F446883
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 451 | 302 | 902 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300053153|Ga0500616_0007633|Ga0500616_0007633_2669_3559 |
| Length | 296 |
| Sequence | MPPAKTSLDELNIAPRADFVRVLGEIFEHSPWVAEQASAGRQFDTVQALHDAMMRAVSTAPLGKKHEFLRGHPDLAGSAARAGTMAAASVSEQSGLGLSNLSDAEYDDFQWLNAAYREKFGFPFIICVRRQTRDAVLAAFRRRLRNNQDTELAAAIEEIGYITRLRLADSVEGPGMPNISGHLSTHVLDAYHGEPAAGVSLDLFELGGEARARIASAVTNDHGRTDQPLLHDAPLRAGRYEIVFYLGDYFRRRGVDLPDHPFVDDVVLRFGIDRPEGRYHVPVVATPWSYSTYRGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 49 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 85 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 86 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 87 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 88 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 138 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 139 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 141 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 142 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 143 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 146 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 149 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 150 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 160 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 161 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 162 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 163 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 164 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 226 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 227 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 228 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 238 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 239 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 244 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 245 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 246 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 247 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 248 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 249 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 250 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 251 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 252 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 254 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 255 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 256 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 257 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 258 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 259 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 260 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 261 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 262 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 263 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 264 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 265 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 266 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 268 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 269 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 270 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 271 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 272 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 273 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 274 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 275 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 276 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 278 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 279 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 280 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 281 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 282 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 283 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 284 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 285 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 286 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 287 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 288 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 289 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 290 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 291 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 292 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 293 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 294 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 295 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 296 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 297 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 298 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 299 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 300 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 301 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 302 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.9 |
| Metatranscriptomes | 0 |
| Isolates | 5.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.85 |
| Nodule | 3.1 |
| Rhizoplane | 2.44 |
| Rhizosphere | 62.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500616_0007633 | 3300053153 | Bacteria | 6833 |
| 2 | JGI24740J21852_10001002 | 3300001979 | Bacteria | 12642 |
| 3 | JGI25153J46596_10069287 | 3300003215 | Bacteria | 921 |
| 4 | rootH2_10047976 | 3300003320 | Bacteria | 1381 |
| 5 | rootH1_10203834 | 3300003323 | Bacteria | 1513 |
| 6 | Ga0065165_1015464 | 3300005262 | Bacteria | 2907 |
| 7 | Ga0070690_100094681 | 3300005330 | Bacteria | 1971 |
| 8 | Ga0068869_100115215 | 3300005334 | Bacteria | 2049 |
| 9 | Ga0068869_100157557 | 3300005334 | Bacteria | 1766 |
| 10 | Ga0070689_100132678 | 3300005340 | Bacteria | 1998 |
| 11 | Ga0070661_100208515 | 3300005344 | Bacteria | 1495 |
| 12 | Ga0070668_100001663 | 3300005347 | Bacteria | 16126 |
