F446883

General Info

Members Datasets Scaffolds Average Seq Length
451 302 902 290

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0007633|Ga0500616_0007633_2669_3559
Length 296
Sequence MPPAKTSLDELNIAPRADFVRVLGEIFEHSPWVAEQASAGRQFDTVQALHDAMMRAVSTAPLGKKHEFLRGHPDLAGSAARAGTMAAASVSEQSGLGLSNLSDAEYDDFQWLNAAYREKFGFPFIICVRRQTRDAVLAAFRRRLRNNQDTELAAAIEEIGYITRLRLADSVEGPGMPNISGHLSTHVLDAYHGEPAAGVSLDLFELGGEARARIASAVTNDHGRTDQPLLHDAPLRAGRYEIVFYLGDYFRRRGVDLPDHPFVDDVVLRFGIDRPEGRYHVPVVATPWSYSTYRGS

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
85 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
86 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
87 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
88 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
244 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
245 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
246 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
247 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
248 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
249 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
250 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
251 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
254 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
255 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
256 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
261 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
262 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
263 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
268 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
272 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
273 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
274 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
275 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
278 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
279 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
280 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
281 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
282 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
283 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
284 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
285 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
286 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
287 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
288 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
289 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
290 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
291 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
292 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
293 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
294 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
295 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
296 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
297 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
298 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
299 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
300 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
301 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
302 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.9
Metatranscriptomes 0
Isolates 5.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.85
Nodule 3.1
Rhizoplane 2.44
Rhizosphere 62.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0007633 3300053153 Bacteria 6833
2 JGI24740J21852_10001002 3300001979 Bacteria 12642
3 JGI25153J46596_10069287 3300003215 Bacteria 921
4 rootH2_10047976 3300003320 Bacteria 1381
5 rootH1_10203834 3300003323 Bacteria 1513
6 Ga0065165_1015464 3300005262 Bacteria 2907
7 Ga0070690_100094681 3300005330 Bacteria 1971
8 Ga0068869_100115215 3300005334 Bacteria 2049
9 Ga0068869_100157557 3300005334 Bacteria 1766
10 Ga0070689_100132678 3300005340 Bacteria 1998
11 Ga0070661_100208515 3300005344 Bacteria 1495
12 Ga0070668_100001663 3300005347 Bacteria 16126
13 Ga0070675_100143729 3300005354 Bacteria 2041
14 Ga0070671_100013459 3300005355 Bacteria 6595
15 Ga0070674_100006879 3300005356 Bacteria 6665
16 Ga0070674_100293318 3300005356 Bacteria 1294
17 Ga0070673_100308246 3300005364 Bacteria 1396
18 Ga0070659_100257260 3300005366 Bacteria 1448
19 Ga0070709_10000216 3300005434 Bacteria 37230
20 Ga0070709_10310541 3300005434 Bacteria 1154
21 Ga0070713_100025222 3300005436 Bacteria 4645
22 Ga0070713_100031259 3300005436 Bacteria 4240
23 Ga0070713_100483445 3300005436 Bacteria 1167
24 Ga0070710_10000168 3300005437 Bacteria 30165
25 Ga0070710_10219682 3300005437 Bacteria 1209
26 Ga0070711_100001315 3300005439 Bacteria 13526
27 Ga0070711_100023924 3300005439 Bacteria 3980
28 Ga0070711_100063271 3300005439 Bacteria 2582
29 Ga0070708_100345484 3300005445 Bacteria 1402
30 Ga0070663_100012208 3300005455 Bacteria 5424
31 Ga0070663_100018982 3300005455 Bacteria 4521
