F446952

General Info

Members Datasets Scaffolds Average Seq Length
452 254 904 205

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10143344|Ga0075433_101433442
Length 234
Sequence MLVKRIQTVRMMHTDSTNVKSEPGLDTARRPQSGSGSARPPSRKAAQSEVTRAKLVRAGRRLFGKRGYADVGTEEIVRAAGVTRGALYHQFADKRELFAAVFEDTEAELIAEAAQRVATTDDPLEALRGGFQGWLEACSRPAVQRIVLVDAPAVLGWEEWRAIGERHGLGVTMAALQAGIDAGAIAPQPVRPLAHVVVGALDEAALYVARADDPETAREEMALILDRLIDSLRA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.54
Nodule 0
Rhizoplane 12.17
Rhizosphere 80.97
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10143344 3300006852 Bacteria 2124
2 Ga0070658_10281080 3300005327 Bacteria 1417
3 Ga0070683_100006278 3300005329 Bacteria 9970
4 Ga0070690_100192526 3300005330 Bacteria 1415
5 Ga0070670_100249160 3300005331 Bacteria 1547
6 Ga0068869_100170168 3300005334 Bacteria 1702
7 Ga0070680_100530481 3300005336 Bacteria 1008
8 Ga0070680_100578272 3300005336 Bacteria 964
9 Ga0070682_100005699 3300005337 Bacteria 6940
10 Ga0068868_100061069 3300005338 Bacteria 2985
11 Ga0068868_100166295 3300005338 Bacteria 1824
12 Ga0070660_100101494 3300005339 Bacteria 2280
13 Ga0070660_100252940 3300005339 Bacteria 1437
14 Ga0070689_100129109 3300005340 Bacteria 2026
15 Ga0070691_10021575 3300005341 Bacteria 2981
16 Ga0070661_100025647 3300005344 Bacteria 4238
17 Ga0070661_100137295 3300005344 Bacteria 1841
18 Ga0070692_10131396 3300005345 Bacteria 1407
19 Ga0070668_100108984 3300005347 Bacteria 2203
20 Ga0070675_100431490 3300005354 Bacteria 1180
21 Ga0070671_100028943 3300005355 Bacteria 4566
22 Ga0070671_100217331 3300005355 Bacteria 1621
23 Ga0070671_100360336 3300005355 Bacteria 1241
24 Ga0070674_100019963 3300005356 Bacteria 4270
25 Ga0070674_100039482 3300005356 Bacteria 3188
26 Ga0070688_100333044 3300005365 Bacteria 1106
27 Ga0070659_100087543 3300005366 Bacteria 2494
28 Ga0070667_100087163 3300005367 Bacteria 2679
29 Ga0070714_100001154 3300005435 Bacteria 19020
30 Ga0070710_10156322 3300005437 Bacteria 1410
31 Ga0070710_10492085 3300005437 Bacteria 838
32 Ga0070701_10073539 3300005438 Bacteria 1833
33 Ga0070711_100003191 3300005439 Bacteria 9517
34 Ga0070711_100003694 3300005439 Bacteria 8959
35 Ga0070711_100028605 3300005439 Bacteria 3669
36 Ga0070711_100247968 3300005439 Bacteria 1395
37 Ga0070705_100324675 3300005440 Bacteria 1113
38 Ga0070705_100561743 3300005440 Bacteria 877
39 Ga0070700_100002691 3300005441 Bacteria 9080
40 Ga0070700_100297792 3300005441 Bacteria 1176
41 Ga0070700_100596151 3300005441 Bacteria 865
42 Ga0070708_100198297 3300005445 Bacteria 1878
43 Ga0070663_100033074 3300005455 Bacteria 3569
44 Ga0070663_100121522 3300005455 Bacteria 1973
45 Ga0070678_100012815 3300005456 Bacteria 5229
46 Ga0070678_100022756 3300005456 Bacteria 4160
47 Ga0070662_100056007 3300005457 Bacteria 2862
48 Ga0068867_100648312 3300005459 Bacteria 926
49 Ga0070706_100004739 3300005467 Bacteria 13042
50 Ga0070707_100329028 3300005468 Bacteria 1485
51 Ga0070699_100007976 3300005518 Bacteria 9194
52 Ga0070679_100040397 3300005530 Bacteria 4641
53 Ga0070684_100001296 3300005535 Bacteria 17931
54 Ga0070684_100048842 3300005535 Bacteria 3671
55 Ga0070697_100310249 3300005536 Bacteria 1357
56 Ga0070697_100530922 3300005536 Bacteria 1031
57 Ga0068853_100013514 3300005539 Bacteria 6669
58 Ga0070686_100089229 3300005544 Bacteria 2059
59 Ga0070696_100300814 3300005546 Bacteria 1229
60 Ga0070665_100000244 3300005548 Bacteria 90284
61 Ga0070665_100394068 3300005548 Bacteria 1392
62 Ga0070665_100619252 3300005548 Bacteria 1095
63 Ga0070665_100776309 3300005548 Bacteria 971
64 Ga0070704_100014804 3300005549 Bacteria 4880
65 Ga0070704_100036180 3300005549 Bacteria 3362
66 Ga0070704_100167008 3300005549 Bacteria 1746
67 Ga0068855_100948577 3300005563 Bacteria 906
68 Ga0070664_100263259 3300005564 Bacteria 1552
69 Ga0068857_100533952 3300005577 Bacteria 1104
70 Ga0068856_100005853 3300005614 Bacteria 12117
71 Ga0068856_100071473 3300005614 Bacteria 3435
72 Ga0070702_100006170 3300005615 Bacteria 5651
73 Ga0068852_100039820 3300005616 Bacteria 3960
74 Ga0068852_100455135 3300005616 Bacteria 1268
75 Ga0068859_100195098 3300005617 Bacteria 2109
76 Ga0068859_100681055 3300005617 Bacteria 1120
77 Ga0068864_100008506 3300005618 Bacteria 8468
78 Ga0068861_100272425 3300005719 Bacteria 1454
