F446973

General Info

Members Datasets Scaffolds Average Seq Length
452 213 904 191

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10473564|Ga0157371_104735641
Length 216
Sequence MTGARVVVVDHHDSYTWNLVHLVAAVTGSLPTVVEHDEVTLDDLAGFSHVVLSPGPGNPLEPGDFAVGREVLLSATVPVLGVCLGMQGLVSVYGGRVGQVAPAHGDTALVEHDGSLLFAGIPSPFTAVRYRSLAALALPDVLVETAWCTGAQGRVVMGVAHREKPLWGVQFHPESVLTEGGYHLLANWLSECGDPSGLAQVEALDARLRRQRMPTG

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
108 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
109 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
110 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
111 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
112 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
115 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
172 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
191 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
192 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2643221546 Microbacterium sp. Root53 Isolate Unclassified
200 2643221561 Nocardioides sp. Root151 Isolate Unclassified
201 2643221576 Nocardioides sp. Root614 Isolate Unclassified
202 2643221590 Nocardioides sp. Root682 Isolate Unclassified
203 2643221604 Nocardioides sp. Root190 Isolate Unclassified
204 2643221641 Nocardioides sp. Root122 Isolate Unclassified
205 2643221696 Nocardioides sp. Root140 Isolate Unclassified
206 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
207 2739367898 Nocardioides sp. CF479 Isolate Unclassified
208 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
209 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
210 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
211 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
212 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
213 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 0.22
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.93
Nodule 0.22
Rhizoplane 4.87
Rhizosphere 75.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10473564 3300013102 Bacteria 922
2 LJQas_1001855 3300000549 Bacteria 3072
3 JGI24740J21852_10020705 3300001979 Bacteria 2289
4 Ga0070683_100000462 3300005329 Bacteria 28410
5 Ga0070683_100161254 3300005329 Bacteria 2128
6 Ga0070683_100230216 3300005329 Bacteria 1762
7 Ga0070683_100260628 3300005329 Bacteria 1649
8 Ga0070666_10364187 3300005335 Bacteria 1036
9 Ga0070680_100034913 3300005336 Bacteria 4057
10 Ga0070682_100007472 3300005337 Bacteria 6162
11 Ga0068868_100149111 3300005338 Bacteria 1925
12 Ga0070660_100008435 3300005339 Bacteria 7205
13 Ga0070687_100060802 3300005343 Bacteria 1994
14 Ga0070687_100250184 3300005343 Bacteria 1101
15 Ga0070692_10036010 3300005345 Bacteria 2510
16 Ga0070675_100551838 3300005354 Bacteria 1042
17 Ga0070659_100052809 3300005366 Bacteria 3197
18 Ga0070659_100088100 3300005366 Bacteria 2486
19 Ga0070667_100042387 3300005367 Bacteria 3819
20 Ga0070663_100056550 3300005455 Bacteria 2811
21 Ga0070678_100703509 3300005456 Bacteria 911
22 Ga0070662_100171473 3300005457 Bacteria 1704
23 Ga0070662_100792968 3300005457 Bacteria 805
24 Ga0070681_10393571 3300005458 Bacteria 1297
25 Ga0070706_101172960 3300005467 Bacteria 706
26 Ga0070698_100001281 3300005471 Bacteria 28053
27 Ga0070679_100137282 3300005530 Bacteria 2426
28 Ga0070684_100030262 3300005535 Bacteria 4598
29 Ga0070684_100129936 3300005535 Bacteria 2272
30 Ga0070684_100570418 3300005535 Bacteria 1051
31 Ga0070664_100108103 3300005564 Bacteria 2425
32 Ga0068857_100009635 3300005577 Bacteria 8393
33 Ga0068857_100500752 3300005577 Bacteria 1140
34 Ga0068856_100521953 3300005614 Bacteria 1209
35 Ga0068856_101110441 3300005614 Bacteria 808
36 Ga0070702_100084169 3300005615 Bacteria 1912
37 Ga0070702_100094591 3300005615 Bacteria 1819
38 Ga0068864_100023143 3300005618 Bacteria 5217
39 Ga0068858_100018823 3300005842 Bacteria 6462
40 Ga0068858_100844965 3300005842 Bacteria 894
41 Ga0068860_100097361 3300005843 Bacteria 2805
42 Ga0081539_10022075 3300005985 Bacteria 4224
43 Ga0081539_10037591 3300005985 Bacteria 2882
44 Ga0075365_10000217 3300006038 Bacteria 19371
45 Ga0075365_10001309 3300006038 Bacteria 11113
46 Ga0075365_10009802 3300006038 Bacteria 5537
47 Ga0075365_10016800 3300006038 Bacteria 4462
48 Ga0075365_10032257 3300006038 Bacteria 3365
49 Ga0075365_10073062 3300006038 Bacteria 2311
50 Ga0075365_10098755 3300006038 Bacteria 1998
51 Ga0075365_10116305 3300006038 Bacteria 1841