32 Ga0070663_100081715 3300005455 Bacteria 2376
33 Ga0070663_100089112 3300005455 Bacteria 2282
34 Ga0070662_100154899 3300005457 Bacteria 1788
35 Ga0070685_10066400 3300005466 Bacteria 2125
36 Ga0070685_10104535 3300005466 Bacteria 1734
37 Ga0070698_100194446 3300005471 Bacteria 1966
38 Ga0068853_100005002 3300005539 Bacteria 10333
39 Ga0068853_100026893 3300005539 Bacteria 4834
40 Ga0070672_100024998 3300005543 Bacteria 4423
41 Ga0070672_100137892 3300005543 Bacteria 2010
42 Ga0070693_100040785 3300005547 Bacteria 2608
43 Ga0070665_100034295 3300005548 Bacteria 5104
44 Ga0070665_100105121 3300005548 Bacteria 2825
45 Ga0070665_100352732 3300005548 Bacteria 1477
46 Ga0068855_100095224 3300005563 Bacteria 3432
47 Ga0070664_100049815 3300005564 Bacteria 3543
48 Ga0068857_100000640 3300005577 Bacteria 25797
49 Ga0068857_100045976 3300005577 Bacteria 3873
50 Ga0068857_100369863 3300005577 Bacteria 1330
51 Ga0068854_100000965 3300005578 Bacteria 17315
52 Ga0068856_100058075 3300005614 Bacteria 3821
53 Ga0068852_100010380 3300005616 Bacteria 6958
54 Ga0068852_100272209 3300005616 Bacteria 1630
55 Ga0068859_100165021 3300005617 Bacteria 2294
56 Ga0068859_100432794 3300005617 Bacteria 1412
57 Ga0068864_100010766 3300005618 Bacteria 7558
58 Ga0068861_100004354 3300005719 Bacteria 9498
59 Ga0068861_100084643 3300005719 Bacteria 2490
60 Ga0068861_100150104 3300005719 Bacteria 1911
61 Ga0068851_10000530 3300005834 Bacteria 16634
62 Ga0068858_100005194 3300005842 Bacteria 12756
63 Ga0068860_100108995 3300005843 Bacteria 2646
64 Ga0068862_100077878 3300005844 Bacteria 2872
65 Ga0068862_100097839 3300005844 Bacteria 2562
66 Ga0081455_10005751 3300005937 Bacteria 13521
67 Ga0081455_10020927 3300005937 Bacteria 6147
68 Ga0081455_10089098 3300005937 Bacteria 2505
69 Ga0081540_1004946 3300005983 Bacteria 10018
70 Ga0081540_1006096 3300005983 Bacteria 8859
71 Ga0081540_1007967 3300005983 Bacteria 7465
72 Ga0081540_1079920 3300005983 Bacteria 1476
73 Ga0081539_10015264 3300005985 Bacteria 5594
74 Ga0070717_10008396 3300006028 Bacteria 7713
75 Ga0070717_10046464 3300006028 Bacteria 3552
76 Ga0075365_10025018 3300006038 Bacteria 3775
77 Ga0075365_10227740 3300006038 Bacteria 1308
78 Ga0075368_10005784 3300006042 Bacteria 4276
79 Ga0075363_100042972 3300006048 Bacteria 2389
80 Ga0075363_100217269 3300006048 Bacteria 1095
81 Ga0075364_10023486 3300006051 Bacteria 3903
82 Ga0075364_10054743 3300006051 Bacteria 2609
83 Ga0075364_10061645 3300006051 Bacteria 2460
84 Ga0070715_10069182 3300006163 Bacteria 1572
85 Ga0070716_100001374 3300006173 Bacteria 10810
86 Ga0070712_100011774 3300006175 Bacteria 5559
87 Ga0070712_100029755 3300006175 Bacteria 3663
88 Ga0070712_100409912 3300006175 Bacteria 1121
89 Ga0075367_10021059 3300006178 Bacteria 3639
90 Ga0075367_10073460 3300006178 Bacteria 2060
91 Ga0075369_10002787 3300006186 Bacteria 6279
92 Ga0075366_10201787 3300006195 Bacteria 1210
93 Ga0097621_100091200 3300006237 Bacteria 2551
94 Ga0075370_10021530 3300006353 Bacteria 3532
95 Ga0068871_100091476 3300006358 Bacteria 2536
96 Ga0075428_100094516 3300006844 Bacteria 3259
97 Ga0068865_100049488 3300006881 Bacteria 2897
98 Ga0068865_100094197 3300006881 Bacteria 2179
99 Ga0097620_100165027 3300006931 Bacteria 2294
100 Ga0097620_100432722 3300006931 Bacteria 1412
101 Ga0105250_10021087 3300009092 Bacteria 2630
102 Ga0105240_10005299 3300009093 Bacteria 19243
103 Ga0105245_10003785 3300009098 Bacteria 13456
104 Ga0105247_10021348 3300009101 Bacteria 3896
105 Ga0114129_10166071 3300009147 Bacteria 3012
106 Ga0105243_10010813 3300009148 Bacteria 6906
107 Ga0105241_10001238 3300009174 Bacteria 19477
108 Ga0105241_10031306 3300009174 Bacteria 3983
109 Ga0105248_10059623 3300009177 Bacteria 4287
110 Ga0105237_10043184 3300009545 Bacteria 4543
111 Ga0105238_10001034 3300009551 Bacteria 28265
112 Ga0105238_10069870 3300009551 Bacteria 3512
113 Ga0105249_10003943 3300009553 Bacteria 12810
114 Ga0105249_10047918 3300009553 Bacteria 3896
115 Ga0105239_10012073 3300010375 Bacteria 9631
116 Ga0105239_10063359 3300010375 Bacteria 4059
117 Ga0105239_10470173 3300010375 Bacteria 1428
118 Ga0105246_10006437 3300011119 Bacteria 7177
119 Ga0157378_10009302 3300013297 Bacteria 8559
120 Ga0157378_10389196 3300013297 Bacteria 1371
121 Ga0163162_10024905 3300013306 Bacteria 5912
122 Ga0163162_10138030 3300013306 Bacteria 2549
123 Ga0163162_10499808 3300013306 Bacteria 1346
124 Ga0163162_10620308 3300013306 Bacteria 1207
125 Ga0157375_10177329 3300013308 Bacteria 2281
126 Ga0163163_10014512 3300014325 Bacteria 7245
127 Ga0157380_10008291 3300014326 Bacteria 7404
128 Ga0157379_10186724 3300014968 Bacteria 1873
129 Ga0157379_10379599 3300014968 Bacteria 1297
130 Ga0157376_10099258 3300014969 Bacteria 2540
131 Ga0163161_10013156 3300017792 Bacteria 5752
132 Ga0163161_10345019 3300017792 Bacteria 1182
133 Ga0214544_1000013 3300021320 Bacteria 228947
134 Ga0214542_1000013 3300021321 Bacteria 234019
135 Ga0214545_1001323 3300021324 Bacteria 45766
136 Ga0214543_1010219 3300021327 Bacteria 14055