79 Ga0068851_10035845 3300005834 Bacteria 2482
80 Ga0068870_10064162 3300005840 Bacteria 1983
81 Ga0068863_100221442 3300005841 Bacteria 1823
82 Ga0068863_100997907 3300005841 Bacteria 840
83 Ga0068863_101097697 3300005841 Bacteria 800
84 Ga0068858_100000450 3300005842 Bacteria 43091
85 Ga0068858_100045864 3300005842 Bacteria 4052
86 Ga0068858_100079505 3300005842 Bacteria 3047
87 Ga0068858_100551325 3300005842 Bacteria 1116
88 Ga0068862_100245774 3300005844 Bacteria 1629
89 Ga0068862_100260353 3300005844 Bacteria 1583
90 Ga0081455_10034846 3300005937 Bacteria 4506
91 Ga0081455_10072612 3300005937 Bacteria 2848
92 Ga0081455_10296200 3300005937 Bacteria 1163
93 Ga0081538_10000030 3300005981 Bacteria 124321
94 Ga0081538_10022949 3300005981 Bacteria 4501
95 Ga0081538_10166558 3300005981 Bacteria 969
96 Ga0081539_10005112 3300005985 Bacteria 13728
97 Ga0070717_10032316 3300006028 Bacteria 4217
98 Ga0075365_10000477 3300006038 Bacteria 15128
99 Ga0075365_10001908 3300006038 Bacteria 9825
100 Ga0075365_10047962 3300006038 Bacteria 2810
101 Ga0075364_10063831 3300006051 Bacteria 2418
102 Ga0075364_10075091 3300006051 Bacteria 2230
103 Ga0075364_10179321 3300006051 Bacteria 1433
104 Ga0070715_10064550 3300006163 Bacteria 1617
105 Ga0070716_100035034 3300006173 Bacteria 2757
106 Ga0070716_100084005 3300006173 Bacteria 1908
107 Ga0070716_100205441 3300006173 Bacteria 1312
108 Ga0070712_100004037 3300006175 Bacteria 9007
109 Ga0070712_100234456 3300006175 Bacteria 1459
110 Ga0075370_10119274 3300006353 Bacteria 1535
111 Ga0068871_100179401 3300006358 Bacteria 1819
112 Ga0068871_100314734 3300006358 Bacteria 1377
113 Ga0075428_100765959 3300006844 Bacteria 1027
114 Ga0075430_100516426 3300006846 Bacteria 986
115 Ga0075431_100012056 3300006847 Bacteria 8724
116 Ga0075431_100276700 3300006847 Bacteria 1700
117 Ga0075431_100409676 3300006847 Bacteria 1356
118 Ga0075433_10104067 3300006852 Bacteria 2515
119 Ga0075434_100053614 3300006871 Bacteria 4006
120 Ga0075434_100056225 3300006871 Bacteria 3910
121 Ga0075434_100421090 3300006871 Bacteria 1356
122 Ga0068865_100064509 3300006881 Bacteria 2578
123 Ga0075436_100025434 3300006914 Bacteria 4074
124 Ga0075436_100559266 3300006914 Bacteria 840
125 Ga0097620_100195104 3300006931 Bacteria 2109
126 Ga0097620_100681029 3300006931 Bacteria 1120
127 Ga0075435_100023684 3300007076 Bacteria 4752
128 Ga0075435_100467522 3300007076 Bacteria 1088
129 Ga0105240_10050677 3300009093 Bacteria 5232
130 Ga0111539_10019740 3300009094 Bacteria 8312
131 Ga0111539_10411146 3300009094 Bacteria 1576
132 Ga0105245_10000016 3300009098 Bacteria 204372
133 Ga0105245_10000619 3300009098 Bacteria 32213
134 Ga0105245_10009667 3300009098 Bacteria 8411
135 Ga0105245_10017386 3300009098 Bacteria 6273
136 Ga0105245_10680040 3300009098 Bacteria 1061
137 Ga0105247_10179620 3300009101 Bacteria 1412
138 Ga0114129_11340033 3300009147 Bacteria 885
139 Ga0105243_10155119 3300009148 Bacteria 1968
140 Ga0105243_10753452 3300009148 Bacteria 955
141 Ga0105241_10268905 3300009174 Bacteria 1452
142 Ga0105242_10080904 3300009176 Bacteria 2715
143 Ga0105242_10109501 3300009176 Bacteria 2352
144 Ga0105242_10317799 3300009176 Bacteria 1427
145 Ga0105248_10036189 3300009177 Bacteria 5520
146 Ga0105248_10683478 3300009177 Bacteria 1158
147 Ga0105237_10071442 3300009545 Bacteria 3465
148 Ga0105237_10233645 3300009545 Bacteria 1840
149 Ga0105237_10557365 3300009545 Bacteria 1153
150 Ga0105238_11099722 3300009551 Bacteria 818
151 Ga0105249_10037284 3300009553 Bacteria 4412
152 Ga0105249_10071152 3300009553 Bacteria 3213
153 Ga0105249_10506752 3300009553 Bacteria 1253
154 Ga0105239_10033048 3300010375 Bacteria 5682
155 Ga0105239_10335358 3300010375 Bacteria 1706
156 Ga0105239_10335742 3300010375 Bacteria 1705
157 Ga0105239_10569985 3300010375 Bacteria 1290
158 Ga0105246_10116040 3300011119 Bacteria 1976
159 Ga0105246_10258257 3300011119 Bacteria 1387
160 Ga0157371_10707687 3300013102 Bacteria 754
161 Ga0157370_10322392 3300013104 Bacteria 1425
162 Ga0157369_10712434 3300013105 Bacteria 1033
163 Ga0157374_10020072 3300013296 Bacteria 5925
164 Ga0157378_10110041 3300013297 Bacteria 2524
165 Ga0157378_10204780 3300013297 Bacteria 1868
166 Ga0157378_11100990 3300013297 Bacteria 831
167 Ga0163162_10223183 3300013306 Bacteria 2014
168 Ga0157372_10042346 3300013307 Bacteria 5036