52 Ga0075365_10150624 3300006038 Bacteria 1618
53 Ga0075365_10181585 3300006038 Bacteria 1471
54 Ga0075365_10197946 3300006038 Bacteria 1407
55 Ga0075365_10271582 3300006038 Bacteria 1193
56 Ga0075365_10300667 3300006038 Bacteria 1129
57 Ga0075365_10350486 3300006038 Bacteria 1041
58 Ga0075365_10397901 3300006038 Bacteria 972
59 Ga0075365_10653000 3300006038 Bacteria 743
60 Ga0075368_10001032 3300006042 Bacteria 8718
61 Ga0075368_10009161 3300006042 Bacteria 3557
62 Ga0075368_10027832 3300006042 Bacteria 2182
63 Ga0075368_10077576 3300006042 Bacteria 1349
64 Ga0075363_100026925 3300006048 Bacteria 2945
65 Ga0075363_100028762 3300006048 Bacteria 2862
66 Ga0075363_100065441 3300006048 Bacteria 1965
67 Ga0075363_100072350 3300006048 Bacteria 1874
68 Ga0075363_100116349 3300006048 Bacteria 1489
69 Ga0075363_100210841 3300006048 Bacteria 1112
70 Ga0075364_10024880 3300006051 Bacteria 3806
71 Ga0075364_10026558 3300006051 Bacteria 3694
72 Ga0075364_10030165 3300006051 Bacteria 3479
73 Ga0075364_10288542 3300006051 Bacteria 1117
74 Ga0075364_10707325 3300006051 Bacteria 687
75 Ga0075362_10072703 3300006177 Bacteria 1573
76 Ga0075367_10004567 3300006178 Bacteria 6775
77 Ga0075367_10050926 3300006178 Bacteria 2446
78 Ga0075367_10059826 3300006178 Bacteria 2269
79 Ga0097621_100684646 3300006237 Bacteria 943
80 Ga0075370_10002885 3300006353 Bacteria 8061
81 Ga0075370_10064676 3300006353 Bacteria 2086
82 Ga0075370_10266724 3300006353 Bacteria 1016
83 Ga0075430_100021019 3300006846 Bacteria 5548
84 Ga0075434_100972367 3300006871 Bacteria 863
85 Ga0068865_100012774 3300006881 Bacteria 5294
86 Ga0105245_10353801 3300009098 Bacteria 1456
87 Ga0105245_10601012 3300009098 Bacteria 1127
88 Ga0105245_10683063 3300009098 Bacteria 1059
89 Ga0114129_11203644 3300009147 Bacteria 943
90 Ga0105243_10062201 3300009148 Bacteria 2988
91 Ga0105242_10470776 3300009176 Bacteria 1189
92 Ga0105248_10112497 3300009177 Bacteria 3070
93 Ga0105237_10625011 3300009545 Bacteria 1084
94 Ga0105239_10001009 3300010375 Bacteria 39368
95 Ga0105239_10205835 3300010375 Bacteria 2205
96 Ga0105246_10012088 3300011119 Bacteria 5379
97 Ga0157369_10015820 3300013105 Bacteria 8498
98 Ga0157369_10726619 3300013105 Bacteria 1022
99 Ga0163162_10010206 3300013306 Bacteria 9124
100 Ga0157372_10069924 3300013307 Bacteria 3949
101 Ga0157372_10529272 3300013307 Bacteria 1374
102 Ga0157375_10048196 3300013308 Bacteria 4166
103 Ga0157375_10096102 3300013308 Bacteria 3035
104 Ga0163163_10331535 3300014325 Bacteria 1576
105 Ga0163163_10616539 3300014325 Bacteria 1148
106 Ga0157380_10267900 3300014326 Bacteria 1555
107 Ga0157380_11284127 3300014326 Bacteria 779
108 Ga0157377_10204455 3300014745 Bacteria 1256
109 Ga0157377_10216197 3300014745 Bacteria 1225
110 Ga0163161_10200041 3300017792 Bacteria 1539
111 Ga0206353_11351807 3300020082 Bacteria 3195
112 Ga0207688_10010972 3300025901 Bacteria 4931
113 Ga0207647_10010051 3300025904 Bacteria 6694
114 Ga0207647_10032686 3300025904 Bacteria 3339
115 Ga0207647_10045357 3300025904 Bacteria 2743
116 Ga0207705_10013668 3300025909 Bacteria 5857
117 Ga0207705_10058757 3300025909 Bacteria 2774
118 Ga0207707_10337160 3300025912 Bacteria 1300
119 Ga0207707_10966003 3300025912 Bacteria 701
120 Ga0207657_10079517 3300025919 Bacteria 2758
121 Ga0207657_10191548 3300025919 Bacteria 1649
122 Ga0207657_10816975 3300025919 Bacteria 720
123 Ga0207652_10072383 3300025921 Bacteria 2997
124 Ga0207659_10310210 3300025926 Bacteria 1299
125 Ga0207687_10002941 3300025927 Bacteria 11560
126 Ga0207690_10067500 3300025932 Bacteria 2453
127 Ga0207690_10119709 3300025932 Bacteria 1910
128 Ga0207690_10137430 3300025932 Bacteria 1796
129 Ga0207706_10185927 3300025933 Bacteria 1824
130 Ga0207706_10597348 3300025933 Bacteria 948
131 Ga0207704_10054238 3300025938 Bacteria 2443
132 Ga0207691_10612199 3300025940 Bacteria 922
133 Ga0207711_11049370 3300025941 Bacteria 755
134 Ga0207689_10095094 3300025942 Bacteria 2447
135 Ga0207661_10009652 3300025944 Bacteria 6930
136 Ga0207661_10172988 3300025944 Bacteria 1881
137 Ga0207661_10308191 3300025944 Bacteria 1421
138 Ga0207661_10338300 3300025944 Bacteria 1356
139 Ga0207661_10818228 3300025944 Bacteria 857
140 Ga0207679_10132092 3300025945 Bacteria 2004
141 Ga0207679_10566108 3300025945 Bacteria 1021
142 Ga0207712_10872642 3300025961 Bacteria 794
143 Ga0207668_10123708 3300025972 Bacteria 1963
144 Ga0207658_10007365 3300025986 Bacteria 7503
