F446886

General Info

Members Datasets Scaffolds Average Seq Length
451 206 902 213

Family's Representative Sequence

Representative Sequence 3300059511|Ga0587091_017894|Ga0587091_017894_97_792
Length 231
Sequence MKSSLRFGVVLVLILVVGILVNAWSYLGEAHVDRKALKDFPQSIGRWQKTGTDQVIDDETMKVLRASDYLQRDFRNSDGQTATLYVGYYATQRDGATYHSPLNCLPGSGWTLSEPGKTTIALPDGKSFVANKYVIQTGDYRSLMIYWYQGRGRNVASEYWGKIYTVFDSVRLRRSDGALVRVTVPIANSEAKAEQTAVEFASAASAALPQFVPRVQHNCAKELIVSETVRN

Samples

Sample ID Description Type Environment
1 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
155 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
168 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
169 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
172 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
173 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
174 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
175 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
176 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
177 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
178 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
181 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
182 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
183 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
184 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
185 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
186 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
187 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
188 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
189 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
190 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
195 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
196 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
197 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 2.66
Rhizosphere 96.9
Stem 0
Stem Tuber 0
Unclassified 28.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587091_017894 3300059511 Bacteria 1199
2 SwRhRL2b_contig_1111583 2162886007 Bacteria 1330
3 CNAas_1000481 3300000532 Unclassified 3886
4 JGI24748J21848_1000001 3300002074 Bacteria 444271
5 JGI24034J26672_10000001 3300002239 Bacteria 1118280
6 rootH2_10064330 3300003320 Bacteria 2112
7 Ga0065714_10064445 3300005288 Bacteria 90891
8 Ga0065704_10103589 3300005289 Unclassified 2167
9 Ga0065704_10308497 3300005289 Unclassified 872
10 Ga0065712_10000114 3300005290 Bacteria 191810
11 Ga0065712_10011468 3300005290 Bacteria 2637
12 Ga0065715_10001473 3300005293 Bacteria 6367
13 Ga0065715_10089098 3300005293 Bacteria 14422
14 Ga0065715_10120185 3300005293 Bacteria 2264
15 Ga0065715_10141829 3300005293 Unclassified 1842
16 Ga0065715_10160837 3300005293 Bacteria 1631
17 Ga0065715_10379140 3300005293 Unclassified 910
18 Ga0065707_10011785 3300005295 Unclassified 3191
19 Ga0065707_10115980 3300005295 Bacteria 2251
20 Ga0065707_10367044 3300005295 Unclassified 889
21 Ga0070670_100000130 3300005331 Bacteria 70859
22 Ga0070670_100044359 3300005331 Unclassified 3824
23 Ga0070670_100060774 3300005331 Bacteria 3244
24 Ga0070670_100425293 3300005331 Bacteria 1174
25 Ga0068869_100274438 3300005334 Bacteria 1354
26 Ga0068869_100401393 3300005334 Bacteria 1128
27 Ga0068869_100410402 3300005334 Bacteria 1115
28 Ga0068869_100511656 3300005334 Unclassified 1004
29 Ga0070680_100020698 3300005336 Bacteria 5220
30 Ga0070682_100013766 3300005337 Bacteria 4663
31 Ga0070689_100310835 3300005340 Bacteria 1314
32 Ga0070689_100536041 3300005340 Bacteria 1007
33 Ga0070687_100043005 3300005343 Bacteria 2293
34 Ga0070661_100305710 3300005344 Bacteria 1239
35 Ga0070692_10021459 3300005345 Bacteria 3142
36 Ga0070692_10073519 3300005345 Bacteria 1826
37 Ga0070692_10154711 3300005345 Bacteria 1309
38 Ga0070669_100384062 3300005353 Bacteria 1146
39 Ga0070673_100106801 3300005364 Bacteria 2315
40 Ga0070688_100417351 3300005365 Unclassified 997
41 Ga0070703_10001298 3300005406 Bacteria 7580
42 Ga0070705_100000894 3300005440 Bacteria 16635
43 Ga0070700_100002786 3300005441 Bacteria 8952
44 Ga0070700_100007693 3300005441 Bacteria 5834
45 Ga0070694_100011839 3300005444 Bacteria 5409
46 Ga0070694_100012776 3300005444 Bacteria 5231
47 Ga0070694_100025174 3300005444 Bacteria 3849
48 Ga0070694_100364672 3300005444 Bacteria 1123
49 Ga0070681_10020080 3300005458 Bacteria 6695
50 Ga0070681_10029881 3300005458 Bacteria 5469
51 Ga0068867_100023654 3300005459 Unclassified 4399
52 Ga0068867_100385070 3300005459 Bacteria 1179