169 Ga0157372_10247247 3300013307 Bacteria 2070
170 Ga0157375_10025972 3300013308 Bacteria 5452
171 Ga0157375_10523111 3300013308 Bacteria 1349
172 Ga0163163_10049541 3300014325 Bacteria 4134
173 Ga0157377_10006199 3300014745 Bacteria 5687
174 Ga0157377_10360920 3300014745 Bacteria 978
175 Ga0157379_10105339 3300014968 Bacteria 2531
176 Ga0157379_10262559 3300014968 Bacteria 1569
177 Ga0157379_10304343 3300014968 Bacteria 1453
178 Ga0157379_10689455 3300014968 Bacteria 958
179 Ga0207692_10141587 3300025898 Bacteria 1368
180 Ga0207710_10165562 3300025900 Bacteria 1079
181 Ga0207688_10002667 3300025901 Bacteria 9664
182 Ga0207688_10146772 3300025901 Bacteria 1391
183 Ga0207688_10235550 3300025901 Bacteria 1106
184 Ga0207699_10274571 3300025906 Bacteria 1169
185 Ga0207705_10076665 3300025909 Bacteria 2431
186 Ga0207654_10075675 3300025911 Bacteria 2012
187 Ga0207707_10391331 3300025912 Bacteria 1194
188 Ga0207695_10920939 3300025913 Bacteria 754
189 Ga0207671_10041366 3300025914 Bacteria 3411
190 Ga0207671_10677367 3300025914 Bacteria 821
191 Ga0207671_11047040 3300025914 Bacteria 642
192 Ga0207693_10007405 3300025915 Bacteria 9028
193 Ga0207693_10022041 3300025915 Bacteria 5065
194 Ga0207663_10026130 3300025916 Bacteria 3385
195 Ga0207663_10124578 3300025916 Bacteria 1770
196 Ga0207663_10134074 3300025916 Bacteria 1716
197 Ga0207663_10299376 3300025916 Bacteria 1201
198 Ga0207660_10088823 3300025917 Bacteria 2286
199 Ga0207660_10438729 3300025917 Bacteria 1055
200 Ga0207660_10769065 3300025917 Bacteria 786
201 Ga0207662_10024228 3300025918 Bacteria 3491
202 Ga0207657_10024349 3300025919 Bacteria 5609
203 Ga0207657_10120305 3300025919 Bacteria 2161
204 Ga0207657_10388145 3300025919 Bacteria 1099
205 Ga0207652_10002251 3300025921 Bacteria 16400
206 Ga0207646_10023780 3300025922 Bacteria 5623
207 Ga0207681_10331632 3300025923 Bacteria 1213
208 Ga0207681_10545606 3300025923 Bacteria 954
209 Ga0207694_10456341 3300025924 Bacteria 1067
210 Ga0207650_10624548 3300025925 Bacteria 907
211 Ga0207687_10158625 3300025927 Bacteria 1734
212 Ga0207687_10273460 3300025927 Bacteria 1351
213 Ga0207687_10361329 3300025927 Bacteria 1185
214 Ga0207700_10129641 3300025928 Bacteria 2057
215 Ga0207664_10007847 3300025929 Bacteria 7415
216 Ga0207644_10122281 3300025931 Bacteria 1983
217 Ga0207690_10129870 3300025932 Bacteria 1843
218 Ga0207706_10051758 3300025933 Bacteria 3626
219 Ga0207686_10064287 3300025934 Bacteria 2336
220 Ga0207686_10079905 3300025934 Bacteria 2131
221 Ga0207686_10219677 3300025934 Bacteria 1371
222 Ga0207686_10236789 3300025934 Bacteria 1327
223 Ga0207670_10075763 3300025936 Bacteria 2340
224 Ga0207670_10215809 3300025936 Bacteria 1466
225 Ga0207669_10555276 3300025937 Bacteria 927
226 Ga0207704_10186468 3300025938 Bacteria 1504
227 Ga0207704_10245059 3300025938 Bacteria 1341
228 Ga0207665_10071187 3300025939 Bacteria 2374
229 Ga0207665_10564951 3300025939 Bacteria 885
230 Ga0207691_10168527 3300025940 Bacteria 1918
231 Ga0207711_10059507 3300025941 Bacteria 3289
232 Ga0207711_10311539 3300025941 Bacteria 1453
233 Ga0207711_10786464 3300025941 Bacteria 886
234 Ga0207711_10796183 3300025941 Bacteria 880
235 Ga0207689_10281237 3300025942 Bacteria 1378
236 Ga0207661_10005187 3300025944 Bacteria 9158
237 Ga0207661_10162394 3300025944 Bacteria 1939
238 Ga0207679_10209056 3300025945 Bacteria 1635
239 Ga0207712_10420020 3300025961 Bacteria 1128
240 Ga0207668_10190049 3300025972 Bacteria 1627
241 Ga0207668_10279210 3300025972 Bacteria 1369
242 Ga0207658_10014913 3300025986 Bacteria 5326
243 Ga0207677_10320253 3300026023 Bacteria 1288
244 Ga0207703_10000322 3300026035 Bacteria 52048
245 Ga0207703_10098969 3300026035 Bacteria 2468
246 Ga0207639_10003640 3300026041 Bacteria 10355
247 Ga0207678_10002490 3300026067 Bacteria 16751
248 Ga0207678_10011774 3300026067 Bacteria 7680
249 Ga0207678_10039331 3300026067 Bacteria 4106
250 Ga0207708_10000288 3300026075 Bacteria 39571
251 Ga0207708_10063375 3300026075 Bacteria 2824
252 Ga0207702_10756669 3300026078 Bacteria 959
253 Ga0207641_10859780 3300026088 Bacteria 899
254 Ga0207648_10684489 3300026089 Bacteria 949
255 Ga0207648_10808439 3300026089 Bacteria 873
256 Ga0207676_10028123 3300026095 Bacteria 4197
257 Ga0207676_10430601 3300026095 Bacteria 1239