137 Ga0209563_101717 3300025230 Bacteria 5532
138 Ga0209564_1001014 3300025295 Bacteria 34834
139 Ga0209564_1020819 3300025295 Bacteria 2388
140 Ga0209758_1005026 3300025297 Bacteria 10533
141 Ga0209758_1015305 3300025297 Bacteria 3986
142 Ga0209758_1046802 3300025297 Bacteria 1555
143 Ga0207426_1006396 3300025302 Bacteria 5133
144 Ga0207426_1018097 3300025302 Bacteria 2489
145 Ga0207656_10072156 3300025321 Bacteria 1536
146 Ga0207696_1055405 3300025711 Bacteria 1125
147 Ga0207692_10001092 3300025898 Bacteria 9943
148 Ga0207692_10029017 3300025898 Bacteria 2624
149 Ga0207710_10029975 3300025900 Bacteria 2371
150 Ga0207699_10000420 3300025906 Bacteria 21716
151 Ga0207699_10037387 3300025906 Bacteria 2775
152 Ga0207699_10047790 3300025906 Bacteria 2510
153 Ga0207643_10128528 3300025908 Bacteria 1506
154 Ga0207654_10000635 3300025911 Bacteria 19837
155 Ga0207695_10002964 3300025913 Bacteria 24489
156 Ga0207671_10004970 3300025914 Bacteria 12459
157 Ga0207671_10203173 3300025914 Bacteria 1548
158 Ga0207693_10009177 3300025915 Bacteria 8077
159 Ga0207693_10019200 3300025915 Bacteria 5440
160 Ga0207693_10035032 3300025915 Bacteria 3959
161 Ga0207663_10010424 3300025916 Bacteria 4949
162 Ga0207663_10117729 3300025916 Bacteria 1813
163 Ga0207681_10163427 3300025923 Bacteria 1681
164 Ga0207694_10000621 3300025924 Bacteria 32250
165 Ga0207694_10143834 3300025924 Bacteria 1919
166 Ga0207650_10094114 3300025925 Bacteria 2295
167 Ga0207659_10034958 3300025926 Bacteria 3470
168 Ga0207687_10001252 3300025927 Bacteria 17372
169 Ga0207700_10040315 3300025928 Bacteria 3408
170 Ga0207664_10018648 3300025929 Bacteria 5113
171 Ga0207664_10021437 3300025929 Bacteria 4805
172 Ga0207644_10270505 3300025931 Bacteria 1361
173 Ga0207690_10131792 3300025932 Bacteria 1830
174 Ga0207686_10025162 3300025934 Bacteria 3458
175 Ga0207709_10037221 3300025935 Bacteria 2890
176 Ga0207704_10023699 3300025938 Bacteria 3313
177 Ga0207704_10308586 3300025938 Bacteria 1215
178 Ga0207691_10024554 3300025940 Bacteria 5669
179 Ga0207691_10092968 3300025940 Bacteria 2701
180 Ga0207691_10282487 3300025940 Bacteria 1428
181 Ga0207691_10310304 3300025940 Bacteria 1354
182 Ga0207711_10064100 3300025941 Bacteria 3173
183 Ga0207711_10227832 3300025941 Bacteria 1706
184 Ga0207689_10004834 3300025942 Bacteria 12148
185 Ga0207689_10011354 3300025942 Bacteria 7637
186 Ga0207689_10050348 3300025942 Bacteria 3435
187 Ga0207679_10456076 3300025945 Bacteria 1134
188 Ga0207667_10010398 3300025949 Bacteria 10879
189 Ga0207667_10562009 3300025949 Bacteria 1153
190 Ga0207712_10147711 3300025961 Bacteria 1812
191 Ga0207668_10003177 3300025972 Bacteria 9622
192 Ga0207668_10076786 3300025972 Bacteria 2406
193 Ga0207640_10007975 3300025981 Bacteria 5849
194 Ga0207677_10004452 3300026023 Bacteria 7522
195 Ga0207703_10007538 3300026035 Bacteria 8631
196 Ga0207703_10100366 3300026035 Bacteria 2452
197 Ga0207639_10547612 3300026041 Bacteria 1062
198 Ga0207678_10007571 3300026067 Bacteria 9599
199 Ga0207678_10011047 3300026067 Bacteria 7933
200 Ga0207678_10020485 3300026067 Bacteria 5798
201 Ga0207678_10024569 3300026067 Bacteria 5263
202 Ga0207678_10492269 3300026067 Bacteria 1068
203 Ga0207708_10076705 3300026075 Bacteria 2564
204 Ga0207708_10123430 3300026075 Bacteria 2020
205 Ga0207702_10000094 3300026078 Bacteria 103202
206 Ga0207702_10000095 3300026078 Bacteria 102704
207 Ga0207676_10006740 3300026095 Bacteria 8129
208 Ga0207674_10001319 3300026116 Bacteria 32297
209 Ga0207674_10040382 3300026116 Bacteria 4833
210 Ga0207674_10187990 3300026116 Bacteria 2015
211 Ga0207675_100001130 3300026118 Bacteria 26475
212 Ga0207675_100105175 3300026118 Bacteria 2660
213 Ga0207675_100112465 3300026118 Bacteria 2570
214 Ga0207675_100201392 3300026118 Bacteria 1912
215 Ga0207683_10024842 3300026121 Bacteria 5163
216 Ga0207683_10158469 3300026121 Bacteria 2045
217 Ga0207683_10327962 3300026121 Bacteria 1403
218 Ga0207698_10041821 3300026142 Bacteria 3419
219 Ga0207698_10290034 3300026142 Bacteria 1518
220 Ga0268266_10025575 3300028379 Bacteria 5021
221 Ga0268266_10028941 3300028379 Bacteria 4707
222 Ga0268265_10204784 3300028380 Bacteria 1714
223 Ga0268264_10016688 3300028381 Bacteria 6012
224 Ga0268264_10230175 3300028381 Bacteria 1711
225 Ga0307517_10000392 3300028786 Bacteria 74887
226 Ga0307517_10147473 3300028786 Bacteria 1627
227 Ga0307515_10042832 3300028794 Bacteria 7063
228 Ga0307515_10072467 3300028794 Bacteria 4648
229 Ga0265339_10012071 3300031249 Bacteria 5294
230 Ga0307513_10067820 3300031456 Bacteria 3740
231 Ga0307509_10124228 3300031507 Bacteria 2551
232 Ga0307508_10119193 3300031616 Bacteria 2241
233 Ga0307508_10120236 3300031616 Bacteria 2229
234 Ga0307508_10296428 3300031616 Bacteria 1210
235 Ga0265314_10008999 3300031711 Bacteria 8493
236 Ga0265342_10003733 3300031712 Bacteria 12318
237 Ga0307516_10004020 3300031730 Bacteria 18431
238 Ga0307516_10014362 3300031730 Bacteria 8382
239 Ga0307412_10155789 3300031911 Bacteria 1691