53 Ga0068867_100454929 3300005459 Unclassified 1092
54 Ga0068867_100542526 3300005459 Unclassified 1006
55 Ga0068867_101055190 3300005459 Unclassified 740
56 Ga0070706_100000001 3300005467 Bacteria 342302
57 Ga0070706_100015520 3300005467 Bacteria 7037
58 Ga0070706_100025115 3300005467 Bacteria 5485
59 Ga0070706_100094029 3300005467 Unclassified 2782
60 Ga0070706_100576502 3300005467 Unclassified 1046
61 Ga0070707_100017014 3300005468 Bacteria 6828
62 Ga0070707_100057364 3300005468 Unclassified 3735
63 Ga0070707_100534204 3300005468 Unclassified 1135
64 Ga0070698_100001384 3300005471 Bacteria 26879
65 Ga0070698_100018600 3300005471 Bacteria 7313
66 Ga0070698_100036206 3300005471 Bacteria 5100
67 Ga0070699_100051274 3300005518 Bacteria 3572
68 Ga0070699_100066340 3300005518 Bacteria 3133
69 Ga0070699_100276442 3300005518 Unclassified 1504
70 Ga0070679_100002257 3300005530 Bacteria 17411
71 Ga0070679_100238163 3300005530 Unclassified 1778
72 Ga0070697_100000149 3300005536 Bacteria 56919
73 Ga0070697_100017523 3300005536 Bacteria 5637
74 Ga0070697_100245048 3300005536 Unclassified 1531
75 Ga0068853_100074844 3300005539 Bacteria 2955
76 Ga0068853_100676099 3300005539 Bacteria 984
77 Ga0070695_100007981 3300005545 Bacteria 6270
78 Ga0070695_100173733 3300005545 Unclassified 1522
79 Ga0070695_100269379 3300005545 Bacteria 1247
80 Ga0070695_100397333 3300005545 Bacteria 1044
81 Ga0070696_100009375 3300005546 Bacteria 6553
82 Ga0070696_100026418 3300005546 Bacteria 3949
83 Ga0070696_100040207 3300005546 Bacteria 3228
84 Ga0070696_100132422 3300005546 Bacteria 1815
85 Ga0070696_100133534 3300005546 Bacteria 1808
86 Ga0070696_100180196 3300005546 Bacteria 1567
87 Ga0070696_100313602 3300005546 Bacteria 1205
88 Ga0070696_100315998 3300005546 Bacteria 1201
89 Ga0070696_100324974 3300005546 Bacteria 1185
90 Ga0070693_100006008 3300005547 Bacteria 5871
91 Ga0070693_100007384 3300005547 Bacteria 5370
92 Ga0070693_100363912 3300005547 Bacteria 993
93 Ga0070704_100151657 3300005549 Bacteria 1823
94 Ga0070704_100909339 3300005549 Unclassified 792
95 Ga0068855_100227821 3300005563 Unclassified 2088
96 Ga0070664_100125663 3300005564 Bacteria 2250
97 Ga0070664_100679876 3300005564 Unclassified 958
98 Ga0068857_100155040 3300005577 Bacteria 2076
99 Ga0068857_100178262 3300005577 Bacteria 1933
100 Ga0068854_100411968 3300005578 Bacteria 1121
101 Ga0068856_100079036 3300005614 Bacteria 3261
102 Ga0070702_100142336 3300005615 Unclassified 1529
103 Ga0070702_100338199 3300005615 Bacteria 1055
104 Ga0068852_100031824 3300005616 Bacteria 4360
105 Ga0068852_100411196 3300005616 Bacteria 1333
106 Ga0068852_100419856 3300005616 Unclassified 1319
107 Ga0068859_100001029 3300005617 Bacteria 28564
108 Ga0068859_100062325 3300005617 Bacteria 3759
109 Ga0068859_100080315 3300005617 Bacteria 3302
110 Ga0068859_100166430 3300005617 Bacteria 2284
111 Ga0068859_100263348 3300005617 Bacteria 1815
112 Ga0068864_100002573 3300005618 Bacteria 14974
113 Ga0068864_100045755 3300005618 Bacteria 3754
114 Ga0068864_100054425 3300005618 Bacteria 3454
115 Ga0068864_100310820 3300005618 Bacteria 1477
116 Ga0068864_100319172 3300005618 Bacteria 1459
117 Ga0068864_100406603 3300005618 Bacteria 1294
118 Ga0068851_10002185 3300005834 Bacteria 8604
119 Ga0068870_10003654 3300005840 Bacteria 6534
120 Ga0068870_10009158 3300005840 Bacteria 4488
121 Ga0068870_10058839 3300005840 Bacteria 2058
122 Ga0068870_10168540 3300005840 Bacteria 1305
123 Ga0068870_10320156 3300005840 Unclassified 985
124 Ga0068863_100102113 3300005841 Bacteria 2726
125 Ga0068858_100000051 3300005842 Bacteria 120692
126 Ga0068858_100016461 3300005842 Bacteria 6942
127 Ga0068858_100058047 3300005842 Bacteria 3577
128 Ga0068858_100121919 3300005842 Bacteria 2439
129 Ga0068858_100243836 3300005842 Unclassified 1705
130 Ga0068860_100093836 3300005843 Unclassified 2860
131 Ga0068862_100125611 3300005844 Bacteria 2265
132 Ga0068862_100574037 3300005844 Unclassified 1079
133 Ga0068862_100922459 3300005844 Unclassified 860
134 Ga0068862_101243854 3300005844 Unclassified 744
135 Ga0081539_10001938 3300005985 Bacteria 31724
136 Ga0081539_10084620 3300005985 Unclassified 1657
137 Ga0070716_100546118 3300006173 Bacteria 863
138 Ga0097621_100239522 3300006237 Bacteria 1586
139 Ga0075428_100146236 3300006844 Bacteria 2568
140 Ga0075428_100185758 3300006844 Unclassified 2249
141 Ga0075428_100632331 3300006844 Bacteria 1142
142 Ga0075433_10010603 3300006852 Bacteria 7408
143 Ga0075433_10016544 3300006852 Bacteria 6083
144 Ga0075433_10042986 3300006852 Bacteria 3922