| 13 | Ga0070675_100143729 | 3300005354 | Bacteria | 2041 |
| 14 | Ga0070671_100013459 | 3300005355 | Bacteria | 6595 |
| 15 | Ga0070674_100006879 | 3300005356 | Bacteria | 6665 |
| 16 | Ga0070674_100293318 | 3300005356 | Bacteria | 1294 |
| 17 | Ga0070673_100308246 | 3300005364 | Bacteria | 1396 |
| 18 | Ga0070659_100257260 | 3300005366 | Bacteria | 1448 |
| 19 | Ga0070709_10000216 | 3300005434 | Bacteria | 37230 |
| 20 | Ga0070709_10310541 | 3300005434 | Bacteria | 1154 |
| 21 | Ga0070713_100025222 | 3300005436 | Bacteria | 4645 |
| 22 | Ga0070713_100031259 | 3300005436 | Bacteria | 4240 |
| 23 | Ga0070713_100483445 | 3300005436 | Bacteria | 1167 |
| 24 | Ga0070710_10000168 | 3300005437 | Bacteria | 30165 |
| 25 | Ga0070710_10219682 | 3300005437 | Bacteria | 1209 |
| 26 | Ga0070711_100001315 | 3300005439 | Bacteria | 13526 |
| 27 | Ga0070711_100023924 | 3300005439 | Bacteria | 3980 |
| 28 | Ga0070711_100063271 | 3300005439 | Bacteria | 2582 |
| 29 | Ga0070708_100345484 | 3300005445 | Bacteria | 1402 |
| 30 | Ga0070663_100012208 | 3300005455 | Bacteria | 5424 |
| 31 | Ga0070663_100018982 | 3300005455 | Bacteria | 4521 |
| 32 | Ga0070663_100081715 | 3300005455 | Bacteria | 2376 |
| 33 | Ga0070663_100089112 | 3300005455 | Bacteria | 2282 |
| 34 | Ga0070662_100154899 | 3300005457 | Bacteria | 1788 |
| 35 | Ga0070685_10066400 | 3300005466 | Bacteria | 2125 |
| 36 | Ga0070685_10104535 | 3300005466 | Bacteria | 1734 |
| 37 | Ga0070698_100194446 | 3300005471 | Bacteria | 1966 |
| 38 | Ga0068853_100005002 | 3300005539 | Bacteria | 10333 |
| 39 | Ga0068853_100026893 | 3300005539 | Bacteria | 4834 |
| 40 | Ga0070672_100024998 | 3300005543 | Bacteria | 4423 |
| 41 | Ga0070672_100137892 | 3300005543 | Bacteria | 2010 |
| 42 | Ga0070693_100040785 | 3300005547 | Bacteria | 2608 |
| 43 | Ga0070665_100034295 | 3300005548 | Bacteria | 5104 |
| 44 | Ga0070665_100105121 | 3300005548 | Bacteria | 2825 |
| 45 | Ga0070665_100352732 | 3300005548 | Bacteria | 1477 |
| 46 | Ga0068855_100095224 | 3300005563 | Bacteria | 3432 |
| 47 | Ga0070664_100049815 | 3300005564 | Bacteria | 3543 |
| 48 | Ga0068857_100000640 | 3300005577 | Bacteria | 25797 |
| 49 | Ga0068857_100045976 | 3300005577 | Bacteria | 3873 |
| 50 | Ga0068857_100369863 | 3300005577 | Bacteria | 1330 |
| 51 | Ga0068854_100000965 | 3300005578 | Bacteria | 17315 |
| 52 | Ga0068856_100058075 | 3300005614 | Bacteria | 3821 |
| 53 | Ga0068852_100010380 | 3300005616 | Bacteria | 6958 |
| 54 | Ga0068852_100272209 | 3300005616 | Bacteria | 1630 |
| 55 | Ga0068859_100165021 | 3300005617 | Bacteria | 2294 |
| 56 | Ga0068859_100432794 | 3300005617 | Bacteria | 1412 |
| 57 | Ga0068864_100010766 | 3300005618 | Bacteria | 7558 |
| 58 | Ga0068861_100004354 | 3300005719 | Bacteria | 9498 |
| 59 | Ga0068861_100084643 | 3300005719 | Bacteria | 2490 |
| 60 | Ga0068861_100150104 | 3300005719 | Bacteria | 1911 |
| 61 | Ga0068851_10000530 | 3300005834 | Bacteria | 16634 |
| 62 | Ga0068858_100005194 | 3300005842 | Bacteria | 12756 |
| 63 | Ga0068860_100108995 | 3300005843 | Bacteria | 2646 |
| 64 | Ga0068862_100077878 | 3300005844 | Bacteria | 2872 |
| 65 | Ga0068862_100097839 | 3300005844 | Bacteria | 2562 |
| 66 | Ga0081455_10005751 | 3300005937 | Bacteria | 13521 |
| 67 | Ga0081455_10020927 | 3300005937 | Bacteria | 6147 |
| 68 | Ga0081455_10089098 | 3300005937 | Bacteria | 2505 |
| 69 | Ga0081540_1004946 | 3300005983 | Bacteria | 10018 |
| 70 | Ga0081540_1006096 | 3300005983 | Bacteria | 8859 |
| 71 | Ga0081540_1007967 | 3300005983 | Bacteria | 7465 |
| 72 | Ga0081540_1079920 | 3300005983 | Bacteria | 1476 |
| 73 | Ga0081539_10015264 | 3300005985 | Bacteria | 5594 |
| 74 | Ga0070717_10008396 | 3300006028 | Bacteria | 7713 |
| 75 | Ga0070717_10046464 | 3300006028 | Bacteria | 3552 |
| 76 | Ga0075365_10025018 | 3300006038 | Bacteria | 3775 |
| 77 | Ga0075365_10227740 | 3300006038 | Bacteria | 1308 |
| 78 | Ga0075368_10005784 | 3300006042 | Bacteria | 4276 |
| 79 | Ga0075363_100042972 | 3300006048 | Bacteria | 2389 |
| 80 | Ga0075363_100217269 | 3300006048 | Bacteria | 1095 |
| 81 | Ga0075364_10023486 | 3300006051 | Bacteria | 3903 |
| 82 | Ga0075364_10054743 | 3300006051 | Bacteria | 2609 |
| 83 | Ga0075364_10061645 | 3300006051 | Bacteria | 2460 |
| 84 | Ga0070715_10069182 | 3300006163 | Bacteria | 1572 |
| 85 | Ga0070716_100001374 | 3300006173 | Bacteria | 10810 |
| 86 | Ga0070712_100011774 | 3300006175 | Bacteria | 5559 |
| 87 | Ga0070712_100029755 | 3300006175 | Bacteria | 3663 |
| 88 | Ga0070712_100409912 | 3300006175 | Bacteria | 1121 |
| 89 | Ga0075367_10021059 | 3300006178 | Bacteria | 3639 |
| 90 | Ga0075367_10073460 | 3300006178 | Bacteria | 2060 |
| 91 | Ga0075369_10002787 | 3300006186 | Bacteria | 6279 |
| 92 | Ga0075366_10201787 | 3300006195 | Bacteria | 1210 |
| 93 | Ga0097621_100091200 | 3300006237 | Bacteria | 2551 |
| 94 | Ga0075370_10021530 | 3300006353 | Bacteria | 3532 |
| 95 | Ga0068871_100091476 | 3300006358 | Bacteria | 2536 |
| 96 | Ga0075428_100094516 | 3300006844 | Bacteria | 3259 |
| 97 | Ga0068865_100049488 | 3300006881 | Bacteria | 2897 |
| 98 | Ga0068865_100094197 | 3300006881 | Bacteria | 2179 |
| 99 | Ga0097620_100165027 | 3300006931 | Bacteria | 2294 |
| 100 | Ga0097620_100432722 | 3300006931 | Bacteria | 1412 |
| 101 | Ga0105250_10021087 | 3300009092 | Bacteria | 2630 |
| 102 | Ga0105240_10005299 | 3300009093 | Bacteria | 19243 |
| 103 | Ga0105245_10003785 | 3300009098 | Bacteria | 13456 |
| 104 | Ga0105247_10021348 | 3300009101 | Bacteria | 3896 |
| 105 | Ga0114129_10166071 | 3300009147 | Bacteria | 3012 |
| 106 | Ga0105243_10010813 | 3300009148 | Bacteria | 6906 |
| 107 | Ga0105241_10001238 | 3300009174 | Bacteria | 19477 |
| 108 | Ga0105241_10031306 | 3300009174 | Bacteria | 3983 |
| 109 | Ga0105248_10059623 | 3300009177 | Bacteria | 4287 |
| 110 | Ga0105237_10043184 | 3300009545 | Bacteria | 4543 |
| 111 | Ga0105238_10001034 | 3300009551 | Bacteria | 28265 |
| 112 | Ga0105238_10069870 | 3300009551 | Bacteria | 3512 |
| 113 | Ga0105249_10003943 | 3300009553 | Bacteria | 12810 |