258 Ga0207674_10037394 3300026116 Bacteria 5049
259 Ga0207675_100007287 3300026118 Bacteria 10455
260 Ga0207675_100423265 3300026118 Bacteria 1315
261 Ga0207683_10009270 3300026121 Bacteria 8387
262 Ga0207683_10040499 3300026121 Bacteria 4066
263 Ga0207683_10159330 3300026121 Bacteria 2040
264 Ga0207698_11026931 3300026142 Bacteria 836
265 Ga0207428_10010900 3300027907 Bacteria 8091
266 Ga0268266_10000020 3300028379 Bacteria 527065
267 Ga0268266_10000085 3300028379 Bacteria 201288
268 Ga0268266_10640720 3300028379 Bacteria 1022
269 Ga0268265_10176205 3300028380 Bacteria 1833
270 Ga0268264_10210777 3300028381 Bacteria 1783
271 Ga0268264_10342971 3300028381 Bacteria 1420
272 Ga0268264_10577802 3300028381 Bacteria 1105
273 Ga0268264_11454146 3300028381 Bacteria 696
274 Ga0307405_10055547 3300031731 Bacteria 2479
275 Ga0307410_10175577 3300031852 Bacteria 1618
276 Ga0307406_10178756 3300031901 Bacteria 1543
277 Ga0307409_100007635 3300031995 Bacteria 6487
278 Ga0307416_100291408 3300032002 Bacteria 1616
279 Ga0307416_100886270 3300032002 Bacteria 992
280 Ga0307411_10283992 3300032005 Bacteria 1319
281 Ga0307415_100378663 3300032126 Bacteria 1201
282 Ga0307415_100735589 3300032126 Bacteria 894
283 Ga0373950_0036362 3300034818 Bacteria 929
284 Ga0373932_0028523 3300035112 Bacteria 1535
285 Ga0373939_0038560 3300035114 Bacteria 1426
286 Ga0373943_0379495 3300035170 Bacteria 814
287 Ga0373931_0529608 3300035691 Bacteria 763
288 Ga0373927_0416605 3300035695 Bacteria 886
289 Ga0373947_0520427 3300035725 Bacteria 809
290 Ga0395898_0009629 3300037466 Bacteria 10142
291 Ga0395898_0022749 3300037466 Bacteria 6344
292 Ga0395898_1317713 3300037466 Bacteria 651
293 Ga0395905_0050331 3300037471 Bacteria 3903
294 Ga0395901_0002589 3300038443 Bacteria 18335
295 Ga0395901_0096965 3300038443 Bacteria 3090
296 Ga0466961_0152221 3300044693 Bacteria 1444
297 Ga0466970_0107104 3300044765 Bacteria 1525
298 Ga0466960_0001031 3300044901 Bacteria 9972
299 Ga0466960_0347857 3300044901 Bacteria 845
300 Ga0466959_0165140 3300045049 Bacteria 1555
301 Ga0466967_0119369 3300045976 Bacteria 2434
302 Ga0466967_0699449 3300045976 Bacteria 1004
303 Ga0495592_0066594 3300046454 Bacteria 2635
304 Ga0495592_0459510 3300046454 Bacteria 796
305 Ga0495629_0081933 3300046459 Bacteria 2252
306 Ga0495641_0007891 3300046461 Bacteria 6574
307 Ga0495650_0000223 3300046471 Bacteria 118162
308 Ga0495582_0287782 3300046473 Bacteria 944
309 Ga0495594_0433584 3300046499 Bacteria 747
310 Ga0495620_0000246 3300046515 Bacteria 40444
311 Ga0495630_0130273 3300046517 Bacteria 1910
312 Ga0495640_0002854 3300046533 Bacteria 13907
313 Ga0495645_0206484 3300046543 Bacteria 1329
314 Ga0495647_0046588 3300046681 Bacteria 1671
315 Ga0495604_0165597 3300047317 Bacteria 1559
316 Ga0495674_0003030 3300047319 Bacteria 16361
317 Ga0495676_0001513 3300047321 Bacteria 20120
318 Ga0495676_0096723 3300047321 Bacteria 2194
319 Ga0495676_0565271 3300047321 Bacteria 742
320 Ga0495680_0292400 3300047322 Bacteria 1146
321 Ga0495686_0144751 3300047472 Bacteria 1400
322 Ga0495602_0005647 3300048088 Bacteria 13115
323 Ga0495602_0413010 3300048088 Bacteria 960
324 Ga0496100_0000038 3300048903 Bacteria 94110
325 Ga0496100_0137206 3300048903 Bacteria 1729
326 Ga0496100_0187249 3300048903 Bacteria 1500
327 Ga0496100_0717998 3300048903 Bacteria 780
328 Ga0496101_0000221 3300048904 Bacteria 42499
329 Ga0496101_0000361 3300048904 Bacteria 30335
330 Ga0496101_0029241 3300048904 Bacteria 3854
331 Ga0496101_0331831 3300048904 Bacteria 1194
332 Ga0496101_0642738 3300048904 Bacteria 838
333 Ga0496102_0008647 3300048905 Bacteria 8738
334 Ga0496102_0009474 3300048905 Bacteria 8371
335 Ga0496102_0032414 3300048905 Bacteria 4692
336 Ga0496102_0049178 3300048905 Bacteria 3836
337 Ga0496102_0084152 3300048905 Bacteria 2935
338 Ga0496102_0205154 3300048905 Bacteria 1858
339 Ga0496103_0015552 3300048906 Bacteria 4531
340 Ga0496103_0071254 3300048906 Bacteria 2175
341 Ga0496103_0377782 3300048906 Bacteria 910
342 Ga0496103_0378799 3300048906 Bacteria 909
343 Ga0496104_0000033 3300048907 Bacteria 189758
344 Ga0496104_0004818 3300048907 Bacteria 11762
345 Ga0496104_0105920 3300048907 Bacteria 2694
346 Ga0496104_0662469 3300048907 Bacteria 952
347 Ga0496105_0104852 3300048908 Bacteria 2334
348 Ga0496105_0114922 3300048908 Bacteria 2220