145 Ga0075433_10179911 3300006852 Bacteria 1881
146 Ga0075433_10295254 3300006852 Unclassified 1435
147 Ga0075433_10451252 3300006852 Bacteria 1133
148 Ga0075433_10572599 3300006852 Unclassified 992
149 Ga0075434_100009276 3300006871 Bacteria 9168
150 Ga0075434_100023954 3300006871 Bacteria 5960
151 Ga0075434_100052582 3300006871 Unclassified 4047
152 Ga0075434_100141632 3300006871 Bacteria 2425
153 Ga0075434_100213509 3300006871 Bacteria 1950
154 Ga0075429_100178263 3300006880 Bacteria 1862
155 Ga0068865_100148869 3300006881 Bacteria 1774
156 Ga0097620_100001029 3300006931 Bacteria 28564
157 Ga0097620_100062322 3300006931 Bacteria 3759
158 Ga0097620_100080323 3300006931 Bacteria 3302
159 Ga0097620_100166429 3300006931 Bacteria 2284
160 Ga0097620_100263356 3300006931 Bacteria 1815
161 Ga0075435_100004755 3300007076 Bacteria 9377
162 Ga0075435_100192845 3300007076 Bacteria 1725
163 Ga0105250_10055450 3300009092 Bacteria 1590
164 Ga0105240_10008868 3300009093 Bacteria 14314
165 Ga0111539_10057566 3300009094 Bacteria 4615
166 Ga0111539_10186542 3300009094 Unclassified 2422
167 Ga0111539_10361973 3300009094 Unclassified 1688
168 Ga0111539_11194087 3300009094 Unclassified 884
169 Ga0105245_11197995 3300009098 Bacteria 807
170 Ga0105247_10000004 3300009101 Bacteria 455497
171 Ga0105247_10002838 3300009101 Bacteria 11561
172 Ga0105247_10041491 3300009101 Unclassified 2816
173 Ga0105247_10168001 3300009101 Bacteria 1457
174 Ga0105247_10316405 3300009101 Unclassified 1088
175 Ga0114129_10020563 3300009147 Bacteria 9387
176 Ga0114129_10068603 3300009147 Bacteria 4944
177 Ga0114129_10078217 3300009147 Bacteria 4601
178 Ga0114129_10134760 3300009147 Unclassified 3389
179 Ga0114129_10302143 3300009147 Bacteria 2133
180 Ga0114129_10476416 3300009147 Bacteria 1634
181 Ga0114129_11419716 3300009147 Unclassified 856
182 Ga0105243_10009443 3300009148 Bacteria 7432
183 Ga0105243_10028150 3300009148 Bacteria 4311
184 Ga0105243_10379957 3300009148 Bacteria 1306
185 Ga0105241_10074904 3300009174 Unclassified 2637
186 Ga0105241_10117071 3300009174 Unclassified 2141
187 Ga0105241_10153506 3300009174 Bacteria 1886
188 Ga0105241_10155764 3300009174 Bacteria 1873
189 Ga0105241_10236531 3300009174 Bacteria 1542
190 Ga0105241_10312416 3300009174 Bacteria 1352
191 Ga0105241_10313315 3300009174 Bacteria 1350
192 Ga0105241_10348131 3300009174 Bacteria 1286
193 Ga0105241_10790658 3300009174 Unclassified 873
194 Ga0105241_10980067 3300009174 Unclassified 790
195 Ga0105242_10057901 3300009176 Bacteria 3175
196 Ga0105242_10113448 3300009176 Bacteria 2314
197 Ga0105248_10070520 3300009177 Unclassified 3925
198 Ga0105248_10177343 3300009177 Bacteria 2401
199 Ga0105248_10269277 3300009177 Bacteria 1918
200 Ga0105248_10779242 3300009177 Bacteria 1079
201 Ga0105237_10000478 3300009545 Bacteria 56847
202 Ga0105237_10255984 3300009545 Bacteria 1753
203 Ga0105237_10264826 3300009545 Bacteria 1722
204 Ga0105237_10497148 3300009545 Bacteria 1226
205 Ga0105238_10000531 3300009551 Bacteria 39922
206 Ga0105238_11192090 3300009551 Unclassified 786
207 Ga0105249_10018842 3300009553 Bacteria 6151
208 Ga0105249_10276627 3300009553 Unclassified 1675
209 Ga0105249_10707661 3300009553 Unclassified 1068
210 Ga0105239_10064067 3300010375 Bacteria 4035
211 Ga0105239_10797251 3300010375 Bacteria 1082
212 Ga0105239_10982884 3300010375 Unclassified 970
213 Ga0105246_10021695 3300011119 Unclassified 4136
214 Ga0105246_10131980 3300011119 Bacteria 1867
215 Ga0157373_10001614 3300013100 Bacteria 17222
216 Ga0157373_10401836 3300013100 Unclassified 982
217 Ga0157374_10778750 3300013296 Unclassified 972
218 Ga0157378_10096603 3300013297 Unclassified 2692
219 Ga0157378_10915590 3300013297 Bacteria 908
220 Ga0163162_10134395 3300013306 Bacteria 2584
221 Ga0163162_10259879 3300013306 Bacteria 1868
222 Ga0163162_10599297 3300013306 Bacteria 1228
223 Ga0163162_10721912 3300013306 Unclassified 1117
224 Ga0157372_10004240 3300013307 Bacteria 15325
225 Ga0157372_10018336 3300013307 Bacteria 7523
226 Ga0157372_11384403 3300013307 Unclassified 811
227 Ga0157375_10006978 3300013308 Bacteria 9864
228 Ga0157375_10161069 3300013308 Unclassified 2385
229 Ga0157375_10639754 3300013308 Unclassified 1220
230 Ga0157375_11398534 3300013308 Bacteria 824
231 Ga0163163_10000806 3300014325 Bacteria 26614
232 Ga0163163_10025451 3300014325 Bacteria 5641
233 Ga0163163_10167503 3300014325 Unclassified 2243
234 Ga0163163_10273597 3300014325 Bacteria 1740
235 Ga0163163_10843539 3300014325 Unclassified 980
236 Ga0163163_10927787 3300014325 Bacteria 934