| 114 | Ga0105249_10047918 | 3300009553 | Bacteria | 3896 |
| 115 | Ga0105239_10012073 | 3300010375 | Bacteria | 9631 |
| 116 | Ga0105239_10063359 | 3300010375 | Bacteria | 4059 |
| 117 | Ga0105239_10470173 | 3300010375 | Bacteria | 1428 |
| 118 | Ga0105246_10006437 | 3300011119 | Bacteria | 7177 |
| 119 | Ga0157378_10009302 | 3300013297 | Bacteria | 8559 |
| 120 | Ga0157378_10389196 | 3300013297 | Bacteria | 1371 |
| 121 | Ga0163162_10024905 | 3300013306 | Bacteria | 5912 |
| 122 | Ga0163162_10138030 | 3300013306 | Bacteria | 2549 |
| 123 | Ga0163162_10499808 | 3300013306 | Bacteria | 1346 |
| 124 | Ga0163162_10620308 | 3300013306 | Bacteria | 1207 |
| 125 | Ga0157375_10177329 | 3300013308 | Bacteria | 2281 |
| 126 | Ga0163163_10014512 | 3300014325 | Bacteria | 7245 |
| 127 | Ga0157380_10008291 | 3300014326 | Bacteria | 7404 |
| 128 | Ga0157379_10186724 | 3300014968 | Bacteria | 1873 |
| 129 | Ga0157379_10379599 | 3300014968 | Bacteria | 1297 |
| 130 | Ga0157376_10099258 | 3300014969 | Bacteria | 2540 |
| 131 | Ga0163161_10013156 | 3300017792 | Bacteria | 5752 |
| 132 | Ga0163161_10345019 | 3300017792 | Bacteria | 1182 |
| 133 | Ga0214544_1000013 | 3300021320 | Bacteria | 228947 |
| 134 | Ga0214542_1000013 | 3300021321 | Bacteria | 234019 |
| 135 | Ga0214545_1001323 | 3300021324 | Bacteria | 45766 |
| 136 | Ga0214543_1010219 | 3300021327 | Bacteria | 14055 |
| 137 | Ga0209563_101717 | 3300025230 | Bacteria | 5532 |
| 138 | Ga0209564_1001014 | 3300025295 | Bacteria | 34834 |
| 139 | Ga0209564_1020819 | 3300025295 | Bacteria | 2388 |
| 140 | Ga0209758_1005026 | 3300025297 | Bacteria | 10533 |
| 141 | Ga0209758_1015305 | 3300025297 | Bacteria | 3986 |
| 142 | Ga0209758_1046802 | 3300025297 | Bacteria | 1555 |
| 143 | Ga0207426_1006396 | 3300025302 | Bacteria | 5133 |
| 144 | Ga0207426_1018097 | 3300025302 | Bacteria | 2489 |
| 145 | Ga0207656_10072156 | 3300025321 | Bacteria | 1536 |
| 146 | Ga0207696_1055405 | 3300025711 | Bacteria | 1125 |
| 147 | Ga0207692_10001092 | 3300025898 | Bacteria | 9943 |
| 148 | Ga0207692_10029017 | 3300025898 | Bacteria | 2624 |
| 149 | Ga0207710_10029975 | 3300025900 | Bacteria | 2371 |
| 150 | Ga0207699_10000420 | 3300025906 | Bacteria | 21716 |
| 151 | Ga0207699_10037387 | 3300025906 | Bacteria | 2775 |
| 152 | Ga0207699_10047790 | 3300025906 | Bacteria | 2510 |
| 153 | Ga0207643_10128528 | 3300025908 | Bacteria | 1506 |
| 154 | Ga0207654_10000635 | 3300025911 | Bacteria | 19837 |
| 155 | Ga0207695_10002964 | 3300025913 | Bacteria | 24489 |
| 156 | Ga0207671_10004970 | 3300025914 | Bacteria | 12459 |
| 157 | Ga0207671_10203173 | 3300025914 | Bacteria | 1548 |
| 158 | Ga0207693_10009177 | 3300025915 | Bacteria | 8077 |
| 159 | Ga0207693_10019200 | 3300025915 | Bacteria | 5440 |
| 160 | Ga0207693_10035032 | 3300025915 | Bacteria | 3959 |
| 161 | Ga0207663_10010424 | 3300025916 | Bacteria | 4949 |
| 162 | Ga0207663_10117729 | 3300025916 | Bacteria | 1813 |
| 163 | Ga0207681_10163427 | 3300025923 | Bacteria | 1681 |
| 164 | Ga0207694_10000621 | 3300025924 | Bacteria | 32250 |
| 165 | Ga0207694_10143834 | 3300025924 | Bacteria | 1919 |
| 166 | Ga0207650_10094114 | 3300025925 | Bacteria | 2295 |
| 167 | Ga0207659_10034958 | 3300025926 | Bacteria | 3470 |
| 168 | Ga0207687_10001252 | 3300025927 | Bacteria | 17372 |
| 169 | Ga0207700_10040315 | 3300025928 | Bacteria | 3408 |
| 170 | Ga0207664_10018648 | 3300025929 | Bacteria | 5113 |
| 171 | Ga0207664_10021437 | 3300025929 | Bacteria | 4805 |
| 172 | Ga0207644_10270505 | 3300025931 | Bacteria | 1361 |
| 173 | Ga0207690_10131792 | 3300025932 | Bacteria | 1830 |
| 174 | Ga0207686_10025162 | 3300025934 | Bacteria | 3458 |
| 175 | Ga0207709_10037221 | 3300025935 | Bacteria | 2890 |
| 176 | Ga0207704_10023699 | 3300025938 | Bacteria | 3313 |
| 177 | Ga0207704_10308586 | 3300025938 | Bacteria | 1215 |
| 178 | Ga0207691_10024554 | 3300025940 | Bacteria | 5669 |
| 179 | Ga0207691_10092968 | 3300025940 | Bacteria | 2701 |
| 180 | Ga0207691_10282487 | 3300025940 | Bacteria | 1428 |
| 181 | Ga0207691_10310304 | 3300025940 | Bacteria | 1354 |
| 182 | Ga0207711_10064100 | 3300025941 | Bacteria | 3173 |
| 183 | Ga0207711_10227832 | 3300025941 | Bacteria | 1706 |
| 184 | Ga0207689_10004834 | 3300025942 | Bacteria | 12148 |
| 185 | Ga0207689_10011354 | 3300025942 | Bacteria | 7637 |
| 186 | Ga0207689_10050348 | 3300025942 | Bacteria | 3435 |
| 187 | Ga0207679_10456076 | 3300025945 | Bacteria | 1134 |
| 188 | Ga0207667_10010398 | 3300025949 | Bacteria | 10879 |
| 189 | Ga0207667_10562009 | 3300025949 | Bacteria | 1153 |
| 190 | Ga0207712_10147711 | 3300025961 | Bacteria | 1812 |
| 191 | Ga0207668_10003177 | 3300025972 | Bacteria | 9622 |
| 192 | Ga0207668_10076786 | 3300025972 | Bacteria | 2406 |
| 193 | Ga0207640_10007975 | 3300025981 | Bacteria | 5849 |
| 194 | Ga0207677_10004452 | 3300026023 | Bacteria | 7522 |
| 195 | Ga0207703_10007538 | 3300026035 | Bacteria | 8631 |
| 196 | Ga0207703_10100366 | 3300026035 | Bacteria | 2452 |
| 197 | Ga0207639_10547612 | 3300026041 | Bacteria | 1062 |
| 198 | Ga0207678_10007571 | 3300026067 | Bacteria | 9599 |
| 199 | Ga0207678_10011047 | 3300026067 | Bacteria | 7933 |
| 200 | Ga0207678_10020485 | 3300026067 | Bacteria | 5798 |
| 201 | Ga0207678_10024569 | 3300026067 | Bacteria | 5263 |
| 202 | Ga0207678_10492269 | 3300026067 | Bacteria | 1068 |
| 203 | Ga0207708_10076705 | 3300026075 | Bacteria | 2564 |
| 204 | Ga0207708_10123430 | 3300026075 | Bacteria | 2020 |
| 205 | Ga0207702_10000094 | 3300026078 | Bacteria | 103202 |
| 206 | Ga0207702_10000095 | 3300026078 | Bacteria | 102704 |
| 207 | Ga0207676_10006740 | 3300026095 | Bacteria | 8129 |
| 208 | Ga0207674_10001319 | 3300026116 | Bacteria | 32297 |
| 209 | Ga0207674_10040382 | 3300026116 | Bacteria | 4833 |
| 210 | Ga0207674_10187990 | 3300026116 | Bacteria | 2015 |
| 211 | Ga0207675_100001130 | 3300026118 | Bacteria | 26475 |
| 212 | Ga0207675_100105175 | 3300026118 | Bacteria | 2660 |
| 213 | Ga0207675_100112465 | 3300026118 | Bacteria | 2570 |
| 214 | Ga0207675_100201392 | 3300026118 | Bacteria | 1912 |