240 Ga0307416_100413277 3300032002 Bacteria 1391
241 Ga0307510_10005065 3300033180 Bacteria 15634
242 Ga0307510_10147426 3300033180 Bacteria 1981
243 Ga0373926_0076522 3300035083 Bacteria 1234
244 Ga0373936_0059906 3300035113 Bacteria 1552
245 Ga0373953_0013850 3300035117 Bacteria 2889
246 Ga0373954_0059618 3300035118 Bacteria 1799
247 Ga0373955_0050388 3300035172 Bacteria 2264
248 Ga0373924_0062648 3300035410 Bacteria 1558
249 Ga0373935_0030482 3300035692 Bacteria 3343
250 Ga0373927_0016760 3300035695 Bacteria 4833
251 Ga0373927_0162525 3300035695 Bacteria 1463
252 Ga0373937_0074808 3300036401 Bacteria 3126
253 Ga0373937_0256598 3300036401 Bacteria 1648
254 Ga0373925_0196376 3300037068 Bacteria 1603
255 Ga0436364_0938298 3300037853 Bacteria 2034
256 Ga0436363_1317613 3300039450 Bacteria 4775
257 Ga0466972_0047293 3300044658 Bacteria 2081
258 Ga0466966_0027320 3300044684 Bacteria 3722
259 Ga0466963_0349077 3300044694 Bacteria 1042
260 Ga0466967_0340987 3300045976 Bacteria 1449
261 Ga0495592_0093766 3300046454 Bacteria 2150
262 Ga0495603_0030560 3300046455 Bacteria 3243
263 Ga0495603_0039693 3300046455 Bacteria 2819
264 Ga0495603_0076706 3300046455 Bacteria 1961
265 Ga0495638_0013878 3300046460 Bacteria 5464
266 Ga0495638_0114078 3300046460 Bacteria 1602
267 Ga0495651_0012738 3300046462 Bacteria 6492
268 Ga0495580_0014285 3300046472 Bacteria 6025
269 Ga0495580_0185261 3300046472 Bacteria 1437
270 Ga0495582_0085830 3300046473 Bacteria 1751
271 Ga0495605_0028213 3300046474 Bacteria 2899
272 Ga0495584_0089334 3300046491 Bacteria 1553
273 Ga0495585_0163904 3300046492 Bacteria 1152
274 Ga0495594_0078080 3300046499 Bacteria 1847
275 Ga0495596_0046391 3300046500 Bacteria 1707
276 Ga0495606_0124006 3300046507 Bacteria 1542
277 Ga0495606_0186708 3300046507 Bacteria 1191
278 Ga0495608_0125025 3300046511 Bacteria 1648
279 Ga0495616_0080564 3300046513 Bacteria 1559
280 Ga0495616_0110248 3300046513 Bacteria 1279
281 Ga0495628_0081540 3300046516 Bacteria 2513
282 Ga0495630_0078882 3300046517 Bacteria 2483
283 Ga0495631_0021630 3300046518 Bacteria 2995
284 Ga0495631_0047638 3300046518 Bacteria 1881
285 Ga0495632_0059427 3300046519 Bacteria 1860
286 Ga0495632_0137140 3300046519 Bacteria 1136
287 Ga0495637_0081124 3300046520 Bacteria 1293
288 Ga0495643_0093264 3300046522 Bacteria 1551
289 Ga0495648_0023312 3300046524 Bacteria 4243
290 Ga0495663_0051834 3300046525 Bacteria 1272
291 Ga0495665_0029485 3300046531 Bacteria 2939
292 Ga0495640_0239684 3300046533 Bacteria 1139
293 Ga0495586_0087920 3300046535 Bacteria 1714
294 Ga0495622_0003392 3300046557 Bacteria 7518
295 Ga0495622_0103972 3300046557 Bacteria 1301
296 Ga0495667_0060553 3300046559 Bacteria 2483
297 Ga0495656_0003122 3300046615 Bacteria 5572
298 Ga0495668_0045526 3300046616 Bacteria 2439
299 Ga0495611_0067038 3300046648 Bacteria 1638
300 Ga0495611_0110318 3300046648 Bacteria 1280
301 Ga0495625_0112388 3300046660 Bacteria 1861
302 Ga0495625_0128066 3300046660 Bacteria 1722
303 Ga0495625_0183600 3300046660 Bacteria 1389
304 Ga0495635_0168394 3300046663 Bacteria 1490
305 Ga0495659_0012785 3300046664 Bacteria 2725
306 Ga0495659_0073157 3300046664 Bacteria 1288
307 Ga0495661_0053118 3300046665 Bacteria 2438
308 Ga0495588_0057788 3300046674 Bacteria 2004
309 Ga0495623_0252746 3300046679 Bacteria 990
310 Ga0495658_0186132 3300046683 Bacteria 1289
311 Ga0495669_0002883 3300046684 Bacteria 7058
312 Ga0495669_0118148 3300046684 Bacteria 1241
313 Ga0495613_0034517 3300046689 Bacteria 3757
314 Ga0495624_0074022 3300046690 Bacteria 2117
315 Ga0495670_0004968 3300046691 Bacteria 6534
316 Ga0495604_0137018 3300047317 Bacteria 1753
317 Ga0495636_0048776 3300047318 Bacteria 1770
318 Ga0495672_0076634 3300047320 Bacteria 1877
319 Ga0495676_0140030 3300047321 Bacteria 1735
320 Ga0495677_0110166 3300047445 Bacteria 1046
321 Ga0495673_0024686 3300047469 Bacteria 2898
322 Ga0495686_0114747 3300047472 Bacteria 1612
323 Ga0495686_0179214 3300047472 Bacteria 1229
324 Ga0495593_0040511 3300047673 Bacteria 2508
325 Ga0495626_0070871 3300048091 Bacteria 1567
326 Ga0496100_0084935 3300048903 Bacteria 2147
327 Ga0496106_0071667 3300048909 Bacteria 2649
328 Ga0496107_0165680 3300048910 Bacteria 1639
329 Ga0496108_0130201 3300048911 Bacteria 2163
330 Ga0496109_0031281 3300048912 Bacteria 4775
331 Ga0496111_0401933 3300048914 Bacteria 1012
332 Ga0496112_0307590 3300048915 Bacteria 1530
333 Ga0496114_0084865 3300048917 Bacteria 2682
334 Ga0496115_0304199 3300048918 Bacteria 1306
335 Ga0496116_0004643 3300048919 Bacteria 13010
336 Ga0496117_0024434 3300048920 Bacteria 4781
337 Ga0496117_0096128 3300048920 Bacteria 1891
338 Ga0496117_0104693 3300048920 Bacteria 1780
339 Ga0496118_0026907 3300048921 Bacteria 4884
340 Ga0496119_0086649 3300048922 Bacteria 1789
341 Ga0496120_0041444 3300048923 Bacteria 2697
342 Ga0496120_0050102 3300048923 Bacteria 2393
343 Ga0496121_0012483 3300048924 Bacteria 9252
344 Ga0496121_0025602 3300048924 Bacteria 5592
345 Ga0496121_0032956 3300048924 Bacteria 4699
346 Ga0496121_0051292 3300048924 Bacteria 3476