237 Ga0163163_11496901 3300014325 Unclassified 736
238 Ga0157380_10163789 3300014326 Unclassified 1935
239 Ga0157380_10181815 3300014326 Bacteria 1848
240 Ga0157377_10006616 3300014745 Bacteria 5539
241 Ga0157377_10066768 3300014745 Bacteria 2069
242 Ga0157377_10149277 3300014745 Bacteria 1444
243 Ga0157379_10050427 3300014968 Unclassified 3715
244 Ga0157379_10247349 3300014968 Unclassified 1618
245 Ga0157379_10527794 3300014968 Unclassified 1096
246 Ga0182007_10069982 3300015262 Unclassified 1149
247 Ga0207672_1000002 3300025223 Bacteria 31879
248 Ga0207656_10003877 3300025321 Bacteria 5187
249 Ga0207653_10000612 3300025885 Bacteria 12459
250 Ga0207642_10095415 3300025899 Unclassified 1480
251 Ga0207710_10000002 3300025900 Bacteria 1251998
252 Ga0207710_10000567 3300025900 Bacteria 22135
253 Ga0207647_10015169 3300025904 Bacteria 5292
254 Ga0207647_10197723 3300025904 Bacteria 1164
255 Ga0207645_10150459 3300025907 Unclassified 1519
256 Ga0207643_10000737 3300025908 Bacteria 20096
257 Ga0207643_10022245 3300025908 Bacteria 3489
258 Ga0207643_10140525 3300025908 Bacteria 1442
259 Ga0207643_10307193 3300025908 Unclassified 988
260 Ga0207684_10000030 3300025910 Bacteria 300037
261 Ga0207684_10001621 3300025910 Bacteria 23877
262 Ga0207684_10015479 3300025910 Bacteria 6562
263 Ga0207654_10057912 3300025911 Bacteria 2254
264 Ga0207654_10099522 3300025911 Bacteria 1789
265 Ga0207654_10165318 3300025911 Bacteria 1432
266 Ga0207654_10297860 3300025911 Unclassified 1096
267 Ga0207654_10580214 3300025911 Unclassified 799
268 Ga0207707_10000007 3300025912 Bacteria 368555
269 Ga0207707_10083140 3300025912 Unclassified 2795
270 Ga0207695_10024787 3300025913 Bacteria 6735
271 Ga0207671_10001313 3300025914 Bacteria 29085
272 Ga0207671_10022147 3300025914 Bacteria 4808
273 Ga0207671_10112881 3300025914 Bacteria 2069
274 Ga0207660_10002909 3300025917 Bacteria 11187
275 Ga0207662_10054533 3300025918 Unclassified 2384
276 Ga0207649_10686747 3300025920 Bacteria 793
277 Ga0207652_10000262 3300025921 Bacteria 54965
278 Ga0207652_10154289 3300025921 Bacteria 2057
279 Ga0207646_10019253 3300025922 Bacteria 6346
280 Ga0207646_10024586 3300025922 Bacteria 5517
281 Ga0207681_10010794 3300025923 Bacteria 5609
282 Ga0207694_10005208 3300025924 Bacteria 10040
283 Ga0207650_10000001 3300025925 Bacteria 1545726
284 Ga0207650_10062952 3300025925 Bacteria 2772
285 Ga0207650_10237363 3300025925 Bacteria 1472
286 Ga0207650_10269166 3300025925 Bacteria 1384
287 Ga0207687_10124733 3300025927 Bacteria 1931
288 Ga0207687_10377345 3300025927 Bacteria 1161
289 Ga0207644_10000179 3300025931 Bacteria 45397
290 Ga0207690_10161716 3300025932 Bacteria 1670
291 Ga0207706_10299397 3300025933 Unclassified 1401
292 Ga0207686_10075194 3300025934 Bacteria 2186
293 Ga0207686_10192183 3300025934 Bacteria 1456
294 Ga0207709_10005361 3300025935 Bacteria 7299
295 Ga0207709_10107675 3300025935 Bacteria 1857
296 Ga0207704_10117633 3300025938 Bacteria 1811
297 Ga0207665_10220038 3300025939 Bacteria 1391
298 Ga0207691_10216947 3300025940 Bacteria 1660
299 Ga0207711_10002453 3300025941 Bacteria 16542
300 Ga0207711_10012194 3300025941 Bacteria 7147
301 Ga0207711_10518142 3300025941 Unclassified 1112
302 Ga0207689_10106617 3300025942 Bacteria 2302
303 Ga0207689_10135951 3300025942 Unclassified 2024
304 Ga0207689_10330832 3300025942 Bacteria 1265
305 Ga0207689_10475102 3300025942 Unclassified 1046
306 Ga0207689_10875738 3300025942 Unclassified 758
307 Ga0207679_10162564 3300025945 Bacteria 1829
308 Ga0207679_10195175 3300025945 Bacteria 1687
309 Ga0207651_10073312 3300025960 Bacteria 2434
310 Ga0207651_10150077 3300025960 Bacteria 1813
311 Ga0207651_10460212 3300025960 Bacteria 1093
312 Ga0207651_10520265 3300025960 Unclassified 1031
313 Ga0207712_10048808 3300025961 Bacteria 2947
314 Ga0207712_10129718 3300025961 Unclassified 1919
315 Ga0207640_10833834 3300025981 Unclassified 801
316 Ga0207703_10000114 3300026035 Bacteria 96051
317 Ga0207703_10146812 3300026035 Bacteria 2052
318 Ga0207703_10210861 3300026035 Bacteria 1732
319 Ga0207703_11006703 3300026035 Bacteria 799
320 Ga0207708_10006106 3300026075 Bacteria 8931
321 Ga0207708_10012733 3300026075 Bacteria 6273
322 Ga0207708_10062301 3300026075 Bacteria 2849
323 Ga0207702_10108802 3300026078 Bacteria 2460
324 Ga0207641_10409315 3300026088 Bacteria 1304
325 Ga0207641_10849041 3300026088 Unclassified 905
326 Ga0207648_10037088 3300026089 Bacteria 4294
327 Ga0207648_10146051 3300026089 Bacteria 2086
328 Ga0207648_10162081 3300026089 Bacteria 1975