145 Ga0207658_10554388 3300025986 Bacteria 1029
146 Ga0207703_10043536 3300026035 Bacteria 3604
147 Ga0207639_10487507 3300026041 Bacteria 1124
148 Ga0207708_10020029 3300026075 Bacteria 5045
149 Ga0207702_10517496 3300026078 Bacteria 1165
150 Ga0207702_11004462 3300026078 Bacteria 828
151 Ga0207641_10193037 3300026088 Bacteria 1873
152 Ga0207676_10024501 3300026095 Bacteria 4466
153 Ga0207674_10009194 3300026116 Bacteria 11327
154 Ga0207683_10091647 3300026121 Bacteria 2708
155 Ga0207683_10869488 3300026121 Bacteria 837
156 Ga0207698_10537400 3300026142 Bacteria 1143
157 Ga0209813_10000255 3300027866 Bacteria 15495
158 Ga0209813_10005792 3300027866 Bacteria 3020
159 Ga0268266_10004282 3300028379 Bacteria 13735
160 Ga0268266_10183919 3300028379 Bacteria 1905
161 Ga0268264_10000420 3300028381 Bacteria 59901
162 Ga0316178_1037578 3300030735 Bacteria 740
163 Ga0307408_100442442 3300031548 Bacteria 1126
164 Ga0307408_101294453 3300031548 Bacteria 683
165 Ga0307405_10350982 3300031731 Bacteria 1138
166 Ga0307413_10204145 3300031824 Bacteria 1430
167 Ga0307413_10412068 3300031824 Bacteria 1062
168 Ga0307413_11053887 3300031824 Bacteria 700
169 Ga0307407_10079753 3300031903 Bacteria 1976
170 Ga0307407_10235960 3300031903 Bacteria 1245
171 Ga0307407_10313819 3300031903 Bacteria 1098
172 Ga0307407_10324797 3300031903 Bacteria 1081
173 Ga0307407_10946466 3300031903 Bacteria 663
174 Ga0307412_10045453 3300031911 Bacteria 2871
175 Ga0307412_10056918 3300031911 Bacteria 2608
176 Ga0307409_100187143 3300031995 Bacteria 1839
177 Ga0307409_100227027 3300031995 Bacteria 1690
178 Ga0307409_100351702 3300031995 Bacteria 1391
179 Ga0307409_100617395 3300031995 Bacteria 1074
180 Ga0307409_100645997 3300031995 Bacteria 1051
181 Ga0307409_100792570 3300031995 Bacteria 954
182 Ga0307416_100142323 3300032002 Bacteria 2182
183 Ga0307416_101896998 3300032002 Bacteria 699
184 Ga0307414_10146790 3300032004 Bacteria 1855
185 Ga0307414_10233563 3300032004 Bacteria 1518
186 Ga0307414_10799428 3300032004 Bacteria 860
187 Ga0307411_10046443 3300032005 Bacteria 2800
188 Ga0307411_10440756 3300032005 Bacteria 1087
189 Ga0307411_10631391 3300032005 Bacteria 925
190 Ga0307415_100100416 3300032126 Bacteria 2120
191 Ga0307415_100199968 3300032126 Bacteria 1585
192 Ga0307415_100506197 3300032126 Bacteria 1057
193 Ga0307415_100550031 3300032126 Bacteria 1018
194 Ga0373931_0782692 3300035691 Bacteria 635
195 Ga0395900_0266119 3300037418 Bacteria 1710
196 Ga0395900_0335049 3300037418 Bacteria 1490
197 Ga0395898_0175362 3300037466 Bacteria 2049
198 Ga0395905_0135619 3300037471 Bacteria 2315
199 Ga0395901_0086882 3300038443 Bacteria 3270
200 Ga0242420_034105 3300038996 Bacteria 954
201 Ga0439447_055409 3300041407 Bacteria 940
202 Ga0439465_0056201 3300041413 Bacteria 1297
203 Ga0451800_1417411 3300041459 Bacteria 749
204 Ga0451837_0232147 3300041494 Bacteria 665
205 Ga0439431_0021598 3300041997 Bacteria 1546
206 Ga0439431_0102019 3300041997 Bacteria 789
207 Ga0439442_034858 3300042002 Bacteria 1052
208 Ga0439448_0113717 3300042005 Bacteria 926
209 Ga0450907_006575 3300042146 Bacteria 1943
210 Ga0439446_0001437 3300042156 Bacteria 5424
211 Ga0439446_0030601 3300042156 Bacteria 1556
212 Ga0439458_0065519 3300042157 Bacteria 912
213 Ga0439434_0003417 3300042435 Bacteria 4640
214 Ga0466972_0079836 3300044658 Bacteria 1558
215 Ga0466972_0119605 3300044658 Bacteria 1243
216 Ga0466972_0154221 3300044658 Bacteria 1079
217 Ga0466965_0001990 3300044683 Bacteria 8546
218 Ga0466965_0027270 3300044683 Bacteria 2772
219 Ga0466965_0204713 3300044683 Bacteria 1048
220 Ga0466966_0188553 3300044684 Bacteria 1250
221 Ga0466961_0095273 3300044693 Bacteria 1877
222 Ga0466961_0106959 3300044693 Bacteria 1761
223 Ga0466963_0021050 3300044694 Bacteria 4110
224 Ga0466963_0102007 3300044694 Bacteria 1965
225 Ga0466964_0189433 3300044706 Bacteria 981
226 Ga0466968_0118253 3300044735 Bacteria 1197
227 Ga0466968_0158618 3300044735 Bacteria 1043
228 Ga0466970_0005374 3300044765 Bacteria 6354
229 Ga0466970_0041549 3300044765 Bacteria 2444
230 Ga0466970_0068677 3300044765 Bacteria 1904
231 Ga0466970_0151563 3300044765 Bacteria 1280
232 Ga0466970_0163575 3300044765 Bacteria 1231
233 Ga0466970_0200701 3300044765 Bacteria 1110
234 Ga0466970_0224221 3300044765 Bacteria 1049
235 Ga0466970_0398890 3300044765 Bacteria 785
236 Ga0466970_0404881 3300044765 Bacteria 779
237 Ga0466957_0228467 3300044842 Bacteria 1231