347 Ga0496121_0079496 3300048924 Bacteria 2603
348 Ga0496121_0087275 3300048924 Bacteria 2449
349 Ga0496121_0111387 3300048924 Bacteria 2087
350 Ga0496121_0116368 3300048924 Bacteria 2028
351 Ga0496121_0152909 3300048924 Bacteria 1696
352 Ga0496121_0192490 3300048924 Bacteria 1461
353 Ga0496122_0176124 3300048925 Bacteria 1282
354 Ga0496123_0058382 3300048926 Bacteria 2503
355 Ga0496123_0077901 3300048926 Bacteria 2034
356 Ga0496124_0030178 3300048927 Bacteria 4816
357 Ga0496125_0001755 3300048928 Bacteria 30072
358 Ga0496125_0006438 3300048928 Bacteria 12694
359 Ga0496126_0023992 3300048929 Bacteria 5897
360 Ga0496126_0025042 3300048929 Bacteria 5750
361 Ga0496126_0068744 3300048929 Bacteria 3161
362 Ga0496126_0224424 3300048929 Bacteria 1576
363 Ga0496126_0264443 3300048929 Bacteria 1429
364 Ga0496126_0458758 3300048929 Bacteria 1024
365 Ga0495678_015491 3300049459 Bacteria 3505
366 Ga0501069_0222980 3300049585 Bacteria 1096
367 nmdc:mga03n38_8146_c1 3300050490 Bacteria 3745
368 nmdc:mga00v17_118560_c1 3300050491 Bacteria 1684
369 nmdc:mga00v17_59521_c1 3300050491 Bacteria 2344
370 nmdc:mga0yw44_254294_c1 3300050492 Bacteria 1170
371 nmdc:mga06z11_6382_c1 3300050494 Bacteria 4792
372 nmdc:mga06z11_85969_c1 3300050494 Bacteria 1698
373 nmdc:mga07m45_161121_c1 3300050496 Bacteria 1302
374 nmdc:mga07m45_45167_c1 3300050496 Bacteria 1224
375 nmdc:mga05p37_108990_c1 3300050507 Bacteria 3406
376 Ga0500635_0006821 3300053080 Bacteria 3066
377 Ga0500578_0214408 3300053086 Bacteria 1173
378 Ga0500581_159365 3300053089 Bacteria 1050
379 Ga0500651_0204616 3300053093 Bacteria 1163
380 Ga0500566_0000446 3300053094 Bacteria 23002
381 Ga0500566_0000506 3300053094 Bacteria 21763
382 Ga0500566_0015456 3300053094 Bacteria 4481
383 Ga0500640_009085 3300053095 Bacteria 3957
384 Ga0500641_0003794 3300053096 Bacteria 5344
385 Ga0500641_0055922 3300053096 Bacteria 1634
386 Ga0500554_019508 3300053102 Bacteria 1849
387 Ga0500555_039738 3300053103 Bacteria 1313
388 Ga0500556_0000003 3300053104 Bacteria 679379
389 Ga0500562_017311 3300053108 Bacteria 1857
390 Ga0500562_022454 3300053108 Bacteria 1645
391 Ga0500569_005451 3300053109 Bacteria 2733
392 Ga0500569_005702 3300053109 Bacteria 2689
393 Ga0500572_072059 3300053111 Bacteria 1069
394 Ga0500592_004246 3300053116 Bacteria 2288
395 Ga0500595_021775 3300053119 Bacteria 2282
396 Ga0500608_027334 3300053122 Bacteria 2688
397 Ga0500614_000626 3300053123 Bacteria 9008
398 Ga0500618_023023 3300053125 Bacteria 1511
399 Ga0500642_0005633 3300053130 Bacteria 4059
400 Ga0500642_0095919 3300053130 Bacteria 1375
401 Ga0500652_017706 3300053131 Bacteria 2616
402 Ga0500655_016769 3300053133 Bacteria 1350
403 Ga0500559_0000146 3300053136 Bacteria 55375
404 Ga0500559_0001239 3300053136 Bacteria 15040
405 Ga0500568_0001368 3300053139 Bacteria 15849
406 Ga0500577_0000111 3300053142 Bacteria 20046
407 Ga0500577_0032392 3300053142 Bacteria 1838
408 Ga0500577_0049884 3300053142 Bacteria 1567
409 Ga0500586_016151 3300053145 Bacteria 2259
410 Ga0500603_000046 3300053150 Bacteria 30040
411 Ga0500616_0000041 3300053153 Bacteria 359328
412 Ga0500616_0133616 3300053153 Bacteria 1169
413 Ga0500616_0180316 3300053153 Bacteria 951
414 Ga0500622_0022350 3300053156 Bacteria 3353
415 Ga0500622_0037800 3300053156 Bacteria 2521
416 Ga0500622_0157345 3300053156 Bacteria 1068
417 Ga0500627_0047453 3300053158 Bacteria 1863
418 Ga0500627_0064267 3300053158 Bacteria 1618
419 Ga0500630_001607 3300053159 Bacteria 10819
420 Ga0500633_0007526 3300053160 Bacteria 2749
421 Ga0500634_0143014 3300053161 Bacteria 1130
422 Ga0500638_028594 3300053162 Bacteria 2680
423 Ga0500638_040714 3300053162 Bacteria 2256
424 Ga0500639_000085 3300053163 Bacteria 44045
425 Ga0500636_0000625 3300053177 Bacteria 19115
426 Ga0500637_0124166 3300053178 Bacteria 1497
427 Ga0500596_000872 3300053735 Bacteria 6003
428 Ga0500599_001455 3300053736 Bacteria 2725
429 2508544485 2508501009 Bacteria 7784016
430 2603860721 2602042107 Bacteria 6226103
431 2617378782 2617270741 Bacteria 8201522
432 2671121996 2667528175 Bacteria 7532676
433 2793068983 2791355197 Bacteria 8420563
434 2824681188 2824679649 Bacteria 8248951
435 2824739071 2824732956 Bacteria 7810675
436 2824750436 2824746037 Bacteria 7911610
437 2841960562 2841957949 Bacteria 8652217
438 2857524840 2857524615 Bacteria 6615449
439 2874611649 2874604998 Bacteria 7834745
440 2874613003 2874612657 Bacteria 8252029
441 2885376609 2885374607 Bacteria 8927485
442 2885417589 2885409591 Bacteria 9235467
443 2888388724 2888388044 Bacteria 7304136
444 2893069354 2893066018 Bacteria 6158120
445 2908741348 2908739725 Bacteria 8628932
446 2919078727 2919073203 Bacteria 6531949
447 2922387047 2922386360 Bacteria 7017218
448 2922399412 2922393267 Bacteria 8285685
449 3005475425 3005474847 Bacteria 9259049
450 3005594763 3005587118 Bacteria 7794411
451 3005712965 3005710791 Bacteria 7622528
452 Ga0500616_0007633
453 JGI24740J21852_10001002
454 JGI25153J46596_10069287
455 rootH2_10047976