| 215 | Ga0207683_10024842 | 3300026121 | Bacteria | 5163 |
| 216 | Ga0207683_10158469 | 3300026121 | Bacteria | 2045 |
| 217 | Ga0207683_10327962 | 3300026121 | Bacteria | 1403 |
| 218 | Ga0207698_10041821 | 3300026142 | Bacteria | 3419 |
| 219 | Ga0207698_10290034 | 3300026142 | Bacteria | 1518 |
| 220 | Ga0268266_10025575 | 3300028379 | Bacteria | 5021 |
| 221 | Ga0268266_10028941 | 3300028379 | Bacteria | 4707 |
| 222 | Ga0268265_10204784 | 3300028380 | Bacteria | 1714 |
| 223 | Ga0268264_10016688 | 3300028381 | Bacteria | 6012 |
| 224 | Ga0268264_10230175 | 3300028381 | Bacteria | 1711 |
| 225 | Ga0307517_10000392 | 3300028786 | Bacteria | 74887 |
| 226 | Ga0307517_10147473 | 3300028786 | Bacteria | 1627 |
| 227 | Ga0307515_10042832 | 3300028794 | Bacteria | 7063 |
| 228 | Ga0307515_10072467 | 3300028794 | Bacteria | 4648 |
| 229 | Ga0265339_10012071 | 3300031249 | Bacteria | 5294 |
| 230 | Ga0307513_10067820 | 3300031456 | Bacteria | 3740 |
| 231 | Ga0307509_10124228 | 3300031507 | Bacteria | 2551 |
| 232 | Ga0307508_10119193 | 3300031616 | Bacteria | 2241 |
| 233 | Ga0307508_10120236 | 3300031616 | Bacteria | 2229 |
| 234 | Ga0307508_10296428 | 3300031616 | Bacteria | 1210 |
| 235 | Ga0265314_10008999 | 3300031711 | Bacteria | 8493 |
| 236 | Ga0265342_10003733 | 3300031712 | Bacteria | 12318 |
| 237 | Ga0307516_10004020 | 3300031730 | Bacteria | 18431 |
| 238 | Ga0307516_10014362 | 3300031730 | Bacteria | 8382 |
| 239 | Ga0307412_10155789 | 3300031911 | Bacteria | 1691 |
| 240 | Ga0307416_100413277 | 3300032002 | Bacteria | 1391 |
| 241 | Ga0307510_10005065 | 3300033180 | Bacteria | 15634 |
| 242 | Ga0307510_10147426 | 3300033180 | Bacteria | 1981 |
| 243 | Ga0373926_0076522 | 3300035083 | Bacteria | 1234 |
| 244 | Ga0373936_0059906 | 3300035113 | Bacteria | 1552 |
| 245 | Ga0373953_0013850 | 3300035117 | Bacteria | 2889 |
| 246 | Ga0373954_0059618 | 3300035118 | Bacteria | 1799 |
| 247 | Ga0373955_0050388 | 3300035172 | Bacteria | 2264 |
| 248 | Ga0373924_0062648 | 3300035410 | Bacteria | 1558 |
| 249 | Ga0373935_0030482 | 3300035692 | Bacteria | 3343 |
| 250 | Ga0373927_0016760 | 3300035695 | Bacteria | 4833 |
| 251 | Ga0373927_0162525 | 3300035695 | Bacteria | 1463 |
| 252 | Ga0373937_0074808 | 3300036401 | Bacteria | 3126 |
| 253 | Ga0373937_0256598 | 3300036401 | Bacteria | 1648 |
| 254 | Ga0373925_0196376 | 3300037068 | Bacteria | 1603 |
| 255 | Ga0436364_0938298 | 3300037853 | Bacteria | 2034 |
| 256 | Ga0436363_1317613 | 3300039450 | Bacteria | 4775 |
| 257 | Ga0466972_0047293 | 3300044658 | Bacteria | 2081 |
| 258 | Ga0466966_0027320 | 3300044684 | Bacteria | 3722 |
| 259 | Ga0466963_0349077 | 3300044694 | Bacteria | 1042 |
| 260 | Ga0466967_0340987 | 3300045976 | Bacteria | 1449 |
| 261 | Ga0495592_0093766 | 3300046454 | Bacteria | 2150 |
| 262 | Ga0495603_0030560 | 3300046455 | Bacteria | 3243 |
| 263 | Ga0495603_0039693 | 3300046455 | Bacteria | 2819 |
| 264 | Ga0495603_0076706 | 3300046455 | Bacteria | 1961 |
| 265 | Ga0495638_0013878 | 3300046460 | Bacteria | 5464 |
| 266 | Ga0495638_0114078 | 3300046460 | Bacteria | 1602 |
| 267 | Ga0495651_0012738 | 3300046462 | Bacteria | 6492 |
| 268 | Ga0495580_0014285 | 3300046472 | Bacteria | 6025 |
| 269 | Ga0495580_0185261 | 3300046472 | Bacteria | 1437 |
| 270 | Ga0495582_0085830 | 3300046473 | Bacteria | 1751 |
| 271 | Ga0495605_0028213 | 3300046474 | Bacteria | 2899 |
| 272 | Ga0495584_0089334 | 3300046491 | Bacteria | 1553 |
| 273 | Ga0495585_0163904 | 3300046492 | Bacteria | 1152 |
| 274 | Ga0495594_0078080 | 3300046499 | Bacteria | 1847 |
| 275 | Ga0495596_0046391 | 3300046500 | Bacteria | 1707 |
| 276 | Ga0495606_0124006 | 3300046507 | Bacteria | 1542 |
| 277 | Ga0495606_0186708 | 3300046507 | Bacteria | 1191 |
| 278 | Ga0495608_0125025 | 3300046511 | Bacteria | 1648 |
| 279 | Ga0495616_0080564 | 3300046513 | Bacteria | 1559 |
| 280 | Ga0495616_0110248 | 3300046513 | Bacteria | 1279 |
| 281 | Ga0495628_0081540 | 3300046516 | Bacteria | 2513 |
| 282 | Ga0495630_0078882 | 3300046517 | Bacteria | 2483 |
| 283 | Ga0495631_0021630 | 3300046518 | Bacteria | 2995 |
| 284 | Ga0495631_0047638 | 3300046518 | Bacteria | 1881 |
| 285 | Ga0495632_0059427 | 3300046519 | Bacteria | 1860 |
| 286 | Ga0495632_0137140 | 3300046519 | Bacteria | 1136 |
| 287 | Ga0495637_0081124 | 3300046520 | Bacteria | 1293 |
| 288 | Ga0495643_0093264 | 3300046522 | Bacteria | 1551 |
| 289 | Ga0495648_0023312 | 3300046524 | Bacteria | 4243 |
| 290 | Ga0495663_0051834 | 3300046525 | Bacteria | 1272 |
| 291 | Ga0495665_0029485 | 3300046531 | Bacteria | 2939 |
| 292 | Ga0495640_0239684 | 3300046533 | Bacteria | 1139 |
| 293 | Ga0495586_0087920 | 3300046535 | Bacteria | 1714 |
| 294 | Ga0495622_0003392 | 3300046557 | Bacteria | 7518 |
| 295 | Ga0495622_0103972 | 3300046557 | Bacteria | 1301 |
| 296 | Ga0495667_0060553 | 3300046559 | Bacteria | 2483 |
| 297 | Ga0495656_0003122 | 3300046615 | Bacteria | 5572 |
| 298 | Ga0495668_0045526 | 3300046616 | Bacteria | 2439 |
| 299 | Ga0495611_0067038 | 3300046648 | Bacteria | 1638 |
| 300 | Ga0495611_0110318 | 3300046648 | Bacteria | 1280 |
| 301 | Ga0495625_0112388 | 3300046660 | Bacteria | 1861 |
| 302 | Ga0495625_0128066 | 3300046660 | Bacteria | 1722 |
| 303 | Ga0495625_0183600 | 3300046660 | Bacteria | 1389 |
| 304 | Ga0495635_0168394 | 3300046663 | Bacteria | 1490 |
| 305 | Ga0495659_0012785 | 3300046664 | Bacteria | 2725 |
| 306 | Ga0495659_0073157 | 3300046664 | Bacteria | 1288 |
| 307 | Ga0495661_0053118 | 3300046665 | Bacteria | 2438 |
| 308 | Ga0495588_0057788 | 3300046674 | Bacteria | 2004 |
| 309 | Ga0495623_0252746 | 3300046679 | Bacteria | 990 |
| 310 | Ga0495658_0186132 | 3300046683 | Bacteria | 1289 |
| 311 | Ga0495669_0002883 | 3300046684 | Bacteria | 7058 |
| 312 | Ga0495669_0118148 | 3300046684 | Bacteria | 1241 |
| 313 | Ga0495613_0034517 | 3300046689 | Bacteria | 3757 |
| 314 | Ga0495624_0074022 | 3300046690 | Bacteria | 2117 |
| 315 | Ga0495670_0004968 | 3300046691 | Bacteria | 6534 |
| 316 | Ga0495604_0137018 | 3300047317 | Bacteria | 1753 |