238 Ga0466957_0243063 3300044842 Bacteria 1195
239 Ga0466957_0360733 3300044842 Bacteria 987
240 Ga0466957_0496617 3300044842 Bacteria 845
241 Ga0466957_0537199 3300044842 Bacteria 814
242 Ga0466960_0016467 3300044901 Bacteria 3209
243 Ga0466960_0017023 3300044901 Bacteria 3163
244 Ga0466960_0050296 3300044901 Bacteria 2009
245 Ga0466960_0124855 3300044901 Bacteria 1352
246 Ga0466960_0156413 3300044901 Bacteria 1221
247 Ga0466960_0253595 3300044901 Bacteria 978
248 Ga0451576_0165641 3300045051 Bacteria 2307
249 Ga0466958_0009817 3300045836 Bacteria 5341
250 Ga0466958_0412309 3300045836 Bacteria 873
251 Ga0466967_0175363 3300045976 Bacteria 2019
252 Ga0466967_0264549 3300045976 Bacteria 1646
253 Ga0466967_0304050 3300045976 Bacteria 1535
254 Ga0466967_0327099 3300045976 Bacteria 1480
255 Ga0466967_0771811 3300045976 Bacteria 954
256 Ga0495630_0246773 3300046517 Bacteria 1364
257 Ga0495635_0212484 3300046663 Bacteria 1310
258 Ga0495602_0561227 3300048088 Bacteria 790
259 Ga0496100_0275287 3300048903 Bacteria 1253
260 Ga0496101_0104532 3300048904 Bacteria 2124
261 Ga0496102_0000672 3300048905 Bacteria 34232
262 Ga0496102_0232856 3300048905 Bacteria 1736
263 Ga0496103_0292119 3300048906 Bacteria 1048
264 Ga0496103_0549391 3300048906 Bacteria 737
265 Ga0496105_0220317 3300048908 Bacteria 1545
266 Ga0496106_0046030 3300048909 Bacteria 3278
267 Ga0496106_0142994 3300048909 Bacteria 1883
268 Ga0496107_0087378 3300048910 Bacteria 2276
269 Ga0496108_0007012 3300048911 Bacteria 9125
270 Ga0496108_0273227 3300048911 Bacteria 1471
271 Ga0496109_0003196 3300048912 Bacteria 13632
272 Ga0496110_0004594 3300048913 Bacteria 10724
273 Ga0496110_0764893 3300048913 Bacteria 869
274 Ga0496111_0001750 3300048914 Bacteria 12709
275 Ga0496111_0119249 3300048914 Bacteria 1948
276 Ga0496111_0153129 3300048914 Bacteria 1711
277 Ga0496113_0323565 3300048916 Bacteria 1236
278 Ga0496114_0285649 3300048917 Bacteria 1455
279 Ga0496114_0572041 3300048917 Bacteria 997
280 Ga0501031_0002249 3300049568 Bacteria 12224
281 Ga0501031_0075728 3300049568 Bacteria 2191
282 Ga0501031_0203999 3300049568 Bacteria 1290
283 Ga0501031_0401812 3300049568 Bacteria 886
284 Ga0501031_0710050 3300049568 Bacteria 645
285 Ga0501032_0004788 3300049569 Bacteria 10148
286 Ga0501032_0061495 3300049569 Bacteria 2517
287 Ga0501032_0069875 3300049569 Bacteria 2343
288 Ga0501033_0046912 3300049570 Bacteria 3213
289 Ga0501033_0230135 3300049570 Bacteria 1317
290 Ga0501034_0021172 3300049571 Bacteria 6632
291 Ga0501034_0321982 3300049571 Bacteria 1479
292 Ga0501036_0005662 3300049572 Bacteria 10137
293 Ga0501036_0028959 3300049572 Bacteria 4680
294 Ga0501036_0053277 3300049572 Bacteria 3426
295 Ga0501036_0099756 3300049572 Bacteria 2456
296 Ga0501037_0001297 3300049573 Bacteria 18375
297 Ga0501037_0150484 3300049573 Bacteria 1664
298 Ga0501037_0753971 3300049573 Bacteria 645
299 Ga0501038_0005098 3300049574 Bacteria 12211
300 Ga0501038_0020109 3300049574 Bacteria 6007
301 Ga0501038_0031157 3300049574 Bacteria 4715
302 Ga0501038_0037292 3300049574 Bacteria 4262
303 Ga0501038_0554871 3300049574 Bacteria 873
304 Ga0501039_0034964 3300049575 Bacteria 3878
305 Ga0501039_0057235 3300049575 Bacteria 3019
306 Ga0501039_0094585 3300049575 Bacteria 2329
307 Ga0501039_0146711 3300049575 Bacteria 1854
308 Ga0501039_0157786 3300049575 Bacteria 1783
309 Ga0501040_0012164 3300049576 Bacteria 5636
310 Ga0501040_0033232 3300049576 Bacteria 3493
311 Ga0501041_0145099 3300049577 Bacteria 1481
312 Ga0501042_0010738 3300049578 Bacteria 6156
313 Ga0501042_0022623 3300049578 Bacteria 4392
314 Ga0501042_0090504 3300049578 Bacteria 2196
315 Ga0501042_0229525 3300049578 Bacteria 1339
316 Ga0501042_0485231 3300049578 Bacteria 897
317 Ga0501042_0657031 3300049578 Bacteria 762
318 Ga0501042_0701979 3300049578 Bacteria 736
319 Ga0501043_0023742 3300049579 Bacteria 4810
320 Ga0501043_0068540 3300049579 Bacteria 2786
321 Ga0501043_0122053 3300049579 Bacteria 2044
322 Ga0501046_0007475 3300049580 Bacteria 9597
323 Ga0501046_0041194 3300049580 Bacteria 3686
324 Ga0501046_0077165 3300049580 Bacteria 2580
325 Ga0501046_0148844 3300049580 Bacteria 1767
326 Ga0501047_0055722 3300049581 Bacteria 3822
327 Ga0501047_0125799 3300049581 Bacteria 2443
328 Ga0501048_0033030 3300049582 Bacteria 3739
329 Ga0501048_0033638 3300049582 Bacteria 3702
330 Ga0501067_0011348 3300049583 Bacteria 4935
331 Ga0501067_0014573 3300049583 Bacteria 4352