456 rootH1_10203834
457 Ga0065165_1015464
458 Ga0070690_100094681
459 Ga0068869_100115215
460 Ga0068869_100157557
461 Ga0070689_100132678
462 Ga0070661_100208515
463 Ga0070668_100001663
464 Ga0070675_100143729
465 Ga0070671_100013459
466 Ga0070674_100006879
467 Ga0070674_100293318
468 Ga0070673_100308246
469 Ga0070659_100257260
470 Ga0070709_10000216
471 Ga0070709_10310541
472 Ga0070713_100025222
473 Ga0070713_100031259
474 Ga0070713_100483445
475 Ga0070710_10000168
476 Ga0070710_10219682
477 Ga0070711_100001315
478 Ga0070711_100023924
479 Ga0070711_100063271
480 Ga0070708_100345484
481 Ga0070663_100012208
482 Ga0070663_100018982
483 Ga0070663_100081715
484 Ga0070663_100089112
485 Ga0070662_100154899
486 Ga0070685_10066400
487 Ga0070685_10104535
488 Ga0070698_100194446
489 Ga0068853_100005002
490 Ga0068853_100026893
491 Ga0070672_100024998
492 Ga0070672_100137892
493 Ga0070693_100040785
494 Ga0070665_100034295
495 Ga0070665_100105121
496 Ga0070665_100352732
497 Ga0068855_100095224
498 Ga0070664_100049815
499 Ga0068857_100000640
500 Ga0068857_100045976
501 Ga0068857_100369863
502 Ga0068854_100000965
503 Ga0068856_100058075
504 Ga0068852_100010380
505 Ga0068852_100272209
506 Ga0068859_100165021
507 Ga0068859_100432794
508 Ga0068864_100010766
509 Ga0068861_100004354
510 Ga0068861_100084643
511 Ga0068861_100150104
512 Ga0068851_10000530
513 Ga0068858_100005194
514 Ga0068860_100108995
515 Ga0068862_100077878
516 Ga0068862_100097839
517 Ga0081455_10005751
518 Ga0081455_10020927
519 Ga0081455_10089098
520 Ga0081540_1004946
521 Ga0081540_1006096
522 Ga0081540_1007967
523 Ga0081540_1079920
524 Ga0081539_10015264
525 Ga0070717_10008396
526 Ga0070717_10046464
527 Ga0075365_10025018
528 Ga0075365_10227740
529 Ga0075368_10005784
530 Ga0075363_100042972
531 Ga0075363_100217269
532 Ga0075364_10023486
533 Ga0075364_10054743
534 Ga0075364_10061645
535 Ga0070715_10069182
536 Ga0070716_100001374
537 Ga0070712_100011774
538 Ga0070712_100029755
539 Ga0070712_100409912
540 Ga0075367_10021059
541 Ga0075367_10073460
542 Ga0075369_10002787
543 Ga0075366_10201787
544 Ga0097621_100091200
545 Ga0075370_10021530
546 Ga0068871_100091476
547 Ga0075428_100094516
548 Ga0068865_100049488
549 Ga0068865_100094197
550 Ga0097620_100165027
551 Ga0097620_100432722
552 Ga0105250_10021087
553 Ga0105240_10005299
554 Ga0105245_10003785
555 Ga0105247_10021348
556 Ga0114129_10166071
557 Ga0105243_10010813
558 Ga0105241_10001238
559 Ga0105241_10031306
560 Ga0105248_10059623
561 Ga0105237_10043184
562 Ga0105238_10001034
563 Ga0105238_10069870
564 Ga0105249_10003943
565 Ga0105249_10047918
566 Ga0105239_10012073
567 Ga0105239_10063359
568 Ga0105239_10470173
569 Ga0105246_10006437
570 Ga0157378_10009302
571 Ga0157378_10389196
572 Ga0163162_10024905
573 Ga0163162_10138030
574 Ga0163162_10499808
575 Ga0163162_10620308
576 Ga0157375_10177329
577 Ga0163163_10014512
578 Ga0157380_10008291
579 Ga0157379_10186724
580 Ga0157379_10379599
581 Ga0157376_10099258
582 Ga0163161_10013156
583 Ga0163161_10345019
584 Ga0214544_1000013
585 Ga0214542_1000013
586 Ga0214545_1001323
587 Ga0214543_1010219
588 Ga0209563_101717
589 Ga0209564_1001014
590 Ga0209564_1020819
591 Ga0209758_1005026
592 Ga0209758_1015305
593 Ga0209758_1046802
594 Ga0207426_1006396
595 Ga0207426_1018097
596 Ga0207656_10072156
597 Ga0207696_1055405
598 Ga0207692_10001092
599 Ga0207692_10029017
600 Ga0207710_10029975
601 Ga0207699_10000420
602 Ga0207699_10037387
603 Ga0207699_10047790
604 Ga0207643_10128528
605 Ga0207654_10000635
606 Ga0207695_10002964
607 Ga0207671_10004970
608 Ga0207671_10203173
609 Ga0207693_10009177
610 Ga0207693_10019200
611 Ga0207693_10035032
612 Ga0207663_10010424
613 Ga0207663_10117729
614 Ga0207681_10163427
615 Ga0207694_10000621
616 Ga0207694_10143834
617 Ga0207650_10094114
618 Ga0207659_10034958
619 Ga0207687_10001252
620 Ga0207700_10040315
621 Ga0207664_10018648
622 Ga0207664_10021437
623 Ga0207644_10270505
624 Ga0207690_10131792
625 Ga0207686_10025162
626 Ga0207709_10037221
627 Ga0207704_10023699
628 Ga0207704_10308586
629 Ga0207691_10024554
630 Ga0207691_10092968
631 Ga0207691_10282487
632 Ga0207691_10310304
633 Ga0207711_10064100
634 Ga0207711_10227832
635 Ga0207689_10004834
636 Ga0207689_10011354
637 Ga0207689_10050348
638 Ga0207679_10456076
639 Ga0207667_10010398
640 Ga0207667_10562009
641 Ga0207712_10147711
642 Ga0207668_10003177
643 Ga0207668_10076786
644 Ga0207640_10007975
645 Ga0207677_10004452
646 Ga0207703_10007538
647 Ga0207703_10100366
648 Ga0207639_10547612
649 Ga0207678_10007571
650 Ga0207678_10011047
651 Ga0207678_10020485
652 Ga0207678_10024569
653 Ga0207678_10492269
654 Ga0207708_10076705
655 Ga0207708_10123430
656 Ga0207702_10000094
657 Ga0207702_10000095
658 Ga0207676_10006740
659 Ga0207674_10001319
660 Ga0207674_10040382
661 Ga0207674_10187990
662 Ga0207675_100001130
663 Ga0207675_100105175
664 Ga0207675_100112465
665 Ga0207675_100201392
666 Ga0207683_10024842
667 Ga0207683_10158469
668 Ga0207683_10327962
669 Ga0207698_10041821
670 Ga0207698_10290034