349 Ga0496105_0237922 3300048908 Bacteria 1478
350 Ga0496106_0000018 3300048909 Bacteria 175028
351 Ga0496106_0000149 3300048909 Bacteria 51656
352 Ga0496106_0010639 3300048909 Bacteria 6798
353 Ga0496106_0155335 3300048909 Bacteria 1806
354 Ga0496106_0474132 3300048909 Bacteria 1005
355 Ga0496107_0000006 3300048910 Bacteria 258746
356 Ga0496107_0033362 3300048910 Bacteria 3683
357 Ga0496107_0049422 3300048910 Bacteria 3030
358 Ga0496107_0061990 3300048910 Bacteria 2709
359 Ga0496107_0065207 3300048910 Bacteria 2640
360 Ga0496107_0378826 3300048910 Bacteria 1052
361 Ga0496108_0047488 3300048911 Bacteria 3588
362 Ga0496108_0121732 3300048911 Bacteria 2238
363 Ga0496109_0022628 3300048912 Bacteria 5567
364 Ga0496109_0098036 3300048912 Bacteria 2717
365 Ga0496109_0105071 3300048912 Bacteria 2622
366 Ga0496110_0000034 3300048913 Bacteria 65177
367 Ga0496110_0001163 3300048913 Bacteria 18670
368 Ga0496110_0005255 3300048913 Bacteria 10131
369 Ga0496110_0310866 3300048913 Bacteria 1435
370 Ga0496111_0000372 3300048914 Bacteria 22335
371 Ga0496111_0003411 3300048914 Bacteria 9836
372 Ga0496112_0000003 3300048915 Bacteria 660147
373 Ga0496112_0008008 3300048915 Bacteria 9429
374 Ga0496112_0072544 3300048915 Bacteria 3403
375 Ga0496113_0144287 3300048916 Bacteria 1874
376 Ga0496113_0416179 3300048916 Bacteria 1079
377 Ga0496115_0206581 3300048918 Bacteria 1622
378 Ga0496115_0406015 3300048918 Bacteria 1105
379 Ga0496116_0000769 3300048919 Bacteria 40716
380 Ga0496117_0009156 3300048920 Bacteria 9280
381 Ga0496118_0004300 3300048921 Bacteria 17014
382 Ga0496118_0037203 3300048921 Bacteria 3922
383 Ga0496119_0002017 3300048922 Bacteria 22987
384 Ga0496119_0008077 3300048922 Bacteria 9335
385 Ga0496119_0034405 3300048922 Bacteria 3337
386 Ga0496120_0005187 3300048923 Bacteria 10509
387 Ga0496121_0045976 3300048924 Bacteria 3742
388 Ga0496121_0265265 3300048924 Bacteria 1183
389 Ga0496124_0369126 3300048927 Bacteria 1008
390 Ga0496125_0016459 3300048928 Bacteria 7098
391 Ga0496125_0074752 3300048928 Bacteria 2626
392 Ga0496126_0014575 3300048929 Bacteria 7941
393 Ga0496126_0058918 3300048929 Bacteria 3460
394 Ga0501031_0010776 3300049568 Bacteria 5954
395 Ga0501032_0016871 3300049569 Bacteria 5132
396 Ga0501033_0002248 3300049570 Bacteria 16538
397 Ga0501034_0010443 3300049571 Bacteria 9673
398 Ga0501034_0517357 3300049571 Bacteria 1105
399 Ga0501036_0006589 3300049572 Bacteria 9432
400 Ga0501037_0012997 3300049573 Bacteria 6136
401 Ga0501043_0001141 3300049579 Bacteria 23356
402 Ga0501043_0348713 3300049579 Bacteria 1125
403 Ga0501046_0019602 3300049580 Bacteria 5608
404 Ga0501047_0007577 3300049581 Bacteria 10217
405 Ga0501047_0042318 3300049581 Bacteria 4402
406 Ga0501047_0099783 3300049581 Bacteria 2782
407 Ga0501047_0187406 3300049581 Bacteria 1933
408 Ga0501047_0452994 3300049581 Bacteria 1112
409 Ga0501048_0001808 3300049582 Bacteria 16246
410 Ga0501068_0019763 3300049584 Bacteria 3916
411 Ga0501068_0253408 3300049584 Bacteria 1122
412 Ga0501069_0085244 3300049585 Bacteria 1782
413 Ga0501070_0001054 3300049586 Bacteria 24795
414 Ga0501070_0035008 3300049586 Bacteria 4197
415 Ga0501070_0332087 3300049586 Bacteria 1235
416 Ga0501071_0091919 3300049587 Bacteria 2229
417 Ga0501073_0031697 3300049589 Bacteria 3771
418 Ga0501075_0009453 3300049591 Bacteria 6821
419 Ga0501079_0013368 3300049741 Bacteria 6260
420 Ga0501079_0033474 3300049741 Bacteria 3953
421 Ga0501079_0071481 3300049741 Bacteria 2681
422 Ga0501080_0007467 3300049742 Bacteria 9869
423 Ga0501080_0010717 3300049742 Bacteria 8387
424 Ga0501080_0025877 3300049742 Bacteria 5451
425 Ga0501083_0005339 3300049744 Bacteria 9090
426 Ga0501083_0279555 3300049744 Bacteria 1086
427 Ga0501083_0353986 3300049744 Bacteria 954
428 Ga0501035_0001380 3300049822 Bacteria 24967
429 Ga0501044_0005148 3300049823 Bacteria 14573
430 Ga0501044_0009242 3300049823 Bacteria 10765
431 Ga0501044_0116208 3300049823 Bacteria 2681
432 Ga0501044_0158471 3300049823 Unclassified 2242
433 nmdc:mga00v17_135177_c1 3300050491 Bacteria 1578
434 nmdc:mga00v17_283447_c1 3300050491 Bacteria 1076
435 nmdc:mga0yw44_358327_c1 3300050492 Bacteria 983
436 nmdc:mga0yw44_504515_c1 3300050492 Bacteria 821
437 nmdc:mga06z11_183551_c1 3300050494 Bacteria 1207
438 nmdc:mga07m45_115127_c1 3300050496 Bacteria 1550