332 Ga0501067_0093278 3300049583 Bacteria 1671
333 Ga0501067_0194198 3300049583 Bacteria 1131
334 Ga0501067_0245135 3300049583 Bacteria 997
335 Ga0501068_0060393 3300049584 Bacteria 2302
336 Ga0501068_0249356 3300049584 Bacteria 1131
337 Ga0501069_0006593 3300049585 Bacteria 6070
338 Ga0501069_0015186 3300049585 Bacteria 4127
339 Ga0501069_0103480 3300049585 Bacteria 1618
340 Ga0501069_0140837 3300049585 Bacteria 1384
341 Ga0501069_0146571 3300049585 Bacteria 1355
342 Ga0501070_0000852 3300049586 Bacteria 27667
343 Ga0501070_0044489 3300049586 Bacteria 3694
344 Ga0501070_0135385 3300049586 Bacteria 2034
345 Ga0501070_0141526 3300049586 Bacteria 1986
346 Ga0501070_0508922 3300049586 Bacteria 967
347 Ga0501070_0555396 3300049586 Bacteria 919
348 Ga0501071_0002158 3300049587 Bacteria 11809
349 Ga0501071_0104262 3300049587 Bacteria 2093
350 Ga0501071_0314762 3300049587 Bacteria 1188
351 Ga0501071_0465245 3300049587 Bacteria 968
352 Ga0501072_0020396 3300049588 Bacteria 5135
353 Ga0501072_0028949 3300049588 Bacteria 4324
354 Ga0501073_0069807 3300049589 Bacteria 2448
355 Ga0501073_0090673 3300049589 Bacteria 2124
356 Ga0501073_0187734 3300049589 Bacteria 1430
357 Ga0501073_0339414 3300049589 Bacteria 1037
358 Ga0501074_0012135 3300049590 Bacteria 6264
359 Ga0501074_0078309 3300049590 Bacteria 2372
360 Ga0501074_0161923 3300049590 Bacteria 1598
361 Ga0501075_0014046 3300049591 Bacteria 5732
362 Ga0501075_0045351 3300049591 Bacteria 3300
363 Ga0501075_0240914 3300049591 Bacteria 1379
364 Ga0501076_0006669 3300049592 Bacteria 8375
365 Ga0501076_0170730 3300049592 Bacteria 1773
366 Ga0501076_0180127 3300049592 Bacteria 1723
367 Ga0501076_0859814 3300049592 Bacteria 748
368 Ga0501076_1193669 3300049592 Bacteria 626
369 Ga0501077_0005993 3300049593 Bacteria 7427
370 Ga0501079_0022529 3300049741 Bacteria 4831
371 Ga0501079_0054901 3300049741 Bacteria 3073
372 Ga0501079_0246853 3300049741 Bacteria 1395
373 Ga0501080_0031551 3300049742 Bacteria 4937
374 Ga0501080_0049550 3300049742 Bacteria 3909
375 Ga0501080_0095899 3300049742 Bacteria 2754
376 Ga0501080_0740725 3300049742 Bacteria 865
377 Ga0501081_0015539 3300049743 Bacteria 5025
378 Ga0501081_0028704 3300049743 Bacteria 3756
379 Ga0501081_0314728 3300049743 Bacteria 1150
380 Ga0501081_0418921 3300049743 Bacteria 993
381 Ga0501035_0028431 3300049822 Bacteria 5103
382 Ga0501035_0032707 3300049822 Bacteria 4731
383 Ga0501035_0069273 3300049822 Bacteria 3127
384 Ga0501035_0286047 3300049822 Bacteria 1392
385 Ga0501044_0075192 3300049823 Bacteria 3429
386 Ga0501044_0353179 3300049823 Bacteria 1389
387 Ga0501045_0016350 3300049824 Bacteria 5268
388 Ga0501045_0027772 3300049824 Bacteria 4080
389 Ga0501045_0519326 3300049824 Bacteria 884
390 nmdc:mga03683_49437_c1 3300050489 Bacteria 1751
391 nmdc:mga03n38_103976_c1 3300050490 Bacteria 1374
392 nmdc:mga03n38_129338_c1 3300050490 Bacteria 1249
393 nmdc:mga03n38_378001_c1 3300050490 Bacteria 776
394 nmdc:mga03n38_49424_c1 3300050490 Bacteria 1870
395 nmdc:mga00v17_103896_c1 3300050491 Bacteria 1796
396 nmdc:mga00v17_200562_c1 3300050491 Bacteria 1290
397 nmdc:mga00v17_210106_c1 3300050491 Bacteria 1259
398 nmdc:mga00v17_6677_c1 3300050491 Bacteria 6130
399 nmdc:mga0yw44_150735_c1 3300050492 Bacteria 1516
400 nmdc:mga0yw44_15122_c1 3300050492 Bacteria 4124
401 nmdc:mga0yw44_17806_c1 3300050492 Bacteria 1078
402 nmdc:mga0yw44_19740_c1 3300050492 Bacteria 3724
403 nmdc:mga0yw44_290238_c1 3300050492 Bacteria 1094
404 nmdc:mga0yw44_376722_c1 3300050492 Bacteria 958
405 nmdc:mga0yw44_45544_c1 3300050492 Bacteria 2630
406 nmdc:mga0yw44_61784_c1 3300050492 Bacteria 2299
407 nmdc:mga0yw44_655_c1 3300050492 Bacteria 12616
408 nmdc:mga06z11_19992_c1 3300050494 Bacteria 3089
409 nmdc:mga06z11_358668_c1 3300050494 Bacteria 873
410 nmdc:mga06z11_58984_c1 3300050494 Bacteria 1993
411 nmdc:mga04h51_114882_c1 3300050495 Bacteria 997
412 nmdc:mga04h51_217783_c1 3300050495 Bacteria 755
413 nmdc:mga07m45_19773_c1 3300050496 Bacteria 3651
414 nmdc:mga07m45_44642_c1 3300050496 Bacteria 2488
415 nmdc:mga07m45_545031_c1 3300050496 Bacteria 671
416 nmdc:mga07m45_607847_c1 3300050496 Bacteria 631
417 nmdc:mga0qj67_163111_c1 3300050509 Bacteria 1809
418 nmdc:mga0n895_669694_c1 3300050512 Bacteria 1035
419 Ga0495601_0163584 3300053077 Bacteria 1454
420 Ga0495619_0135516 3300053085 Bacteria 1694
421 Ga0500644_0000204 3300053088 Bacteria 35880
422 Ga0500556_0000317 3300053104 Bacteria 36403