329 Ga0207676_10001219 3300026095 Bacteria 19164
330 Ga0207676_10001273 3300026095 Bacteria 18747
331 Ga0207676_10017240 3300026095 Bacteria 5234
332 Ga0207676_10258370 3300026095 Bacteria 1571
333 Ga0207676_10394978 3300026095 Bacteria 1291
334 Ga0207676_10727798 3300026095 Bacteria 963
335 Ga0207674_10120425 3300026116 Unclassified 2592
336 Ga0207674_10121207 3300026116 Unclassified 2583
337 Ga0207674_10147923 3300026116 Bacteria 2307
338 Ga0207674_10290476 3300026116 Bacteria 1583
339 Ga0207674_10327030 3300026116 Bacteria 1483
340 Ga0207674_10913850 3300026116 Unclassified 846
341 Ga0207675_100007573 3300026118 Bacteria 10258
342 Ga0207675_101094565 3300026118 Unclassified 817
343 Ga0207683_10293471 3300026121 Unclassified 1487
344 Ga0207698_10027675 3300026142 Bacteria 4029
345 Ga0207698_10471444 3300026142 Unclassified 1216
346 Ga0268265_10214898 3300028380 Bacteria 1678
347 Ga0268265_10681063 3300028380 Unclassified 991
348 Ga0268265_10828049 3300028380 Unclassified 904
349 Ga0268264_10084777 3300028381 Bacteria 2717
350 Ga0268264_10227159 3300028381 Bacteria 1721
351 Ga0268264_10308263 3300028381 Unclassified 1493
352 Ga0268264_10313738 3300028381 Bacteria 1480
353 Ga0314311_1154250 3300030733 Unclassified 1003
354 Ga0307408_100089674 3300031548 Bacteria 2318
355 Ga0307408_100433693 3300031548 Bacteria 1136
356 Ga0307405_10004874 3300031731 Bacteria 6407
357 Ga0307410_10065519 3300031852 Bacteria 2499
358 Ga0307406_10004079 3300031901 Bacteria 7951
359 Ga0307412_10036753 3300031911 Bacteria 3141
360 Ga0307416_100015704 3300032002 Bacteria 5239
361 Ga0307416_100287727 3300032002 Bacteria 1625
362 Ga0307415_100009505 3300032126 Bacteria 5455
363 Ga0373951_0000869 3300035091 Bacteria 8160
364 Ga0373932_0066699 3300035112 Bacteria 1107
365 Ga0373960_0074618 3300035121 Unclassified 1056
366 Ga0373961_0104505 3300035241 Unclassified 921
367 Ga0373931_0071679 3300035691 Bacteria 1893
368 Ga0395900_0052138 3300037418 Bacteria 4212
369 Ga0395901_0215233 3300038443 Bacteria 2010
370 Ga0395901_0307653 3300038443 Bacteria 1642
371 Ga0395901_0452469 3300038443 Unclassified 1313
372 Ga0242422_00207 3300038699 Unclassified 3365
373 Ga0242420_000602 3300038996 Unclassified 4199
374 Ga0439448_0020746 3300042005 Unclassified 2036
375 Ga0439455_0080305 3300042012 Bacteria 885
376 Ga0439458_0003705 3300042157 Bacteria 3546
377 Ga0451576_0399699 3300045051 Bacteria 1441
378 Ga0495636_0201904 3300047318 Unclassified 908
379 Ga0496102_0014160 3300048905 Bacteria 6929
380 Ga0496104_0206364 3300048907 Bacteria 1877
381 Ga0496106_0109218 3300048909 Bacteria 2152
382 Ga0496106_0309539 3300048909 Unclassified 1267
383 Ga0496107_0166558 3300048910 Bacteria 1634
384 Ga0496108_0140968 3300048911 Bacteria 2077
385 Ga0496108_0240754 3300048911 Unclassified 1574
386 Ga0496108_0683460 3300048911 Unclassified 891
387 Ga0496112_0199677 3300048915 Bacteria 1960
388 Ga0496112_0373149 3300048915 Bacteria 1368
389 Ga0496112_0497548 3300048915 Bacteria 1155
390 Ga0496112_0536169 3300048915 Bacteria 1105
391 Ga0501291_001252 3300049514 Unclassified 2938
392 Ga0501292_042631 3300049515 Unclassified 787
393 Ga0501296_014890 3300049519 Unclassified 957
394 Ga0501298_010040 3300049521 Bacteria 1621
395 Ga0501198_002422 3300049649 Bacteria 2512
396 Ga0501199_017693 3300049650 Unclassified 809
397 Ga0501202_026519 3300049652 Unclassified 1186
398 Ga0501207_001016 3300049654 Bacteria 3411
399 Ga0501207_011226 3300049654 Unclassified 1331
400 Ga0501216_003681 3300049660 Bacteria 2250
401 Ga0501216_009926 3300049660 Unclassified 1524
402 Ga0501216_055294 3300049660 Unclassified 789
403 Ga0501217_000844 3300049661 Bacteria 5407
404 Ga0501217_016774 3300049661 Bacteria 1682
405 Ga0501223_001667 3300049663 Bacteria 5095
406 Ga0501223_006850 3300049663 Bacteria 2342
407 Ga0501224_001399 3300049664 Bacteria 3193
408 Ga0501224_004623 3300049664 Unclassified 1958
409 Ga0501227_007645 3300049665 Bacteria 2316
410 Ga0501230_012607 3300049667 Unclassified 1357
411 Ga0501233_007095 3300049668 Bacteria 2126
412 Ga0501233_031408 3300049668 Bacteria 1202
413 Ga0501235_007396 3300049669 Bacteria 2392
414 Ga0501236_005898 3300049670 Bacteria 1493
415 Ga0501239_003331 3300049672 Bacteria 1522
416 Ga0501240_006966 3300049673 Bacteria 1406
417 Ga0501240_012568 3300049673 Bacteria 1160
418 Ga0501243_004219 3300049675 Bacteria 2152
419 Ga0501243_040823 3300049675 Unclassified 815
420 Ga0501251_003994 3300049681 Bacteria 1501
421 Ga0501221_019241 3300049704 Bacteria 1322
422 Ga0501221_059485 3300049704 Unclassified 880