| 317 | Ga0495636_0048776 | 3300047318 | Bacteria | 1770 |
| 318 | Ga0495672_0076634 | 3300047320 | Bacteria | 1877 |
| 319 | Ga0495676_0140030 | 3300047321 | Bacteria | 1735 |
| 320 | Ga0495677_0110166 | 3300047445 | Bacteria | 1046 |
| 321 | Ga0495673_0024686 | 3300047469 | Bacteria | 2898 |
| 322 | Ga0495686_0114747 | 3300047472 | Bacteria | 1612 |
| 323 | Ga0495686_0179214 | 3300047472 | Bacteria | 1229 |
| 324 | Ga0495593_0040511 | 3300047673 | Bacteria | 2508 |
| 325 | Ga0495626_0070871 | 3300048091 | Bacteria | 1567 |
| 326 | Ga0496100_0084935 | 3300048903 | Bacteria | 2147 |
| 327 | Ga0496106_0071667 | 3300048909 | Bacteria | 2649 |
| 328 | Ga0496107_0165680 | 3300048910 | Bacteria | 1639 |
| 329 | Ga0496108_0130201 | 3300048911 | Bacteria | 2163 |
| 330 | Ga0496109_0031281 | 3300048912 | Bacteria | 4775 |
| 331 | Ga0496111_0401933 | 3300048914 | Bacteria | 1012 |
| 332 | Ga0496112_0307590 | 3300048915 | Bacteria | 1530 |
| 333 | Ga0496114_0084865 | 3300048917 | Bacteria | 2682 |
| 334 | Ga0496115_0304199 | 3300048918 | Bacteria | 1306 |
| 335 | Ga0496116_0004643 | 3300048919 | Bacteria | 13010 |
| 336 | Ga0496117_0024434 | 3300048920 | Bacteria | 4781 |
| 337 | Ga0496117_0096128 | 3300048920 | Bacteria | 1891 |
| 338 | Ga0496117_0104693 | 3300048920 | Bacteria | 1780 |
| 339 | Ga0496118_0026907 | 3300048921 | Bacteria | 4884 |
| 340 | Ga0496119_0086649 | 3300048922 | Bacteria | 1789 |
| 341 | Ga0496120_0041444 | 3300048923 | Bacteria | 2697 |
| 342 | Ga0496120_0050102 | 3300048923 | Bacteria | 2393 |
| 343 | Ga0496121_0012483 | 3300048924 | Bacteria | 9252 |
| 344 | Ga0496121_0025602 | 3300048924 | Bacteria | 5592 |
| 345 | Ga0496121_0032956 | 3300048924 | Bacteria | 4699 |
| 346 | Ga0496121_0051292 | 3300048924 | Bacteria | 3476 |
| 347 | Ga0496121_0079496 | 3300048924 | Bacteria | 2603 |
| 348 | Ga0496121_0087275 | 3300048924 | Bacteria | 2449 |
| 349 | Ga0496121_0111387 | 3300048924 | Bacteria | 2087 |
| 350 | Ga0496121_0116368 | 3300048924 | Bacteria | 2028 |
| 351 | Ga0496121_0152909 | 3300048924 | Bacteria | 1696 |
| 352 | Ga0496121_0192490 | 3300048924 | Bacteria | 1461 |
| 353 | Ga0496122_0176124 | 3300048925 | Bacteria | 1282 |
| 354 | Ga0496123_0058382 | 3300048926 | Bacteria | 2503 |
| 355 | Ga0496123_0077901 | 3300048926 | Bacteria | 2034 |
| 356 | Ga0496124_0030178 | 3300048927 | Bacteria | 4816 |
| 357 | Ga0496125_0001755 | 3300048928 | Bacteria | 30072 |
| 358 | Ga0496125_0006438 | 3300048928 | Bacteria | 12694 |
| 359 | Ga0496126_0023992 | 3300048929 | Bacteria | 5897 |
| 360 | Ga0496126_0025042 | 3300048929 | Bacteria | 5750 |
| 361 | Ga0496126_0068744 | 3300048929 | Bacteria | 3161 |
| 362 | Ga0496126_0224424 | 3300048929 | Bacteria | 1576 |
| 363 | Ga0496126_0264443 | 3300048929 | Bacteria | 1429 |
| 364 | Ga0496126_0458758 | 3300048929 | Bacteria | 1024 |
| 365 | Ga0495678_015491 | 3300049459 | Bacteria | 3505 |
| 366 | Ga0501069_0222980 | 3300049585 | Bacteria | 1096 |
| 367 | nmdc:mga03n38_8146_c1 | 3300050490 | Bacteria | 3745 |
| 368 | nmdc:mga00v17_118560_c1 | 3300050491 | Bacteria | 1684 |
| 369 | nmdc:mga00v17_59521_c1 | 3300050491 | Bacteria | 2344 |
| 370 | nmdc:mga0yw44_254294_c1 | 3300050492 | Bacteria | 1170 |
| 371 | nmdc:mga06z11_6382_c1 | 3300050494 | Bacteria | 4792 |
| 372 | nmdc:mga06z11_85969_c1 | 3300050494 | Bacteria | 1698 |
| 373 | nmdc:mga07m45_161121_c1 | 3300050496 | Bacteria | 1302 |
| 374 | nmdc:mga07m45_45167_c1 | 3300050496 | Bacteria | 1224 |
| 375 | nmdc:mga05p37_108990_c1 | 3300050507 | Bacteria | 3406 |
| 376 | Ga0500635_0006821 | 3300053080 | Bacteria | 3066 |
| 377 | Ga0500578_0214408 | 3300053086 | Bacteria | 1173 |
| 378 | Ga0500581_159365 | 3300053089 | Bacteria | 1050 |
| 379 | Ga0500651_0204616 | 3300053093 | Bacteria | 1163 |
| 380 | Ga0500566_0000446 | 3300053094 | Bacteria | 23002 |
| 381 | Ga0500566_0000506 | 3300053094 | Bacteria | 21763 |
| 382 | Ga0500566_0015456 | 3300053094 | Bacteria | 4481 |
| 383 | Ga0500640_009085 | 3300053095 | Bacteria | 3957 |
| 384 | Ga0500641_0003794 | 3300053096 | Bacteria | 5344 |
| 385 | Ga0500641_0055922 | 3300053096 | Bacteria | 1634 |
| 386 | Ga0500554_019508 | 3300053102 | Bacteria | 1849 |
| 387 | Ga0500555_039738 | 3300053103 | Bacteria | 1313 |
| 388 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 389 | Ga0500562_017311 | 3300053108 | Bacteria | 1857 |
| 390 | Ga0500562_022454 | 3300053108 | Bacteria | 1645 |
| 391 | Ga0500569_005451 | 3300053109 | Bacteria | 2733 |
| 392 | Ga0500569_005702 | 3300053109 | Bacteria | 2689 |
| 393 | Ga0500572_072059 | 3300053111 | Bacteria | 1069 |
| 394 | Ga0500592_004246 | 3300053116 | Bacteria | 2288 |
| 395 | Ga0500595_021775 | 3300053119 | Bacteria | 2282 |
| 396 | Ga0500608_027334 | 3300053122 | Bacteria | 2688 |
| 397 | Ga0500614_000626 | 3300053123 | Bacteria | 9008 |
| 398 | Ga0500618_023023 | 3300053125 | Bacteria | 1511 |
| 399 | Ga0500642_0005633 | 3300053130 | Bacteria | 4059 |
| 400 | Ga0500642_0095919 | 3300053130 | Bacteria | 1375 |
| 401 | Ga0500652_017706 | 3300053131 | Bacteria | 2616 |
| 402 | Ga0500655_016769 | 3300053133 | Bacteria | 1350 |
| 403 | Ga0500559_0000146 | 3300053136 | Bacteria | 55375 |
| 404 | Ga0500559_0001239 | 3300053136 | Bacteria | 15040 |
| 405 | Ga0500568_0001368 | 3300053139 | Bacteria | 15849 |
| 406 | Ga0500577_0000111 | 3300053142 | Bacteria | 20046 |
| 407 | Ga0500577_0032392 | 3300053142 | Bacteria | 1838 |
| 408 | Ga0500577_0049884 | 3300053142 | Bacteria | 1567 |
| 409 | Ga0500586_016151 | 3300053145 | Bacteria | 2259 |
| 410 | Ga0500603_000046 | 3300053150 | Bacteria | 30040 |
| 411 | Ga0500616_0000041 | 3300053153 | Bacteria | 359328 |
| 412 | Ga0500616_0133616 | 3300053153 | Bacteria | 1169 |
| 413 | Ga0500616_0180316 | 3300053153 | Bacteria | 951 |
| 414 | Ga0500622_0022350 | 3300053156 | Bacteria | 3353 |
| 415 | Ga0500622_0037800 | 3300053156 | Bacteria | 2521 |
| 416 | Ga0500622_0157345 | 3300053156 | Bacteria | 1068 |
| 417 | Ga0500627_0047453 | 3300053158 | Bacteria | 1863 |
| 418 | Ga0500627_0064267 | 3300053158 | Bacteria | 1618 |