423 Ga0500593_000171 3300053117 Bacteria 26266
424 Ga0500568_0223308 3300053139 Bacteria 688
425 Ga0500573_0004894 3300053140 Bacteria 7101
426 Ga0501084_0045737 3300054114 Bacteria 3664
427 Ga0501084_0053482 3300054114 Bacteria 3377
428 Ga0501084_0586686 3300054114 Bacteria 942
429 Ga0501082_0120893 3300060353 Bacteria 2270
430 Ga0501082_0230344 3300060353 Bacteria 1612
431 Ga0501082_0764829 3300060353 Bacteria 845
432 Ga0466962_0337213 3300061719 Bacteria 749
433 Ga0530510_0041717 3300061734 Bacteria 3313
434 Ga0530510_0047190 3300061734 Bacteria 3112
435 Ga0530510_0058798 3300061734 Bacteria 2780
436 Ga0530510_0068358 3300061734 Bacteria 2577
437 2643752265 2643221546 Bacteria 2910897
438 2643826833 2643221561 Bacteria 4984412
439 2643893642 2643221576 Bacteria 5214352
440 2643962007 2643221590 Bacteria 5214697
441 2644034859 2643221604 Bacteria 5014917
442 2644228165 2643221641 Bacteria 4490190
443 2644534182 2643221696 Bacteria 5431823
444 2738693041 2738541272 Bacteria 6848551
445 2740165657 2739367898 Bacteria 4367674
446 2774395154 2773857762 Bacteria 5971770
447 2809198575 2808606439 Bacteria 5952208
448 2812348748 2811994878 Bacteria 5992952
449 2812352578 2811994878 Bacteria 5992952
450 2855388660 2855386786 Bacteria 4752232
451 2857485430 2857481737 Bacteria 4761446
452 8054612137 8054609563 Bacteria 5170090
453 Ga0157371_10473564
454 LJQas_1001855
455 JGI24740J21852_10020705
456 Ga0070683_100000462
457 Ga0070683_100161254
458 Ga0070683_100230216
459 Ga0070683_100260628
460 Ga0070666_10364187
461 Ga0070680_100034913
462 Ga0070682_100007472
463 Ga0068868_100149111
464 Ga0070660_100008435
465 Ga0070687_100060802
466 Ga0070687_100250184
467 Ga0070692_10036010
468 Ga0070675_100551838
469 Ga0070659_100052809
470 Ga0070659_100088100
471 Ga0070667_100042387
472 Ga0070663_100056550
473 Ga0070678_100703509
474 Ga0070662_100171473
475 Ga0070662_100792968
476 Ga0070681_10393571
477 Ga0070706_101172960
478 Ga0070698_100001281
479 Ga0070679_100137282
480 Ga0070684_100030262
481 Ga0070684_100129936
482 Ga0070684_100570418
483 Ga0070664_100108103
484 Ga0068857_100009635
485 Ga0068857_100500752
486 Ga0068856_100521953
487 Ga0068856_101110441
488 Ga0070702_100084169
489 Ga0070702_100094591
490 Ga0068864_100023143
491 Ga0068858_100018823
492 Ga0068858_100844965
493 Ga0068860_100097361
494 Ga0081539_10022075
495 Ga0081539_10037591
496 Ga0075365_10000217
497 Ga0075365_10001309
498 Ga0075365_10009802
499 Ga0075365_10016800
500 Ga0075365_10032257
501 Ga0075365_10073062
502 Ga0075365_10098755
503 Ga0075365_10116305
504 Ga0075365_10150624
505 Ga0075365_10181585
506 Ga0075365_10197946
507 Ga0075365_10271582
508 Ga0075365_10300667
509 Ga0075365_10350486
510 Ga0075365_10397901
511 Ga0075365_10653000
512 Ga0075368_10001032
513 Ga0075368_10009161
514 Ga0075368_10027832
515 Ga0075368_10077576
516 Ga0075363_100026925
517 Ga0075363_100028762
518 Ga0075363_100065441
519 Ga0075363_100072350
520 Ga0075363_100116349
521 Ga0075363_100210841
522 Ga0075364_10024880
523 Ga0075364_10026558
524 Ga0075364_10030165
525 Ga0075364_10288542
526 Ga0075364_10707325
527 Ga0075362_10072703
528 Ga0075367_10004567
529 Ga0075367_10050926
530 Ga0075367_10059826
531 Ga0097621_100684646
532 Ga0075370_10002885
533 Ga0075370_10064676
534 Ga0075370_10266724
535 Ga0075430_100021019
536 Ga0075434_100972367
537 Ga0068865_100012774
538 Ga0105245_10353801
539 Ga0105245_10601012
540 Ga0105245_10683063
541 Ga0114129_11203644
542 Ga0105243_10062201
543 Ga0105242_10470776
544 Ga0105248_10112497
545 Ga0105237_10625011
546 Ga0105239_10001009
547 Ga0105239_10205835
548 Ga0105246_10012088
549 Ga0157369_10015820
550 Ga0157369_10726619
551 Ga0163162_10010206
552 Ga0157372_10069924
553 Ga0157372_10529272
554 Ga0157375_10048196
555 Ga0157375_10096102
556 Ga0163163_10331535
557 Ga0163163_10616539
558 Ga0157380_10267900
559 Ga0157380_11284127
560 Ga0157377_10204455
561 Ga0157377_10216197
562 Ga0163161_10200041
563 Ga0206353_11351807
564 Ga0207688_10010972
565 Ga0207647_10010051
566 Ga0207647_10032686
567 Ga0207647_10045357
568 Ga0207705_10013668
569 Ga0207705_10058757
570 Ga0207707_10337160
571 Ga0207707_10966003
572 Ga0207657_10079517
573 Ga0207657_10191548
574 Ga0207657_10816975
575 Ga0207652_10072383
576 Ga0207659_10310210
577 Ga0207687_10002941
578 Ga0207690_10067500
579 Ga0207690_10119709
580 Ga0207690_10137430
581 Ga0207706_10185927
582 Ga0207706_10597348
583 Ga0207704_10054238
584 Ga0207691_10612199