439 nmdc:mga06r32_121064_c1 3300050510 Bacteria 2582
440 nmdc:mga06r32_146503_c1 3300050510 Bacteria 2338
441 nmdc:mga06r32_180434_c1 3300050510 Bacteria 2097
442 nmdc:mga08y16_345518_c1 3300050511 Bacteria 1529
443 nmdc:mga0n895_261108_c1 3300050512 Bacteria 1758
444 nmdc:mga0n895_63792_c1 3300050512 Bacteria 3643
445 nmdc:mga0rr50_397880_c1 3300050513 Bacteria 1163
446 nmdc:mga0rr50_6590_c1 3300050513 Bacteria 7093
447 nmdc:mga0a205_244033_c1 3300050515 Bacteria 1677
448 Ga0500595_031336 3300053119 Bacteria 1785
449 Ga0500658_0031043 3300053134 Bacteria 2089
450 Ga0500616_0017189 3300053153 Bacteria 4107
451 Ga0501082_0036869 3300060353 Bacteria 4212
452 Ga0466962_0089138 3300061719 Bacteria 1477
453 Ga0075433_10143344
454 Ga0070658_10281080
455 Ga0070683_100006278
456 Ga0070690_100192526
457 Ga0070670_100249160
458 Ga0068869_100170168
459 Ga0070680_100530481
460 Ga0070680_100578272
461 Ga0070682_100005699
462 Ga0068868_100061069
463 Ga0068868_100166295
464 Ga0070660_100101494
465 Ga0070660_100252940
466 Ga0070689_100129109
467 Ga0070691_10021575
468 Ga0070661_100025647
469 Ga0070661_100137295
470 Ga0070692_10131396
471 Ga0070668_100108984
472 Ga0070675_100431490
473 Ga0070671_100028943
474 Ga0070671_100217331
475 Ga0070671_100360336
476 Ga0070674_100019963
477 Ga0070674_100039482
478 Ga0070688_100333044
479 Ga0070659_100087543
480 Ga0070667_100087163
481 Ga0070714_100001154
482 Ga0070710_10156322
483 Ga0070710_10492085
484 Ga0070701_10073539
485 Ga0070711_100003191
486 Ga0070711_100003694
487 Ga0070711_100028605
488 Ga0070711_100247968
489 Ga0070705_100324675
490 Ga0070705_100561743
491 Ga0070700_100002691
492 Ga0070700_100297792
493 Ga0070700_100596151
494 Ga0070708_100198297
495 Ga0070663_100033074
496 Ga0070663_100121522
497 Ga0070678_100012815
498 Ga0070678_100022756
499 Ga0070662_100056007
500 Ga0068867_100648312
501 Ga0070706_100004739
502 Ga0070707_100329028
503 Ga0070699_100007976
504 Ga0070679_100040397
505 Ga0070684_100001296
506 Ga0070684_100048842
507 Ga0070697_100310249
508 Ga0070697_100530922
509 Ga0068853_100013514
510 Ga0070686_100089229
511 Ga0070696_100300814
512 Ga0070665_100000244
513 Ga0070665_100394068
514 Ga0070665_100619252
515 Ga0070665_100776309
516 Ga0070704_100014804
517 Ga0070704_100036180
518 Ga0070704_100167008
519 Ga0068855_100948577
520 Ga0070664_100263259
521 Ga0068857_100533952
522 Ga0068856_100005853
523 Ga0068856_100071473
524 Ga0070702_100006170
525 Ga0068852_100039820
526 Ga0068852_100455135
527 Ga0068859_100195098
528 Ga0068859_100681055
529 Ga0068864_100008506
530 Ga0068861_100272425
531 Ga0068851_10035845
532 Ga0068870_10064162
533 Ga0068863_100221442
534 Ga0068863_100997907
535 Ga0068863_101097697
536 Ga0068858_100000450
537 Ga0068858_100045864
538 Ga0068858_100079505
539 Ga0068858_100551325
540 Ga0068862_100245774
541 Ga0068862_100260353
542 Ga0081455_10034846
543 Ga0081455_10072612
544 Ga0081455_10296200
545 Ga0081538_10000030
546 Ga0081538_10022949
547 Ga0081538_10166558
548 Ga0081539_10005112
549 Ga0070717_10032316
550 Ga0075365_10000477
551 Ga0075365_10001908
552 Ga0075365_10047962
553 Ga0075364_10063831
554 Ga0075364_10075091
555 Ga0075364_10179321
556 Ga0070715_10064550
557 Ga0070716_100035034
558 Ga0070716_100084005
559 Ga0070716_100205441
560 Ga0070712_100004037
561 Ga0070712_100234456
562 Ga0075370_10119274
563 Ga0068871_100179401
564 Ga0068871_100314734
565 Ga0075428_100765959
566 Ga0075430_100516426
567 Ga0075431_100012056
568 Ga0075431_100276700
569 Ga0075431_100409676
570 Ga0075433_10104067
571 Ga0075434_100053614
572 Ga0075434_100056225
573 Ga0075434_100421090
574 Ga0068865_100064509
575 Ga0075436_100025434
576 Ga0075436_100559266
577 Ga0097620_100195104
578 Ga0097620_100681029
579 Ga0075435_100023684
580 Ga0075435_100467522
581 Ga0105240_10050677
582 Ga0111539_10019740
583 Ga0111539_10411146
584 Ga0105245_10000016
585 Ga0105245_10000619
586 Ga0105245_10009667
587 Ga0105245_10017386
588 Ga0105245_10680040
589 Ga0105247_10179620
590 Ga0114129_11340033
591 Ga0105243_10155119
592 Ga0105243_10753452
593 Ga0105241_10268905
594 Ga0105242_10080904
595 Ga0105242_10109501
596 Ga0105242_10317799
597 Ga0105248_10036189
598 Ga0105248_10683478
599 Ga0105237_10071442
600 Ga0105237_10233645
601 Ga0105237_10557365
602 Ga0105238_11099722
603 Ga0105249_10037284
604 Ga0105249_10071152
605 Ga0105249_10506752