423 Ga0501225_0015191 3300049705 Bacteria 2147
424 Ga0501229_005340 3300049706 Bacteria 1575
425 Ga0501234_006950 3300049707 Bacteria 1770
426 Ga0501245_008472 3300049708 Bacteria 1466
427 Ga0501268_027060 3300049765 Bacteria 1017
428 Ga0501272_009950 3300049769 Bacteria 1057
429 Ga0501273_008802 3300049770 Unclassified 1214
430 Ga0501212_026337 3300049851 Unclassified 921
431 Ga0501226_007081 3300049853 Bacteria 1260
432 nmdc:mga05p37_233204_c1 3300050507 Bacteria 2216
433 nmdc:mga05p37_351171_c1 3300050507 Bacteria 1736
434 nmdc:mga05p37_56689_c1 3300050507 Bacteria 4824
435 nmdc:mga09592_235884_c1 3300050508 Unclassified 1585
436 nmdc:mga0qj67_66476_c1 3300050509 Unclassified 2872
437 nmdc:mga06r32_207625_c1 3300050510 Bacteria 1947
438 nmdc:mga06r32_716944_c1 3300050510 Bacteria 965
439 nmdc:mga08y16_126438_c1 3300050511 Unclassified 2659
440 nmdc:mga08y16_252708_c1 3300050511 Bacteria 1821
441 nmdc:mga0n895_126566_c1 3300050512 Unclassified 2579
442 nmdc:mga0n895_49700_c1 3300050512 Unclassified 4110
443 nmdc:mga0n895_92750_c1 3300050512 Bacteria 3023
444 nmdc:mga0rr50_40052_c1 3300050513 Bacteria 3404
445 nmdc:mga0rr50_46937_c1 3300050513 Bacteria 3182
446 nmdc:mga0a205_11197_c1 3300050515 Bacteria 8256
447 nmdc:mga0a205_22394_c1 3300050515 Bacteria 5985
448 nmdc:mga0a205_308952_c1 3300050515 Bacteria 1453
449 nmdc:mga0a205_571549_c1 3300050515 Unclassified 985
450 nmdc:mga0a205_7485_c1 3300050515 Bacteria 9888
451 Ga0500644_0197775 3300053088 Unclassified 830
452 Ga0587091_017894
453 SwRhRL2b_contig_1111583
454 CNAas_1000481
455 JGI24748J21848_1000001
456 JGI24034J26672_10000001
457 rootH2_10064330
458 Ga0065714_10064445
459 Ga0065704_10103589
460 Ga0065704_10308497
461 Ga0065712_10000114
462 Ga0065712_10011468
463 Ga0065715_10001473
464 Ga0065715_10089098
465 Ga0065715_10120185
466 Ga0065715_10141829
467 Ga0065715_10160837
468 Ga0065715_10379140
469 Ga0065707_10011785
470 Ga0065707_10115980
471 Ga0065707_10367044
472 Ga0070670_100000130
473 Ga0070670_100044359
474 Ga0070670_100060774
475 Ga0070670_100425293
476 Ga0068869_100274438
477 Ga0068869_100401393
478 Ga0068869_100410402
479 Ga0068869_100511656
480 Ga0070680_100020698
481 Ga0070682_100013766
482 Ga0070689_100310835
483 Ga0070689_100536041
484 Ga0070687_100043005
485 Ga0070661_100305710
486 Ga0070692_10021459
487 Ga0070692_10073519
488 Ga0070692_10154711
489 Ga0070669_100384062
490 Ga0070673_100106801
491 Ga0070688_100417351
492 Ga0070703_10001298
493 Ga0070705_100000894
494 Ga0070700_100002786
495 Ga0070700_100007693
496 Ga0070694_100011839
497 Ga0070694_100012776
498 Ga0070694_100025174
499 Ga0070694_100364672
500 Ga0070681_10020080
501 Ga0070681_10029881
502 Ga0068867_100023654
503 Ga0068867_100385070
504 Ga0068867_100454929
505 Ga0068867_100542526
506 Ga0068867_101055190
507 Ga0070706_100000001
508 Ga0070706_100015520
509 Ga0070706_100025115
510 Ga0070706_100094029
511 Ga0070706_100576502
512 Ga0070707_100017014
513 Ga0070707_100057364
514 Ga0070707_100534204
515 Ga0070698_100001384
516 Ga0070698_100018600
517 Ga0070698_100036206
518 Ga0070699_100051274
519 Ga0070699_100066340
520 Ga0070699_100276442
521 Ga0070679_100002257
522 Ga0070679_100238163
523 Ga0070697_100000149
524 Ga0070697_100017523
525 Ga0070697_100245048
526 Ga0068853_100074844
527 Ga0068853_100676099
528 Ga0070695_100007981
529 Ga0070695_100173733
530 Ga0070695_100269379
531 Ga0070695_100397333
532 Ga0070696_100009375
533 Ga0070696_100026418
534 Ga0070696_100040207
535 Ga0070696_100132422
536 Ga0070696_100133534
537 Ga0070696_100180196
538 Ga0070696_100313602
539 Ga0070696_100315998
540 Ga0070696_100324974
541 Ga0070693_100006008
542 Ga0070693_100007384
543 Ga0070693_100363912
544 Ga0070704_100151657
545 Ga0070704_100909339
546 Ga0068855_100227821
547 Ga0070664_100125663
548 Ga0070664_100679876
549 Ga0068857_100155040
550 Ga0068857_100178262
551 Ga0068854_100411968
552 Ga0068856_100079036
553 Ga0070702_100142336
554 Ga0070702_100338199
555 Ga0068852_100031824
556 Ga0068852_100411196
557 Ga0068852_100419856
558 Ga0068859_100001029
559 Ga0068859_100062325
560 Ga0068859_100080315
561 Ga0068859_100166430
562 Ga0068859_100263348
563 Ga0068864_100002573
564 Ga0068864_100045755
565 Ga0068864_100054425
566 Ga0068864_100310820
567 Ga0068864_100319172
568 Ga0068864_100406603
569 Ga0068851_10002185
570 Ga0068870_10003654
571 Ga0068870_10009158
572 Ga0068870_10058839
573 Ga0068870_10168540
574 Ga0068870_10320156
575 Ga0068863_100102113
576 Ga0068858_100000051
577 Ga0068858_100016461
578 Ga0068858_100058047
579 Ga0068858_100121919