671 Ga0268266_10025575
672 Ga0268266_10028941
673 Ga0268265_10204784
674 Ga0268264_10016688
675 Ga0268264_10230175
676 Ga0307517_10000392
677 Ga0307517_10147473
678 Ga0307515_10042832
679 Ga0307515_10072467
680 Ga0265339_10012071
681 Ga0307513_10067820
682 Ga0307509_10124228
683 Ga0307508_10119193
684 Ga0307508_10120236
685 Ga0307508_10296428
686 Ga0265314_10008999
687 Ga0265342_10003733
688 Ga0307516_10004020
689 Ga0307516_10014362
690 Ga0307412_10155789
691 Ga0307416_100413277
692 Ga0307510_10005065
693 Ga0307510_10147426
694 Ga0373926_0076522
695 Ga0373936_0059906
696 Ga0373953_0013850
697 Ga0373954_0059618
698 Ga0373955_0050388
699 Ga0373924_0062648
700 Ga0373935_0030482
701 Ga0373927_0016760
702 Ga0373927_0162525
703 Ga0373937_0074808
704 Ga0373937_0256598
705 Ga0373925_0196376
706 Ga0436364_0938298
707 Ga0436363_1317613
708 Ga0466972_0047293
709 Ga0466966_0027320
710 Ga0466963_0349077
711 Ga0466967_0340987
712 Ga0495592_0093766
713 Ga0495603_0030560
714 Ga0495603_0039693
715 Ga0495603_0076706
716 Ga0495638_0013878
717 Ga0495638_0114078
718 Ga0495651_0012738
719 Ga0495580_0014285
720 Ga0495580_0185261
721 Ga0495582_0085830
722 Ga0495605_0028213
723 Ga0495584_0089334
724 Ga0495585_0163904
725 Ga0495594_0078080
726 Ga0495596_0046391
727 Ga0495606_0124006
728 Ga0495606_0186708
729 Ga0495608_0125025
730 Ga0495616_0080564
731 Ga0495616_0110248
732 Ga0495628_0081540
733 Ga0495630_0078882
734 Ga0495631_0021630
735 Ga0495631_0047638
736 Ga0495632_0059427
737 Ga0495632_0137140
738 Ga0495637_0081124
739 Ga0495643_0093264
740 Ga0495648_0023312
741 Ga0495663_0051834
742 Ga0495665_0029485
743 Ga0495640_0239684
744 Ga0495586_0087920
745 Ga0495622_0003392
746 Ga0495622_0103972
747 Ga0495667_0060553
748 Ga0495656_0003122
749 Ga0495668_0045526
750 Ga0495611_0067038
751 Ga0495611_0110318
752 Ga0495625_0112388
753 Ga0495625_0128066
754 Ga0495625_0183600
755 Ga0495635_0168394
756 Ga0495659_0012785
757 Ga0495659_0073157
758 Ga0495661_0053118
759 Ga0495588_0057788
760 Ga0495623_0252746
761 Ga0495658_0186132
762 Ga0495669_0002883
763 Ga0495669_0118148
764 Ga0495613_0034517
765 Ga0495624_0074022
766 Ga0495670_0004968
767 Ga0495604_0137018
768 Ga0495636_0048776
769 Ga0495672_0076634
770 Ga0495676_0140030
771 Ga0495677_0110166
772 Ga0495673_0024686
773 Ga0495686_0114747
774 Ga0495686_0179214
775 Ga0495593_0040511
776 Ga0495626_0070871
777 Ga0496100_0084935
778 Ga0496106_0071667
779 Ga0496107_0165680
780 Ga0496108_0130201
781 Ga0496109_0031281
782 Ga0496111_0401933
783 Ga0496112_0307590
784 Ga0496114_0084865
785 Ga0496115_0304199
786 Ga0496116_0004643
787 Ga0496117_0024434
788 Ga0496117_0096128
789 Ga0496117_0104693
790 Ga0496118_0026907
791 Ga0496119_0086649
792 Ga0496120_0041444
793 Ga0496120_0050102
794 Ga0496121_0012483
795 Ga0496121_0025602
796 Ga0496121_0032956
797 Ga0496121_0051292
798 Ga0496121_0079496
799 Ga0496121_0087275
800 Ga0496121_0111387
801 Ga0496121_0116368
802 Ga0496121_0152909
803 Ga0496121_0192490
804 Ga0496122_0176124
805 Ga0496123_0058382
806 Ga0496123_0077901
807 Ga0496124_0030178
808 Ga0496125_0001755
809 Ga0496125_0006438
810 Ga0496126_0023992
811 Ga0496126_0025042
812 Ga0496126_0068744
813 Ga0496126_0224424
814 Ga0496126_0264443
815 Ga0496126_0458758
816 Ga0495678_015491
817 Ga0501069_0222980
818 nmdc:mga03n38_8146_c1
819 nmdc:mga00v17_118560_c1
820 nmdc:mga00v17_59521_c1
821 nmdc:mga0yw44_254294_c1
822 nmdc:mga06z11_6382_c1
823 nmdc:mga06z11_85969_c1
824 nmdc:mga07m45_161121_c1
825 nmdc:mga07m45_45167_c1
826 nmdc:mga05p37_108990_c1
827 Ga0500635_0006821
828 Ga0500578_0214408
829 Ga0500581_159365
830 Ga0500651_0204616
831 Ga0500566_0000446
832 Ga0500566_0000506
833 Ga0500566_0015456
834 Ga0500640_009085
835 Ga0500641_0003794
836 Ga0500641_0055922
837 Ga0500554_019508
838 Ga0500555_039738
839 Ga0500556_0000003
840 Ga0500562_017311
841 Ga0500562_022454
842 Ga0500569_005451
843 Ga0500569_005702
844 Ga0500572_072059
845 Ga0500592_004246
846 Ga0500595_021775
847 Ga0500608_027334
848 Ga0500614_000626
849 Ga0500618_023023
850 Ga0500642_0005633
851 Ga0500642_0095919
852 Ga0500652_017706
853 Ga0500655_016769
854 Ga0500559_0000146
855 Ga0500559_0001239
856 Ga0500568_0001368
857 Ga0500577_0000111
858 Ga0500577_0032392
859 Ga0500577_0049884
860 Ga0500586_016151
861 Ga0500603_000046
862 Ga0500616_0000041
863 Ga0500616_0133616
864 Ga0500616_0180316
865 Ga0500622_0022350
866 Ga0500622_0037800
867 Ga0500622_0157345
868 Ga0500627_0047453
869 Ga0500627_0064267
870 Ga0500630_001607
871 Ga0500633_0007526
872 Ga0500634_0143014
873 Ga0500638_028594
874 Ga0500638_040714
875 Ga0500639_000085
876 Ga0500636_0000625
877 Ga0500637_0124166
878 Ga0500596_000872
879 Ga0500599_001455
880 2508544485
881 2603860721
882 2617378782
883 2671121996
884 2793068983
885 2824681188
886 2824739071
887 2824750436
888 2841960562
889 2857524840
890 2874611649
891 2874613003
892 2885376609
893 2885417589
894 2888388724
895 2893069354
896 2908741348
897 2919078727
898 2922387047
899 2922399412
900 3005475425
901 3005594763
902 3005712965