606 Ga0105239_10033048
607 Ga0105239_10335358
608 Ga0105239_10335742
609 Ga0105239_10569985
610 Ga0105246_10116040
611 Ga0105246_10258257
612 Ga0157371_10707687
613 Ga0157370_10322392
614 Ga0157369_10712434
615 Ga0157374_10020072
616 Ga0157378_10110041
617 Ga0157378_10204780
618 Ga0157378_11100990
619 Ga0163162_10223183
620 Ga0157372_10042346
621 Ga0157372_10247247
622 Ga0157375_10025972
623 Ga0157375_10523111
624 Ga0163163_10049541
625 Ga0157377_10006199
626 Ga0157377_10360920
627 Ga0157379_10105339
628 Ga0157379_10262559
629 Ga0157379_10304343
630 Ga0157379_10689455
631 Ga0207692_10141587
632 Ga0207710_10165562
633 Ga0207688_10002667
634 Ga0207688_10146772
635 Ga0207688_10235550
636 Ga0207699_10274571
637 Ga0207705_10076665
638 Ga0207654_10075675
639 Ga0207707_10391331
640 Ga0207695_10920939
641 Ga0207671_10041366
642 Ga0207671_10677367
643 Ga0207671_11047040
644 Ga0207693_10007405
645 Ga0207693_10022041
646 Ga0207663_10026130
647 Ga0207663_10124578
648 Ga0207663_10134074
649 Ga0207663_10299376
650 Ga0207660_10088823
651 Ga0207660_10438729
652 Ga0207660_10769065
653 Ga0207662_10024228
654 Ga0207657_10024349
655 Ga0207657_10120305
656 Ga0207657_10388145
657 Ga0207652_10002251
658 Ga0207646_10023780
659 Ga0207681_10331632
660 Ga0207681_10545606
661 Ga0207694_10456341
662 Ga0207650_10624548
663 Ga0207687_10158625
664 Ga0207687_10273460
665 Ga0207687_10361329
666 Ga0207700_10129641
667 Ga0207664_10007847
668 Ga0207644_10122281
669 Ga0207690_10129870
670 Ga0207706_10051758
671 Ga0207686_10064287
672 Ga0207686_10079905
673 Ga0207686_10219677
674 Ga0207686_10236789
675 Ga0207670_10075763
676 Ga0207670_10215809
677 Ga0207669_10555276
678 Ga0207704_10186468
679 Ga0207704_10245059
680 Ga0207665_10071187
681 Ga0207665_10564951
682 Ga0207691_10168527
683 Ga0207711_10059507
684 Ga0207711_10311539
685 Ga0207711_10786464
686 Ga0207711_10796183
687 Ga0207689_10281237
688 Ga0207661_10005187
689 Ga0207661_10162394
690 Ga0207679_10209056
691 Ga0207712_10420020
692 Ga0207668_10190049
693 Ga0207668_10279210
694 Ga0207658_10014913
695 Ga0207677_10320253
696 Ga0207703_10000322
697 Ga0207703_10098969
698 Ga0207639_10003640
699 Ga0207678_10002490
700 Ga0207678_10011774
701 Ga0207678_10039331
702 Ga0207708_10000288
703 Ga0207708_10063375
704 Ga0207702_10756669
705 Ga0207641_10859780
706 Ga0207648_10684489
707 Ga0207648_10808439
708 Ga0207676_10028123
709 Ga0207676_10430601
710 Ga0207674_10037394
711 Ga0207675_100007287
712 Ga0207675_100423265
713 Ga0207683_10009270
714 Ga0207683_10040499
715 Ga0207683_10159330
716 Ga0207698_11026931
717 Ga0207428_10010900
718 Ga0268266_10000020
719 Ga0268266_10000085
720 Ga0268266_10640720
721 Ga0268265_10176205
722 Ga0268264_10210777
723 Ga0268264_10342971
724 Ga0268264_10577802
725 Ga0268264_11454146
726 Ga0307405_10055547
727 Ga0307410_10175577
728 Ga0307406_10178756
729 Ga0307409_100007635
730 Ga0307416_100291408
731 Ga0307416_100886270
732 Ga0307411_10283992
733 Ga0307415_100378663
734 Ga0307415_100735589
735 Ga0373950_0036362
736 Ga0373932_0028523
737 Ga0373939_0038560
738 Ga0373943_0379495
739 Ga0373931_0529608
740 Ga0373927_0416605
741 Ga0373947_0520427
742 Ga0395898_0009629
743 Ga0395898_0022749
744 Ga0395898_1317713
745 Ga0395905_0050331
746 Ga0395901_0002589
747 Ga0395901_0096965
748 Ga0466961_0152221
749 Ga0466970_0107104
750 Ga0466960_0001031
751 Ga0466960_0347857
752 Ga0466959_0165140
753 Ga0466967_0119369
754 Ga0466967_0699449
755 Ga0495592_0066594
756 Ga0495592_0459510
757 Ga0495629_0081933
758 Ga0495641_0007891
759 Ga0495650_0000223
760 Ga0495582_0287782
761 Ga0495594_0433584
762 Ga0495620_0000246
763 Ga0495630_0130273
764 Ga0495640_0002854
765 Ga0495645_0206484
766 Ga0495647_0046588
767 Ga0495604_0165597
768 Ga0495674_0003030
769 Ga0495676_0001513
770 Ga0495676_0096723
771 Ga0495676_0565271
772 Ga0495680_0292400
773 Ga0495686_0144751
774 Ga0495602_0005647
775 Ga0495602_0413010
776 Ga0496100_0000038
777 Ga0496100_0137206
778 Ga0496100_0187249
779 Ga0496100_0717998
780 Ga0496101_0000221
781 Ga0496101_0000361
782 Ga0496101_0029241
783 Ga0496101_0331831
784 Ga0496101_0642738
785 Ga0496102_0008647
786 Ga0496102_0009474
787 Ga0496102_0032414
788 Ga0496102_0049178
789 Ga0496102_0084152
790 Ga0496102_0205154
791 Ga0496103_0015552
792 Ga0496103_0071254
793 Ga0496103_0377782
794 Ga0496103_0378799