580 Ga0068858_100243836
581 Ga0068860_100093836
582 Ga0068862_100125611
583 Ga0068862_100574037
584 Ga0068862_100922459
585 Ga0068862_101243854
586 Ga0081539_10001938
587 Ga0081539_10084620
588 Ga0070716_100546118
589 Ga0097621_100239522
590 Ga0075428_100146236
591 Ga0075428_100185758
592 Ga0075428_100632331
593 Ga0075433_10010603
594 Ga0075433_10016544
595 Ga0075433_10042986
596 Ga0075433_10179911
597 Ga0075433_10295254
598 Ga0075433_10451252
599 Ga0075433_10572599
600 Ga0075434_100009276
601 Ga0075434_100023954
602 Ga0075434_100052582
603 Ga0075434_100141632
604 Ga0075434_100213509
605 Ga0075429_100178263
606 Ga0068865_100148869
607 Ga0097620_100001029
608 Ga0097620_100062322
609 Ga0097620_100080323
610 Ga0097620_100166429
611 Ga0097620_100263356
612 Ga0075435_100004755
613 Ga0075435_100192845
614 Ga0105250_10055450
615 Ga0105240_10008868
616 Ga0111539_10057566
617 Ga0111539_10186542
618 Ga0111539_10361973
619 Ga0111539_11194087
620 Ga0105245_11197995
621 Ga0105247_10000004
622 Ga0105247_10002838
623 Ga0105247_10041491
624 Ga0105247_10168001
625 Ga0105247_10316405
626 Ga0114129_10020563
627 Ga0114129_10068603
628 Ga0114129_10078217
629 Ga0114129_10134760
630 Ga0114129_10302143
631 Ga0114129_10476416
632 Ga0114129_11419716
633 Ga0105243_10009443
634 Ga0105243_10028150
635 Ga0105243_10379957
636 Ga0105241_10074904
637 Ga0105241_10117071
638 Ga0105241_10153506
639 Ga0105241_10155764
640 Ga0105241_10236531
641 Ga0105241_10312416
642 Ga0105241_10313315
643 Ga0105241_10348131
644 Ga0105241_10790658
645 Ga0105241_10980067
646 Ga0105242_10057901
647 Ga0105242_10113448
648 Ga0105248_10070520
649 Ga0105248_10177343
650 Ga0105248_10269277
651 Ga0105248_10779242
652 Ga0105237_10000478
653 Ga0105237_10255984
654 Ga0105237_10264826
655 Ga0105237_10497148
656 Ga0105238_10000531
657 Ga0105238_11192090
658 Ga0105249_10018842
659 Ga0105249_10276627
660 Ga0105249_10707661
661 Ga0105239_10064067
662 Ga0105239_10797251
663 Ga0105239_10982884
664 Ga0105246_10021695
665 Ga0105246_10131980
666 Ga0157373_10001614
667 Ga0157373_10401836
668 Ga0157374_10778750
669 Ga0157378_10096603
670 Ga0157378_10915590
671 Ga0163162_10134395
672 Ga0163162_10259879
673 Ga0163162_10599297
674 Ga0163162_10721912
675 Ga0157372_10004240
676 Ga0157372_10018336
677 Ga0157372_11384403
678 Ga0157375_10006978
679 Ga0157375_10161069
680 Ga0157375_10639754
681 Ga0157375_11398534
682 Ga0163163_10000806
683 Ga0163163_10025451
684 Ga0163163_10167503
685 Ga0163163_10273597
686 Ga0163163_10843539
687 Ga0163163_10927787
688 Ga0163163_11496901
689 Ga0157380_10163789
690 Ga0157380_10181815
691 Ga0157377_10006616
692 Ga0157377_10066768
693 Ga0157377_10149277
694 Ga0157379_10050427
695 Ga0157379_10247349
696 Ga0157379_10527794
697 Ga0182007_10069982
698 Ga0207672_1000002
699 Ga0207656_10003877
700 Ga0207653_10000612
701 Ga0207642_10095415
702 Ga0207710_10000002
703 Ga0207710_10000567
704 Ga0207647_10015169
705 Ga0207647_10197723
706 Ga0207645_10150459
707 Ga0207643_10000737
708 Ga0207643_10022245
709 Ga0207643_10140525
710 Ga0207643_10307193
711 Ga0207684_10000030
712 Ga0207684_10001621
713 Ga0207684_10015479
714 Ga0207654_10057912
715 Ga0207654_10099522
716 Ga0207654_10165318
717 Ga0207654_10297860
718 Ga0207654_10580214
719 Ga0207707_10000007
720 Ga0207707_10083140
721 Ga0207695_10024787
722 Ga0207671_10001313
723 Ga0207671_10022147
724 Ga0207671_10112881
725 Ga0207660_10002909
726 Ga0207662_10054533
727 Ga0207649_10686747
728 Ga0207652_10000262
729 Ga0207652_10154289
730 Ga0207646_10019253
731 Ga0207646_10024586
732 Ga0207681_10010794
733 Ga0207694_10005208
734 Ga0207650_10000001
735 Ga0207650_10062952
736 Ga0207650_10237363
737 Ga0207650_10269166
738 Ga0207687_10124733
739 Ga0207687_10377345
740 Ga0207644_10000179
741 Ga0207690_10161716
742 Ga0207706_10299397
743 Ga0207686_10075194
744 Ga0207686_10192183
745 Ga0207709_10005361
746 Ga0207709_10107675
747 Ga0207704_10117633
748 Ga0207665_10220038
749 Ga0207691_10216947
750 Ga0207711_10002453
751 Ga0207711_10012194
752 Ga0207711_10518142
753 Ga0207689_10106617
754 Ga0207689_10135951
755 Ga0207689_10330832
756 Ga0207689_10475102
757 Ga0207689_10875738
758 Ga0207679_10162564
759 Ga0207679_10195175
760 Ga0207651_10073312
761 Ga0207651_10150077
762 Ga0207651_10460212
763 Ga0207651_10520265
764 Ga0207712_10048808
765 Ga0207712_10129718
766 Ga0207640_10833834
767 Ga0207703_10000114
768 Ga0207703_10146812
769 Ga0207703_10210861
770 Ga0207703_11006703
771 Ga0207708_10006106
772 Ga0207708_10012733
773 Ga0207708_10062301
774 Ga0207702_10108802
775 Ga0207641_10409315