585 Ga0207711_11049370
586 Ga0207689_10095094
587 Ga0207661_10009652
588 Ga0207661_10172988
589 Ga0207661_10308191
590 Ga0207661_10338300
591 Ga0207661_10818228
592 Ga0207679_10132092
593 Ga0207679_10566108
594 Ga0207712_10872642
595 Ga0207668_10123708
596 Ga0207658_10007365
597 Ga0207658_10554388
598 Ga0207703_10043536
599 Ga0207639_10487507
600 Ga0207708_10020029
601 Ga0207702_10517496
602 Ga0207702_11004462
603 Ga0207641_10193037
604 Ga0207676_10024501
605 Ga0207674_10009194
606 Ga0207683_10091647
607 Ga0207683_10869488
608 Ga0207698_10537400
609 Ga0209813_10000255
610 Ga0209813_10005792
611 Ga0268266_10004282
612 Ga0268266_10183919
613 Ga0268264_10000420
614 Ga0316178_1037578
615 Ga0307408_100442442
616 Ga0307408_101294453
617 Ga0307405_10350982
618 Ga0307413_10204145
619 Ga0307413_10412068
620 Ga0307413_11053887
621 Ga0307407_10079753
622 Ga0307407_10235960
623 Ga0307407_10313819
624 Ga0307407_10324797
625 Ga0307407_10946466
626 Ga0307412_10045453
627 Ga0307412_10056918
628 Ga0307409_100187143
629 Ga0307409_100227027
630 Ga0307409_100351702
631 Ga0307409_100617395
632 Ga0307409_100645997
633 Ga0307409_100792570
634 Ga0307416_100142323
635 Ga0307416_101896998
636 Ga0307414_10146790
637 Ga0307414_10233563
638 Ga0307414_10799428
639 Ga0307411_10046443
640 Ga0307411_10440756
641 Ga0307411_10631391
642 Ga0307415_100100416
643 Ga0307415_100199968
644 Ga0307415_100506197
645 Ga0307415_100550031
646 Ga0373931_0782692
647 Ga0395900_0266119
648 Ga0395900_0335049
649 Ga0395898_0175362
650 Ga0395905_0135619
651 Ga0395901_0086882
652 Ga0242420_034105
653 Ga0439447_055409
654 Ga0439465_0056201
655 Ga0451800_1417411
656 Ga0451837_0232147
657 Ga0439431_0021598
658 Ga0439431_0102019
659 Ga0439442_034858
660 Ga0439448_0113717
661 Ga0450907_006575
662 Ga0439446_0001437
663 Ga0439446_0030601
664 Ga0439458_0065519
665 Ga0439434_0003417
666 Ga0466972_0079836
667 Ga0466972_0119605
668 Ga0466972_0154221
669 Ga0466965_0001990
670 Ga0466965_0027270
671 Ga0466965_0204713
672 Ga0466966_0188553
673 Ga0466961_0095273
674 Ga0466961_0106959
675 Ga0466963_0021050
676 Ga0466963_0102007
677 Ga0466964_0189433
678 Ga0466968_0118253
679 Ga0466968_0158618
680 Ga0466970_0005374
681 Ga0466970_0041549
682 Ga0466970_0068677
683 Ga0466970_0151563
684 Ga0466970_0163575
685 Ga0466970_0200701
686 Ga0466970_0224221
687 Ga0466970_0398890
688 Ga0466970_0404881
689 Ga0466957_0228467
690 Ga0466957_0243063
691 Ga0466957_0360733
692 Ga0466957_0496617
693 Ga0466957_0537199
694 Ga0466960_0016467
695 Ga0466960_0017023
696 Ga0466960_0050296
697 Ga0466960_0124855
698 Ga0466960_0156413
699 Ga0466960_0253595
700 Ga0451576_0165641
701 Ga0466958_0009817
702 Ga0466958_0412309
703 Ga0466967_0175363
704 Ga0466967_0264549
705 Ga0466967_0304050
706 Ga0466967_0327099
707 Ga0466967_0771811
708 Ga0495630_0246773
709 Ga0495635_0212484
710 Ga0495602_0561227
711 Ga0496100_0275287
712 Ga0496101_0104532
713 Ga0496102_0000672
714 Ga0496102_0232856
715 Ga0496103_0292119
716 Ga0496103_0549391
717 Ga0496105_0220317
718 Ga0496106_0046030
719 Ga0496106_0142994
720 Ga0496107_0087378
721 Ga0496108_0007012
722 Ga0496108_0273227
723 Ga0496109_0003196
724 Ga0496110_0004594
725 Ga0496110_0764893
726 Ga0496111_0001750
727 Ga0496111_0119249
728 Ga0496111_0153129
729 Ga0496113_0323565
730 Ga0496114_0285649
731 Ga0496114_0572041
732 Ga0501031_0002249
733 Ga0501031_0075728
734 Ga0501031_0203999
735 Ga0501031_0401812
736 Ga0501031_0710050
737 Ga0501032_0004788
738 Ga0501032_0061495
739 Ga0501032_0069875
740 Ga0501033_0046912
741 Ga0501033_0230135
742 Ga0501034_0021172
743 Ga0501034_0321982
744 Ga0501036_0005662
745 Ga0501036_0028959
746 Ga0501036_0053277
747 Ga0501036_0099756
748 Ga0501037_0001297
749 Ga0501037_0150484
750 Ga0501037_0753971
751 Ga0501038_0005098
752 Ga0501038_0020109
753 Ga0501038_0031157
754 Ga0501038_0037292
755 Ga0501038_0554871
756 Ga0501039_0034964
757 Ga0501039_0057235
758 Ga0501039_0094585
759 Ga0501039_0146711
760 Ga0501039_0157786
761 Ga0501040_0012164
762 Ga0501040_0033232
763 Ga0501041_0145099
764 Ga0501042_0010738
765 Ga0501042_0022623
766 Ga0501042_0090504
767 Ga0501042_0229525
768 Ga0501042_0485231
769 Ga0501042_0657031
770 Ga0501042_0701979
771 Ga0501043_0023742
772 Ga0501043_0068540
773 Ga0501043_0122053
774 Ga0501046_0007475
775 Ga0501046_0041194
776 Ga0501046_0077165
777 Ga0501046_0148844
778 Ga0501047_0055722
779 Ga0501047_0125799
780 Ga0501048_0033030
781 Ga0501048_0033638
782 Ga0501067_0011348