795 Ga0496104_0000033
796 Ga0496104_0004818
797 Ga0496104_0105920
798 Ga0496104_0662469
799 Ga0496105_0104852
800 Ga0496105_0114922
801 Ga0496105_0237922
802 Ga0496106_0000018
803 Ga0496106_0000149
804 Ga0496106_0010639
805 Ga0496106_0155335
806 Ga0496106_0474132
807 Ga0496107_0000006
808 Ga0496107_0033362
809 Ga0496107_0049422
810 Ga0496107_0061990
811 Ga0496107_0065207
812 Ga0496107_0378826
813 Ga0496108_0047488
814 Ga0496108_0121732
815 Ga0496109_0022628
816 Ga0496109_0098036
817 Ga0496109_0105071
818 Ga0496110_0000034
819 Ga0496110_0001163
820 Ga0496110_0005255
821 Ga0496110_0310866
822 Ga0496111_0000372
823 Ga0496111_0003411
824 Ga0496112_0000003
825 Ga0496112_0008008
826 Ga0496112_0072544
827 Ga0496113_0144287
828 Ga0496113_0416179
829 Ga0496115_0206581
830 Ga0496115_0406015
831 Ga0496116_0000769
832 Ga0496117_0009156
833 Ga0496118_0004300
834 Ga0496118_0037203
835 Ga0496119_0002017
836 Ga0496119_0008077
837 Ga0496119_0034405
838 Ga0496120_0005187
839 Ga0496121_0045976
840 Ga0496121_0265265
841 Ga0496124_0369126
842 Ga0496125_0016459
843 Ga0496125_0074752
844 Ga0496126_0014575
845 Ga0496126_0058918
846 Ga0501031_0010776
847 Ga0501032_0016871
848 Ga0501033_0002248
849 Ga0501034_0010443
850 Ga0501034_0517357
851 Ga0501036_0006589
852 Ga0501037_0012997
853 Ga0501043_0001141
854 Ga0501043_0348713
855 Ga0501046_0019602
856 Ga0501047_0007577
857 Ga0501047_0042318
858 Ga0501047_0099783
859 Ga0501047_0187406
860 Ga0501047_0452994
861 Ga0501048_0001808
862 Ga0501068_0019763
863 Ga0501068_0253408
864 Ga0501069_0085244
865 Ga0501070_0001054
866 Ga0501070_0035008
867 Ga0501070_0332087
868 Ga0501071_0091919
869 Ga0501073_0031697
870 Ga0501075_0009453
871 Ga0501079_0013368
872 Ga0501079_0033474
873 Ga0501079_0071481
874 Ga0501080_0007467
875 Ga0501080_0010717
876 Ga0501080_0025877
877 Ga0501083_0005339
878 Ga0501083_0279555
879 Ga0501083_0353986
880 Ga0501035_0001380
881 Ga0501044_0005148
882 Ga0501044_0009242
883 Ga0501044_0116208
884 Ga0501044_0158471
885 nmdc:mga00v17_135177_c1
886 nmdc:mga00v17_283447_c1
887 nmdc:mga0yw44_358327_c1
888 nmdc:mga0yw44_504515_c1
889 nmdc:mga06z11_183551_c1
890 nmdc:mga07m45_115127_c1
891 nmdc:mga06r32_121064_c1
892 nmdc:mga06r32_146503_c1
893 nmdc:mga06r32_180434_c1
894 nmdc:mga08y16_345518_c1
895 nmdc:mga0n895_261108_c1
896 nmdc:mga0n895_63792_c1
897 nmdc:mga0rr50_397880_c1
898 nmdc:mga0rr50_6590_c1
899 nmdc:mga0a205_244033_c1
900 Ga0500595_031336
901 Ga0500658_0031043
902 Ga0500616_0017189
903 Ga0501082_0036869
904 Ga0466962_0089138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21351

TetR_C_41

Tetracyclin repressor-like, C-terminal domain

124

232

0.98

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

55

101

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5icj-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis transcriptional repressor ethr2 in complex with bdm41420 0.9757 11 197
5n1i-assembly1.cif.gz_B unliganded form of the mycobacterium tuberculosis repressor ethr2 0.9684 11 197
6hs1-assembly1.cif.gz_B ethr2 in complex with compound 9 (bdm76060) 0.9663 10 197
5icj-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis transcriptional repressor ethr2 in complex with bdm41420 0.9654 11 197
5n1i-assembly1.cif.gz_B unliganded form of the mycobacterium tuberculosis repressor ethr2 0.9583 11 197
ID Description Score Start End Superfamily
2eh3A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9889 13 59 1.10.10.60
1jt6E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9879 13 59 1.10.10.60
1jt0C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9874 13 59 1.10.10.60
2g0eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9868 14 59 1.10.10.60
1jusE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9859 13 59 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A431NQE1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9929 6 198 GO:0000976
GO:0003700
AF-A0A7W0K221-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9887 9 196 GO:0000976
GO:0003700
AF-A0A538C728-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9874 9 198 GO:0000976
GO:0003700
AF-A0A537XCG2-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9868 1 198 GO:0000976
GO:0003700
AF-A0A1X2LUU5-F1-model_v4 HTH tetR-type domain-containing protein 0.9827 5 196 GO:0000976
GO:0003700

Map