| 419 | Ga0500630_001607 | 3300053159 | Bacteria | 10819 |
| 420 | Ga0500633_0007526 | 3300053160 | Bacteria | 2749 |
| 421 | Ga0500634_0143014 | 3300053161 | Bacteria | 1130 |
| 422 | Ga0500638_028594 | 3300053162 | Bacteria | 2680 |
| 423 | Ga0500638_040714 | 3300053162 | Bacteria | 2256 |
| 424 | Ga0500639_000085 | 3300053163 | Bacteria | 44045 |
| 425 | Ga0500636_0000625 | 3300053177 | Bacteria | 19115 |
| 426 | Ga0500637_0124166 | 3300053178 | Bacteria | 1497 |
| 427 | Ga0500596_000872 | 3300053735 | Bacteria | 6003 |
| 428 | Ga0500599_001455 | 3300053736 | Bacteria | 2725 |
| 429 | 2508544485 | 2508501009 | Bacteria | 7784016 |
| 430 | 2603860721 | 2602042107 | Bacteria | 6226103 |
| 431 | 2617378782 | 2617270741 | Bacteria | 8201522 |
| 432 | 2671121996 | 2667528175 | Bacteria | 7532676 |
| 433 | 2793068983 | 2791355197 | Bacteria | 8420563 |
| 434 | 2824681188 | 2824679649 | Bacteria | 8248951 |
| 435 | 2824739071 | 2824732956 | Bacteria | 7810675 |
| 436 | 2824750436 | 2824746037 | Bacteria | 7911610 |
| 437 | 2841960562 | 2841957949 | Bacteria | 8652217 |
| 438 | 2857524840 | 2857524615 | Bacteria | 6615449 |
| 439 | 2874611649 | 2874604998 | Bacteria | 7834745 |
| 440 | 2874613003 | 2874612657 | Bacteria | 8252029 |
| 441 | 2885376609 | 2885374607 | Bacteria | 8927485 |
| 442 | 2885417589 | 2885409591 | Bacteria | 9235467 |
| 443 | 2888388724 | 2888388044 | Bacteria | 7304136 |
| 444 | 2893069354 | 2893066018 | Bacteria | 6158120 |
| 445 | 2908741348 | 2908739725 | Bacteria | 8628932 |
| 446 | 2919078727 | 2919073203 | Bacteria | 6531949 |
| 447 | 2922387047 | 2922386360 | Bacteria | 7017218 |
| 448 | 2922399412 | 2922393267 | Bacteria | 8285685 |
| 449 | 3005475425 | 3005474847 | Bacteria | 9259049 |
| 450 | 3005594763 | 3005587118 | Bacteria | 7794411 |
| 451 | 3005712965 | 3005710791 | Bacteria | 7622528 |
| 452 | Ga0500616_0007633 | |||
| 453 | JGI24740J21852_10001002 | |||
| 454 | JGI25153J46596_10069287 | |||
| 455 | rootH2_10047976 | |||
| 456 | rootH1_10203834 | |||
| 457 | Ga0065165_1015464 | |||
| 458 | Ga0070690_100094681 | |||
| 459 | Ga0068869_100115215 | |||
| 460 | Ga0068869_100157557 | |||
| 461 | Ga0070689_100132678 | |||
| 462 | Ga0070661_100208515 | |||
| 463 | Ga0070668_100001663 | |||
| 464 | Ga0070675_100143729 | |||
| 465 | Ga0070671_100013459 | |||
| 466 | Ga0070674_100006879 | |||
| 467 | Ga0070674_100293318 | |||
| 468 | Ga0070673_100308246 | |||
| 469 | Ga0070659_100257260 | |||
| 470 | Ga0070709_10000216 | |||
| 471 | Ga0070709_10310541 | |||
| 472 | Ga0070713_100025222 | |||
| 473 | Ga0070713_100031259 | |||
| 474 | Ga0070713_100483445 | |||
| 475 | Ga0070710_10000168 | |||
| 476 | Ga0070710_10219682 | |||
| 477 | Ga0070711_100001315 | |||
| 478 | Ga0070711_100023924 | |||
| 479 | Ga0070711_100063271 | |||
| 480 | Ga0070708_100345484 | |||
| 481 | Ga0070663_100012208 | |||
| 482 | Ga0070663_100018982 | |||
| 483 | Ga0070663_100081715 | |||
| 484 | Ga0070663_100089112 | |||
| 485 | Ga0070662_100154899 | |||
| 486 | Ga0070685_10066400 | |||
| 487 | Ga0070685_10104535 | |||
| 488 | Ga0070698_100194446 | |||
| 489 | Ga0068853_100005002 | |||
| 490 | Ga0068853_100026893 | |||
| 491 | Ga0070672_100024998 | |||
| 492 | Ga0070672_100137892 | |||
| 493 | Ga0070693_100040785 | |||
| 494 | Ga0070665_100034295 | |||
| 495 | Ga0070665_100105121 | |||
| 496 | Ga0070665_100352732 | |||
| 497 | Ga0068855_100095224 | |||
| 498 | Ga0070664_100049815 | |||
| 499 | Ga0068857_100000640 | |||
| 500 | Ga0068857_100045976 | |||
| 501 | Ga0068857_100369863 | |||
| 502 | Ga0068854_100000965 | |||
| 503 | Ga0068856_100058075 | |||
| 504 | Ga0068852_100010380 | |||
| 505 | Ga0068852_100272209 | |||
| 506 | Ga0068859_100165021 | |||
| 507 | Ga0068859_100432794 | |||
| 508 | Ga0068864_100010766 | |||
| 509 | Ga0068861_100004354 | |||
| 510 | Ga0068861_100084643 | |||
| 511 | Ga0068861_100150104 | |||
| 512 | Ga0068851_10000530 | |||
| 513 | Ga0068858_100005194 | |||
| 514 | Ga0068860_100108995 | |||
| 515 | Ga0068862_100077878 | |||
| 516 | Ga0068862_100097839 | |||
| 517 | Ga0081455_10005751 | |||
| 518 | Ga0081455_10020927 | |||
| 519 | Ga0081455_10089098 | |||
| 520 | Ga0081540_1004946 | |||
| 521 | Ga0081540_1006096 | |||
| 522 | Ga0081540_1007967 | |||
| 523 | Ga0081540_1079920 | |||
| 524 | Ga0081539_10015264 | |||
| 525 | Ga0070717_10008396 | |||
| 526 | Ga0070717_10046464 | |||
| 527 | Ga0075365_10025018 | |||
| 528 | Ga0075365_10227740 | |||
| 529 | Ga0075368_10005784 | |||
| 530 | Ga0075363_100042972 | |||
| 531 | Ga0075363_100217269 | |||
| 532 | Ga0075364_10023486 | |||
| 533 | Ga0075364_10054743 | |||
| 534 | Ga0075364_10061645 | |||
| 535 | Ga0070715_10069182 | |||
| 536 | Ga0070716_100001374 | |||
| 537 | Ga0070712_100011774 | |||
| 538 | Ga0070712_100029755 | |||
| 539 | Ga0070712_100409912 | |||
| 540 | Ga0075367_10021059 | |||
| 541 | Ga0075367_10073460 | |||
| 542 | Ga0075369_10002787 | |||
| 543 | Ga0075366_10201787 | |||
| 544 | Ga0097621_100091200 | |||
| 545 | Ga0075370_10021530 | |||
| 546 | Ga0068871_100091476 | |||
| 547 | Ga0075428_100094516 | |||
| 548 | Ga0068865_100049488 | |||
| 549 | Ga0068865_100094197 | |||
| 550 | Ga0097620_100165027 | |||
| 551 | Ga0097620_100432722 | |||
| 552 | Ga0105250_10021087 | |||
| 553 | Ga0105240_10005299 | |||
| 554 | Ga0105245_10003785 | |||
| 555 | Ga0105247_10021348 | |||
| 556 | Ga0114129_10166071 | |||
| 557 | Ga0105243_10010813 | |||
| 558 | Ga0105241_10001238 | |||
| 559 | Ga0105241_10031306 | |||
| 560 | Ga0105248_10059623 | |||
| 561 | Ga0105237_10043184 | |||
| 562 | Ga0105238_10001034 | |||
| 563 | Ga0105238_10069870 | |||
| 564 | Ga0105249_10003943 | |||
| 565 | Ga0105249_10047918 | |||
| 566 | Ga0105239_10012073 | |||
| 567 | Ga0105239_10063359 | |||
| 568 | Ga0105239_10470173 | |||
| 569 | Ga0105246_10006437 | |||
| 570 | Ga0157378_10009302 | |||
| 571 | Ga0157378_10389196 | |||
| 572 | Ga0163162_10024905 | |||
| 573 | Ga0163162_10138030 | |||
| 574 | Ga0163162_10499808 | |||
| 575 | Ga0163162_10620308 | |||
| 576 | Ga0157375_10177329 | |||
| 577 | Ga0163163_10014512 | |||
| 578 | Ga0157380_10008291 | |||