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09349

OHCU_decarbox

OHCU decarboxylase

12

168

0.98

PF00576

Transthyretin

HIUase/Transthyretin family

183

295

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o74-assembly3.cif.gz_F structure of ohcu decarboxylase in complex with guanine 0.95 6 168
4q14-assembly1.cif.gz_B crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis 0.9238 179 295
2gpz-assembly1.cif.gz_A transthyretin-like protein from salmonella dublin 0.918 180 295
2o74-assembly3.cif.gz_F structure of ohcu decarboxylase in complex with guanine 0.9175 6 168
4q14-assembly1.cif.gz_B crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis 0.9089 179 295
ID Description Score Start End Superfamily
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.9509 6 168 1.10.3330.10
4q14B00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9239 179 295 2.60.40.180
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.9183 6 168 1.10.3330.10
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.918 180 295 2.60.40.180
4q14B00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9091 179 295 2.60.40.180
ID Description Score Start End GO Terms
AF-T1AAF6-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9788 3 171 GO:0000255
GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A7V9SJ48-F1-model_v4 Xanthine dehydrogenase molybdopterin binding subunit (EC 1.17.1.4) 0.9776 6 169 GO:0000255
GO:0004854
GO:0005506
GO:0006144
GO:0019628
GO:0030151
AF-A0A4Y8U257-F1-model_v4 deleted 0.9772 3 170
AF-A0A172YFF4-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9762 2 170 GO:0000255
GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A4Q3HLA8-F1-model_v4 deleted 0.9758 107 292

Map