783 Ga0501067_0014573
784 Ga0501067_0093278
785 Ga0501067_0194198
786 Ga0501067_0245135
787 Ga0501068_0060393
788 Ga0501068_0249356
789 Ga0501069_0006593
790 Ga0501069_0015186
791 Ga0501069_0103480
792 Ga0501069_0140837
793 Ga0501069_0146571
794 Ga0501070_0000852
795 Ga0501070_0044489
796 Ga0501070_0135385
797 Ga0501070_0141526
798 Ga0501070_0508922
799 Ga0501070_0555396
800 Ga0501071_0002158
801 Ga0501071_0104262
802 Ga0501071_0314762
803 Ga0501071_0465245
804 Ga0501072_0020396
805 Ga0501072_0028949
806 Ga0501073_0069807
807 Ga0501073_0090673
808 Ga0501073_0187734
809 Ga0501073_0339414
810 Ga0501074_0012135
811 Ga0501074_0078309
812 Ga0501074_0161923
813 Ga0501075_0014046
814 Ga0501075_0045351
815 Ga0501075_0240914
816 Ga0501076_0006669
817 Ga0501076_0170730
818 Ga0501076_0180127
819 Ga0501076_0859814
820 Ga0501076_1193669
821 Ga0501077_0005993
822 Ga0501079_0022529
823 Ga0501079_0054901
824 Ga0501079_0246853
825 Ga0501080_0031551
826 Ga0501080_0049550
827 Ga0501080_0095899
828 Ga0501080_0740725
829 Ga0501081_0015539
830 Ga0501081_0028704
831 Ga0501081_0314728
832 Ga0501081_0418921
833 Ga0501035_0028431
834 Ga0501035_0032707
835 Ga0501035_0069273
836 Ga0501035_0286047
837 Ga0501044_0075192
838 Ga0501044_0353179
839 Ga0501045_0016350
840 Ga0501045_0027772
841 Ga0501045_0519326
842 nmdc:mga03683_49437_c1
843 nmdc:mga03n38_103976_c1
844 nmdc:mga03n38_129338_c1
845 nmdc:mga03n38_378001_c1
846 nmdc:mga03n38_49424_c1
847 nmdc:mga00v17_103896_c1
848 nmdc:mga00v17_200562_c1
849 nmdc:mga00v17_210106_c1
850 nmdc:mga00v17_6677_c1
851 nmdc:mga0yw44_150735_c1
852 nmdc:mga0yw44_15122_c1
853 nmdc:mga0yw44_17806_c1
854 nmdc:mga0yw44_19740_c1
855 nmdc:mga0yw44_290238_c1
856 nmdc:mga0yw44_376722_c1
857 nmdc:mga0yw44_45544_c1
858 nmdc:mga0yw44_61784_c1
859 nmdc:mga0yw44_655_c1
860 nmdc:mga06z11_19992_c1
861 nmdc:mga06z11_358668_c1
862 nmdc:mga06z11_58984_c1
863 nmdc:mga04h51_114882_c1
864 nmdc:mga04h51_217783_c1
865 nmdc:mga07m45_19773_c1
866 nmdc:mga07m45_44642_c1
867 nmdc:mga07m45_545031_c1
868 nmdc:mga07m45_607847_c1
869 nmdc:mga0qj67_163111_c1
870 nmdc:mga0n895_669694_c1
871 Ga0495601_0163584
872 Ga0495619_0135516
873 Ga0500644_0000204
874 Ga0500556_0000317
875 Ga0500593_000171
876 Ga0500568_0223308
877 Ga0500573_0004894
878 Ga0501084_0045737
879 Ga0501084_0053482
880 Ga0501084_0586686
881 Ga0501082_0120893
882 Ga0501082_0230344
883 Ga0501082_0764829
884 Ga0466962_0337213
885 Ga0530510_0041717
886 Ga0530510_0047190
887 Ga0530510_0058798
888 Ga0530510_0068358
889 2643752265
890 2643826833
891 2643893642
892 2643962007
893 2644034859
894 2644228165
895 2644534182
896 2738693041
897 2740165657
898 2774395154
899 2809198575
900 2812348748
901 2812352578
902 2855388660
903 2857485430
904 8054612137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

7

192

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9194 13 200
7d95-assembly1.cif.gz_B crystal structure of acivicin-bound gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.91 14 198
7d40-assembly2.cif.gz_B crystal structure of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9077 14 198
8hx8-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate 0.9044 12 196
8hx8-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate 0.9031 12 196
ID Description Score Start End Superfamily
1qdlB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9194 13 200 3.40.50.880
af_Q8I2T0_6_209_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9128 14 199 3.40.50.880
af_A0A1D8PMB0_37_257_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9126 12 196 3.40.50.880
af_Q57690_3_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9066 12 199 3.40.50.880
2a9vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9023 12 198 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A417XZT2-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9761 11 200 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A495NRX8-F1-model_v4 deleted 0.9733 11 201
AF-A0A6J4PCE1-F1-model_v4 Anthranilate synthase, amidotransferase component @ Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85, EC 4.1.3.27) 0.9713 11 198 GO:0000162
GO:0004049
GO:0005829
GO:0006541
GO:0046820
AF-A0A7Y5TBB1-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9681 12 200 GO:0000162
GO:0004049
GO:0005829
GO:0006541
AF-A0A7Y5TBB1-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9579 12 200 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Map