| 579 | Ga0157379_10186724 | |||
| 580 | Ga0157379_10379599 | |||
| 581 | Ga0157376_10099258 | |||
| 582 | Ga0163161_10013156 | |||
| 583 | Ga0163161_10345019 | |||
| 584 | Ga0214544_1000013 | |||
| 585 | Ga0214542_1000013 | |||
| 586 | Ga0214545_1001323 | |||
| 587 | Ga0214543_1010219 | |||
| 588 | Ga0209563_101717 | |||
| 589 | Ga0209564_1001014 | |||
| 590 | Ga0209564_1020819 | |||
| 591 | Ga0209758_1005026 | |||
| 592 | Ga0209758_1015305 | |||
| 593 | Ga0209758_1046802 | |||
| 594 | Ga0207426_1006396 | |||
| 595 | Ga0207426_1018097 | |||
| 596 | Ga0207656_10072156 | |||
| 597 | Ga0207696_1055405 | |||
| 598 | Ga0207692_10001092 | |||
| 599 | Ga0207692_10029017 | |||
| 600 | Ga0207710_10029975 | |||
| 601 | Ga0207699_10000420 | |||
| 602 | Ga0207699_10037387 | |||
| 603 | Ga0207699_10047790 | |||
| 604 | Ga0207643_10128528 | |||
| 605 | Ga0207654_10000635 | |||
| 606 | Ga0207695_10002964 | |||
| 607 | Ga0207671_10004970 | |||
| 608 | Ga0207671_10203173 | |||
| 609 | Ga0207693_10009177 | |||
| 610 | Ga0207693_10019200 | |||
| 611 | Ga0207693_10035032 | |||
| 612 | Ga0207663_10010424 | |||
| 613 | Ga0207663_10117729 | |||
| 614 | Ga0207681_10163427 | |||
| 615 | Ga0207694_10000621 | |||
| 616 | Ga0207694_10143834 | |||
| 617 | Ga0207650_10094114 | |||
| 618 | Ga0207659_10034958 | |||
| 619 | Ga0207687_10001252 | |||
| 620 | Ga0207700_10040315 | |||
| 621 | Ga0207664_10018648 | |||
| 622 | Ga0207664_10021437 | |||
| 623 | Ga0207644_10270505 | |||
| 624 | Ga0207690_10131792 | |||
| 625 | Ga0207686_10025162 | |||
| 626 | Ga0207709_10037221 | |||
| 627 | Ga0207704_10023699 | |||
| 628 | Ga0207704_10308586 | |||
| 629 | Ga0207691_10024554 | |||
| 630 | Ga0207691_10092968 | |||
| 631 | Ga0207691_10282487 | |||
| 632 | Ga0207691_10310304 | |||
| 633 | Ga0207711_10064100 | |||
| 634 | Ga0207711_10227832 | |||
| 635 | Ga0207689_10004834 | |||
| 636 | Ga0207689_10011354 | |||
| 637 | Ga0207689_10050348 | |||
| 638 | Ga0207679_10456076 | |||
| 639 | Ga0207667_10010398 | |||
| 640 | Ga0207667_10562009 | |||
| 641 | Ga0207712_10147711 | |||
| 642 | Ga0207668_10003177 | |||
| 643 | Ga0207668_10076786 | |||
| 644 | Ga0207640_10007975 | |||
| 645 | Ga0207677_10004452 | |||
| 646 | Ga0207703_10007538 | |||
| 647 | Ga0207703_10100366 | |||
| 648 | Ga0207639_10547612 | |||
| 649 | Ga0207678_10007571 | |||
| 650 | Ga0207678_10011047 | |||
| 651 | Ga0207678_10020485 | |||
| 652 | Ga0207678_10024569 | |||
| 653 | Ga0207678_10492269 | |||
| 654 | Ga0207708_10076705 | |||
| 655 | Ga0207708_10123430 | |||
| 656 | Ga0207702_10000094 | |||
| 657 | Ga0207702_10000095 | |||
| 658 | Ga0207676_10006740 | |||
| 659 | Ga0207674_10001319 | |||
| 660 | Ga0207674_10040382 | |||
| 661 | Ga0207674_10187990 | |||
| 662 | Ga0207675_100001130 | |||
| 663 | Ga0207675_100105175 | |||
| 664 | Ga0207675_100112465 | |||
| 665 | Ga0207675_100201392 | |||
| 666 | Ga0207683_10024842 | |||
| 667 | Ga0207683_10158469 | |||
| 668 | Ga0207683_10327962 | |||
| 669 | Ga0207698_10041821 | |||
| 670 | Ga0207698_10290034 | |||
| 671 | Ga0268266_10025575 | |||
| 672 | Ga0268266_10028941 | |||
| 673 | Ga0268265_10204784 | |||
| 674 | Ga0268264_10016688 | |||
| 675 | Ga0268264_10230175 | |||
| 676 | Ga0307517_10000392 | |||
| 677 | Ga0307517_10147473 | |||
| 678 | Ga0307515_10042832 | |||
| 679 | Ga0307515_10072467 | |||
| 680 | Ga0265339_10012071 | |||
| 681 | Ga0307513_10067820 | |||
| 682 | Ga0307509_10124228 | |||
| 683 | Ga0307508_10119193 | |||
| 684 | Ga0307508_10120236 | |||
| 685 | Ga0307508_10296428 | |||
| 686 | Ga0265314_10008999 | |||
| 687 | Ga0265342_10003733 | |||
| 688 | Ga0307516_10004020 | |||
| 689 | Ga0307516_10014362 | |||
| 690 | Ga0307412_10155789 | |||
| 691 | Ga0307416_100413277 | |||
| 692 | Ga0307510_10005065 | |||
| 693 | Ga0307510_10147426 | |||
| 694 | Ga0373926_0076522 | |||
| 695 | Ga0373936_0059906 | |||
| 696 | Ga0373953_0013850 | |||
| 697 | Ga0373954_0059618 | |||
| 698 | Ga0373955_0050388 | |||
| 699 | Ga0373924_0062648 | |||
| 700 | Ga0373935_0030482 | |||
| 701 | Ga0373927_0016760 | |||
| 702 | Ga0373927_0162525 | |||
| 703 | Ga0373937_0074808 | |||
| 704 | Ga0373937_0256598 | |||
| 705 | Ga0373925_0196376 | |||
| 706 | Ga0436364_0938298 | |||
| 707 | Ga0436363_1317613 | |||
| 708 | Ga0466972_0047293 | |||
| 709 | Ga0466966_0027320 | |||
| 710 | Ga0466963_0349077 | |||
| 711 | Ga0466967_0340987 | |||
| 712 | Ga0495592_0093766 | |||
| 713 | Ga0495603_0030560 | |||
| 714 | Ga0495603_0039693 | |||
| 715 | Ga0495603_0076706 | |||
| 716 | Ga0495638_0013878 | |||
| 717 | Ga0495638_0114078 | |||
| 718 | Ga0495651_0012738 | |||
| 719 | Ga0495580_0014285 | |||
| 720 | Ga0495580_0185261 | |||
| 721 | Ga0495582_0085830 | |||
| 722 | Ga0495605_0028213 | |||
| 723 | Ga0495584_0089334 | |||
| 724 | Ga0495585_0163904 | |||
| 725 | Ga0495594_0078080 | |||
| 726 | Ga0495596_0046391 | |||
| 727 | Ga0495606_0124006 | |||
| 728 | Ga0495606_0186708 | |||
| 729 | Ga0495608_0125025 | |||
| 730 | Ga0495616_0080564 | |||
| 731 | Ga0495616_0110248 | |||
| 732 | Ga0495628_0081540 | |||
| 733 | Ga0495630_0078882 | |||
| 734 | Ga0495631_0021630 | |||
| 735 | Ga0495631_0047638 | |||
| 736 | Ga0495632_0059427 | |||
| 737 | Ga0495632_0137140 | |||
| 738 | Ga0495637_0081124 | |||
| 739 | Ga0495643_0093264 | |||
| 740 | Ga0495648_0023312 | |||
| 741 | Ga0495663_0051834 | |||
| 742 | Ga0495665_0029485 | |||
| 743 | Ga0495640_0239684 | |||
| 744 | Ga0495586_0087920 | |||
| 745 | Ga0495622_0003392 | |||
| 746 | Ga0495622_0103972 | |||
| 747 | Ga0495667_0060553 | |||
| 748 | Ga0495656_0003122 | |||
| 749 | Ga0495668_0045526 | |||
| 750 | Ga0495611_0067038 | |||
| 751 | Ga0495611_0110318 | |||
| 752 | Ga0495625_0112388 | |||
| 753 | Ga0495625_0128066 | |||
| 754 | Ga0495625_0183600 | |||
| 755 | Ga0495635_0168394 | |||
| 756 | Ga0495659_0012785 | |||
| 757 | Ga0495659_0073157 | |||
| 758 | Ga0495661_0053118 | |||
| 759 | Ga0495588_0057788 | |||
| 760 | Ga0495623_0252746 | |||
| 761 | Ga0495658_0186132 | |||
| 762 | Ga0495669_0002883 | |||
| 763 | Ga0495669_0118148 | |||
| 764 | Ga0495613_0034517 | |||