776 Ga0207641_10849041
777 Ga0207648_10037088
778 Ga0207648_10146051
779 Ga0207648_10162081
780 Ga0207676_10001219
781 Ga0207676_10001273
782 Ga0207676_10017240
783 Ga0207676_10258370
784 Ga0207676_10394978
785 Ga0207676_10727798
786 Ga0207674_10120425
787 Ga0207674_10121207
788 Ga0207674_10147923
789 Ga0207674_10290476
790 Ga0207674_10327030
791 Ga0207674_10913850
792 Ga0207675_100007573
793 Ga0207675_101094565
794 Ga0207683_10293471
795 Ga0207698_10027675
796 Ga0207698_10471444
797 Ga0268265_10214898
798 Ga0268265_10681063
799 Ga0268265_10828049
800 Ga0268264_10084777
801 Ga0268264_10227159
802 Ga0268264_10308263
803 Ga0268264_10313738
804 Ga0314311_1154250
805 Ga0307408_100089674
806 Ga0307408_100433693
807 Ga0307405_10004874
808 Ga0307410_10065519
809 Ga0307406_10004079
810 Ga0307412_10036753
811 Ga0307416_100015704
812 Ga0307416_100287727
813 Ga0307415_100009505
814 Ga0373951_0000869
815 Ga0373932_0066699
816 Ga0373960_0074618
817 Ga0373961_0104505
818 Ga0373931_0071679
819 Ga0395900_0052138
820 Ga0395901_0215233
821 Ga0395901_0307653
822 Ga0395901_0452469
823 Ga0242422_00207
824 Ga0242420_000602
825 Ga0439448_0020746
826 Ga0439455_0080305
827 Ga0439458_0003705
828 Ga0451576_0399699
829 Ga0495636_0201904
830 Ga0496102_0014160
831 Ga0496104_0206364
832 Ga0496106_0109218
833 Ga0496106_0309539
834 Ga0496107_0166558
835 Ga0496108_0140968
836 Ga0496108_0240754
837 Ga0496108_0683460
838 Ga0496112_0199677
839 Ga0496112_0373149
840 Ga0496112_0497548
841 Ga0496112_0536169
842 Ga0501291_001252
843 Ga0501292_042631
844 Ga0501296_014890
845 Ga0501298_010040
846 Ga0501198_002422
847 Ga0501199_017693
848 Ga0501202_026519
849 Ga0501207_001016
850 Ga0501207_011226
851 Ga0501216_003681
852 Ga0501216_009926
853 Ga0501216_055294
854 Ga0501217_000844
855 Ga0501217_016774
856 Ga0501223_001667
857 Ga0501223_006850
858 Ga0501224_001399
859 Ga0501224_004623
860 Ga0501227_007645
861 Ga0501230_012607
862 Ga0501233_007095
863 Ga0501233_031408
864 Ga0501235_007396
865 Ga0501236_005898
866 Ga0501239_003331
867 Ga0501240_006966
868 Ga0501240_012568
869 Ga0501243_004219
870 Ga0501243_040823
871 Ga0501251_003994
872 Ga0501221_019241
873 Ga0501221_059485
874 Ga0501225_0015191
875 Ga0501229_005340
876 Ga0501234_006950
877 Ga0501245_008472
878 Ga0501268_027060
879 Ga0501272_009950
880 Ga0501273_008802
881 Ga0501212_026337
882 Ga0501226_007081
883 nmdc:mga05p37_233204_c1
884 nmdc:mga05p37_351171_c1
885 nmdc:mga05p37_56689_c1
886 nmdc:mga09592_235884_c1
887 nmdc:mga0qj67_66476_c1
888 nmdc:mga06r32_207625_c1
889 nmdc:mga06r32_716944_c1
890 nmdc:mga08y16_126438_c1
891 nmdc:mga08y16_252708_c1
892 nmdc:mga0n895_126566_c1
893 nmdc:mga0n895_49700_c1
894 nmdc:mga0n895_92750_c1
895 nmdc:mga0rr50_40052_c1
896 nmdc:mga0rr50_46937_c1
897 nmdc:mga0a205_11197_c1
898 nmdc:mga0a205_22394_c1
899 nmdc:mga0a205_308952_c1
900 nmdc:mga0a205_571549_c1
901 nmdc:mga0a205_7485_c1
902 Ga0500644_0197775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11984

DUF3485

Protein of unknown function (DUF3485)

9

211

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6psy-assembly1.cif.gz_A cryo-em structure of s. cerevisiae drs2p-cdc50p in the autoinhibited apo form 0.6344 47 87
4gfc-assembly1.cif.gz_B n-terminal coiled-coil dimer of c.elegans sas-6, crystal form b 0.6323 109 145
7atm-assembly1.cif.gz_A structure of p. aeruginosa pbp3 in complex with a phenyl boronic acid (compound 1) 0.5539 129 209
4qgu-assembly1.cif.gz_B protein domain complex with ssdna 0.5268 110 145
3ul5-assembly1.cif.gz_A saccharum officinarum canecystatin-1 in space group c2221 0.5248 97 143
ID Description Score Start End Superfamily
af_Q54YZ6_966_1109_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7518 107 146 2.30.29.30
af_A0A1D8PGZ4_146_362_3.40.50.12050 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6986 109 146 3.40.50.12050
af_A0A0R4IVP6_260_438_2.30.29.230 Mainly Beta;Roll;PH-domain like; 0.6854 105 145 2.30.29.230
af_P05030_388_532_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.6438 46 88 3.40.1110.10
1aupA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.6413 111 139 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A2V8PRN3-F1-model_v4 EpsI family protein 0.8775 49 213
AF-A0A838MUP8-F1-model_v4 EpsI family protein 0.8734 63 213
AF-A0A7X0BTN9-F1-model_v4 Exosortase D (VPLPA-CTERM-specific) 0.8725 33 213 GO:0005886
GO:0006508
GO:0008233
AF-A0A286GYZ4-F1-model_v4 Exosortase D, VPLPA-CTERM-specific 0.8709 33 213 GO:0005886
GO:0006508
GO:0008233
AF-A0A1E7HJ13-F1-model_v4 EpsI family protein 0.8706 34 213

Map