| 765 | Ga0495624_0074022 | |||
| 766 | Ga0495670_0004968 | |||
| 767 | Ga0495604_0137018 | |||
| 768 | Ga0495636_0048776 | |||
| 769 | Ga0495672_0076634 | |||
| 770 | Ga0495676_0140030 | |||
| 771 | Ga0495677_0110166 | |||
| 772 | Ga0495673_0024686 | |||
| 773 | Ga0495686_0114747 | |||
| 774 | Ga0495686_0179214 | |||
| 775 | Ga0495593_0040511 | |||
| 776 | Ga0495626_0070871 | |||
| 777 | Ga0496100_0084935 | |||
| 778 | Ga0496106_0071667 | |||
| 779 | Ga0496107_0165680 | |||
| 780 | Ga0496108_0130201 | |||
| 781 | Ga0496109_0031281 | |||
| 782 | Ga0496111_0401933 | |||
| 783 | Ga0496112_0307590 | |||
| 784 | Ga0496114_0084865 | |||
| 785 | Ga0496115_0304199 | |||
| 786 | Ga0496116_0004643 | |||
| 787 | Ga0496117_0024434 | |||
| 788 | Ga0496117_0096128 | |||
| 789 | Ga0496117_0104693 | |||
| 790 | Ga0496118_0026907 | |||
| 791 | Ga0496119_0086649 | |||
| 792 | Ga0496120_0041444 | |||
| 793 | Ga0496120_0050102 | |||
| 794 | Ga0496121_0012483 | |||
| 795 | Ga0496121_0025602 | |||
| 796 | Ga0496121_0032956 | |||
| 797 | Ga0496121_0051292 | |||
| 798 | Ga0496121_0079496 | |||
| 799 | Ga0496121_0087275 | |||
| 800 | Ga0496121_0111387 | |||
| 801 | Ga0496121_0116368 | |||
| 802 | Ga0496121_0152909 | |||
| 803 | Ga0496121_0192490 | |||
| 804 | Ga0496122_0176124 | |||
| 805 | Ga0496123_0058382 | |||
| 806 | Ga0496123_0077901 | |||
| 807 | Ga0496124_0030178 | |||
| 808 | Ga0496125_0001755 | |||
| 809 | Ga0496125_0006438 | |||
| 810 | Ga0496126_0023992 | |||
| 811 | Ga0496126_0025042 | |||
| 812 | Ga0496126_0068744 | |||
| 813 | Ga0496126_0224424 | |||
| 814 | Ga0496126_0264443 | |||
| 815 | Ga0496126_0458758 | |||
| 816 | Ga0495678_015491 | |||
| 817 | Ga0501069_0222980 | |||
| 818 | nmdc:mga03n38_8146_c1 | |||
| 819 | nmdc:mga00v17_118560_c1 | |||
| 820 | nmdc:mga00v17_59521_c1 | |||
| 821 | nmdc:mga0yw44_254294_c1 | |||
| 822 | nmdc:mga06z11_6382_c1 | |||
| 823 | nmdc:mga06z11_85969_c1 | |||
| 824 | nmdc:mga07m45_161121_c1 | |||
| 825 | nmdc:mga07m45_45167_c1 | |||
| 826 | nmdc:mga05p37_108990_c1 | |||
| 827 | Ga0500635_0006821 | |||
| 828 | Ga0500578_0214408 | |||
| 829 | Ga0500581_159365 | |||
| 830 | Ga0500651_0204616 | |||
| 831 | Ga0500566_0000446 | |||
| 832 | Ga0500566_0000506 | |||
| 833 | Ga0500566_0015456 | |||
| 834 | Ga0500640_009085 | |||
| 835 | Ga0500641_0003794 | |||
| 836 | Ga0500641_0055922 | |||
| 837 | Ga0500554_019508 | |||
| 838 | Ga0500555_039738 | |||
| 839 | Ga0500556_0000003 | |||
| 840 | Ga0500562_017311 | |||
| 841 | Ga0500562_022454 | |||
| 842 | Ga0500569_005451 | |||
| 843 | Ga0500569_005702 | |||
| 844 | Ga0500572_072059 | |||
| 845 | Ga0500592_004246 | |||
| 846 | Ga0500595_021775 | |||
| 847 | Ga0500608_027334 | |||
| 848 | Ga0500614_000626 | |||
| 849 | Ga0500618_023023 | |||
| 850 | Ga0500642_0005633 | |||
| 851 | Ga0500642_0095919 | |||
| 852 | Ga0500652_017706 | |||
| 853 | Ga0500655_016769 | |||
| 854 | Ga0500559_0000146 | |||
| 855 | Ga0500559_0001239 | |||
| 856 | Ga0500568_0001368 | |||
| 857 | Ga0500577_0000111 | |||
| 858 | Ga0500577_0032392 | |||
| 859 | Ga0500577_0049884 | |||
| 860 | Ga0500586_016151 | |||
| 861 | Ga0500603_000046 | |||
| 862 | Ga0500616_0000041 | |||
| 863 | Ga0500616_0133616 | |||
| 864 | Ga0500616_0180316 | |||
| 865 | Ga0500622_0022350 | |||
| 866 | Ga0500622_0037800 | |||
| 867 | Ga0500622_0157345 | |||
| 868 | Ga0500627_0047453 | |||
| 869 | Ga0500627_0064267 | |||
| 870 | Ga0500630_001607 | |||
| 871 | Ga0500633_0007526 | |||
| 872 | Ga0500634_0143014 | |||
| 873 | Ga0500638_028594 | |||
| 874 | Ga0500638_040714 | |||
| 875 | Ga0500639_000085 | |||
| 876 | Ga0500636_0000625 | |||
| 877 | Ga0500637_0124166 | |||
| 878 | Ga0500596_000872 | |||
| 879 | Ga0500599_001455 | |||
| 880 | 2508544485 | |||
| 881 | 2603860721 | |||
| 882 | 2617378782 | |||
| 883 | 2671121996 | |||
| 884 | 2793068983 | |||
| 885 | 2824681188 | |||
| 886 | 2824739071 | |||
| 887 | 2824750436 | |||
| 888 | 2841960562 | |||
| 889 | 2857524840 | |||
| 890 | 2874611649 | |||
| 891 | 2874613003 | |||
| 892 | 2885376609 | |||
| 893 | 2885417589 | |||
| 894 | 2888388724 | |||
| 895 | 2893069354 | |||
| 896 | 2908741348 | |||
| 897 | 2919078727 | |||
| 898 | 2922387047 | |||
| 899 | 2922399412 | |||
| 900 | 3005475425 | |||
| 901 | 3005594763 | |||
| 902 | 3005712965 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o74-assembly3.cif.gz_F | structure of ohcu decarboxylase in complex with guanine | 0.95 | 6 | 168 |
| 4q14-assembly1.cif.gz_B | crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis | 0.9238 | 179 | 295 |
| 2gpz-assembly1.cif.gz_A | transthyretin-like protein from salmonella dublin | 0.918 | 180 | 295 |
| 2o74-assembly3.cif.gz_F | structure of ohcu decarboxylase in complex with guanine | 0.9175 | 6 | 168 |
| 4q14-assembly1.cif.gz_B | crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis | 0.9089 | 179 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2o70F00 | Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | 0.9509 | 6 | 168 | 1.10.3330.10 |
| 4q14B00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9239 | 179 | 295 | 2.60.40.180 |
| 2o70F00 | Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase | 0.9183 | 6 | 168 | 1.10.3330.10 |
| 2gpzC00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.918 | 180 | 295 | 2.60.40.180 |
| 4q14B00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9091 | 179 | 295 | 2.60.40.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T1AAF6-F1-model_v4 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) | 0.9788 | 3 | 171 |
GO:0000255
GO:0005777 GO:0006144 GO:0019628 GO:0051997 |
| AF-A0A7V9SJ48-F1-model_v4 | Xanthine dehydrogenase molybdopterin binding subunit (EC 1.17.1.4) | 0.9776 | 6 | 169 |
GO:0000255
GO:0004854 GO:0005506 GO:0006144 GO:0019628 GO:0030151 |
| AF-A0A4Y8U257-F1-model_v4 | deleted | 0.9772 | 3 | 170 |
|
| AF-A0A172YFF4-F1-model_v4 | 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) | 0.9762 | 2 | 170 |
GO:0000255
GO:0005777 GO:0006144 GO:0019628 GO:0051997 |
| AF-A0A4Q3HLA8-F1-model_v4 | deleted | 0.9758 | 107 | 292 |
|