F446802

General Info

Members Datasets Scaffolds Average Seq Length
451 303 902 214

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10243339|Ga0207665_102433392
Length 248
Sequence MSSVDQTSIRQEYKDQTRVRILDAAMLVFRRHGFRRSSIEQAAEAAGLTRQALYHHFKSKEALFRAVIERLYENALAAEIAAANAAEKAGGSIADIILAEITGRLRQVIGSFHGSPHIEELFSEHLVQARDLYQKYSGLYGKQLAATIERVCRKQQLTLAAGMNSRNFARCIEMAISGSKSMHPAMQPADAFLKDLEIMVRTLVAGAVGASPKLRPMKPATAKKPSAKTLEIANEHDDDQRPRRAPPR

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
181 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
277 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
278 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
281 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
282 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
287 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
288 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
289 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
292 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
293 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
294 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
295 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
296 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
297 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
298 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
299 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
300 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
301 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
302 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
303 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 0
Isolates 2.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.53
Nodule 1.55
Rhizoplane 7.98
Rhizosphere 72.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10243339 3300025939 Bacteria 1326
2 JGI25153J46596_10004077 3300003215 Bacteria 7950
3 rootL2_10053669 3300003322 Bacteria 2540
4 Ga0070658_10297391 3300005327 Bacteria 1376
5 Ga0070666_10328050 3300005335 Bacteria 1093
6 Ga0070666_10452834 3300005335 Bacteria 927
7 Ga0070680_100050906 3300005336 Bacteria 3379
8 Ga0070682_100136274 3300005337 Bacteria 1668
9 Ga0070682_100332999 3300005337 Bacteria 1126
10 Ga0068868_100053907 3300005338 Bacteria 3168
11 Ga0070660_100066999 3300005339 Bacteria 2797
12 Ga0070660_100483812 3300005339 Bacteria 1029
13 Ga0070691_10392931 3300005341 Bacteria 780
14 Ga0070661_100240547 3300005344 Bacteria 1394
15 Ga0070661_100727848 3300005344 Bacteria 810
16 Ga0070668_100424762 3300005347 Bacteria 1138
17 Ga0070669_100479086 3300005353 Bacteria 1029
18 Ga0070675_100770268 3300005354 Bacteria 879
19 Ga0070671_100102255 3300005355 Bacteria 2404
20 Ga0070671_100157178 3300005355 Bacteria 1921
21 Ga0070671_100217450 3300005355 Bacteria 1621
22 Ga0070688_100063221 3300005365 Bacteria 2345
23 Ga0070701_10254024 3300005438 Bacteria 1063
24 Ga0070700_100220161 3300005441 Bacteria 1344
25 Ga0070694_100106796 3300005444 Bacteria 1989
26 Ga0070663_100508412 3300005455 Bacteria 1001
27 Ga0070678_100033929 3300005456 Bacteria 3548
28 Ga0070678_100137260 3300005456 Bacteria 1952
29 Ga0070678_100294056 3300005456 Bacteria 1378
30 Ga0070678_100302451 3300005456 Bacteria 1360
31 Ga0070662_100221316 3300005457 Bacteria 1510
32 Ga0070681_10051506 3300005458 Bacteria 4106
33 Ga0070685_10155102 3300005466 Bacteria 1454
34 Ga0070706_100589758 3300005467 Bacteria 1033
35 Ga0070706_100872523 3300005467 Bacteria 832
36 Ga0070679_100073700 3300005530 Bacteria 3405
37 Ga0070684_100635586 3300005535 Bacteria 993
38 Ga0068853_100153536 3300005539 Bacteria 2073
39 Ga0068853_100203838 3300005539 Bacteria 1801
40 Ga0068853_100271135 3300005539 Bacteria 1563
41 Ga0070686_100201027 3300005544 Bacteria 1428
42 Ga0070693_100077691 3300005547 Bacteria 1971
43 Ga0070693_100165307 3300005547 Bacteria 1413
44 Ga0070665_100017212 3300005548 Bacteria 7253
45 Ga0070665_100064844 3300005548 Bacteria 3664
46 Ga0070665_100831429 3300005548 Bacteria 936
47 Ga0068855_100008500 3300005563 Bacteria 12410
48 Ga0068855_100064277 3300005563 Bacteria 4279
49 Ga0068857_100408728 3300005577 Bacteria 1264
50 Ga0068856_100102134 3300005614 Bacteria 2860
51 Ga0068856_100269376 3300005614 Bacteria 1719
52 Ga0068852_100103780 3300005616 Bacteria 2572
53 Ga0068852_100260535 3300005616 Bacteria 1665
54 Ga0068852_100421390 3300005616 Bacteria 1317
55 Ga0068859_100025848 3300005617 Bacteria 5890
56 Ga0068864_100108510 3300005618 Bacteria 2470
57 Ga0068861_100690091 3300005719 Bacteria 947
58 Ga0068851_10137924 3300005834 Bacteria 1324
59 Ga0068870_10019559 3300005840 Bacteria 3286
60 Ga0068858_100616180 3300005842 Bacteria 1053
61 Ga0068860_100036330 3300005843 Bacteria 4721
62 Ga0068860_100162554 3300005843 Bacteria 2153
63 Ga0068862_100576347 3300005844 Bacteria 1077
64 Ga0081455_10009024 3300005937 Bacteria 10292
65 Ga0081455_10017754 3300005937 Bacteria 6807
66 Ga0081455_10030094 3300005937 Bacteria 4939
67 Ga0081538_10087125 3300005981 Bacteria 1632
68 Ga0081540_1007732 3300005983 Bacteria 7613
69 Ga0081540_1008133 3300005983 Bacteria 7358
70 Ga0081540_1012690 3300005983 Bacteria 5526
71 Ga0081540_1014117 3300005983 Bacteria 5141
72 Ga0081540_1031240 3300005983 Bacteria 2933
73 Ga0081539_10000191 3300005985 Bacteria 142387
74 Ga0070717_10005130 3300006028 Bacteria 9551
75 Ga0075365_10095484 3300006038 Bacteria 2030
76 Ga0075365_10139466 3300006038 Bacteria 1683
77 Ga0075365_10232860 3300006038 Bacteria 1293
78 Ga0075368_10039678 3300006042 Bacteria 1846
79 Ga0075363_100048805 3300006048 Bacteria 2252
80 Ga0075363_100124999 3300006048 Bacteria 1439
81 Ga0075364_10115707 3300006051 Bacteria 1792
82 Ga0075364_10300445 3300006051 Bacteria 1093
83 Ga0075364_10456828 3300006051 Bacteria 873
84 Ga0070716_100287290 3300006173 Bacteria 1138
85 Ga0070712_100681617 3300006175 Bacteria 875
86 Ga0075362_10044367 3300006177 Bacteria 1971
87 Ga0075362_10060323 3300006177 Bacteria 1714
88 Ga0075367_10253342 3300006178 Bacteria 1104
89 Ga0075369_10012585 3300006186 Bacteria 3342
90 Ga0075369_10033498 3300006186 Bacteria 2178
91 Ga0075366_10122837 3300006195 Bacteria 1565
92 Ga0075366_10214392 3300006195 Bacteria 1172
93 Ga0097621_100181728 3300006237 Bacteria 1817
94 Ga0075370_10053960 3300006353 Bacteria 2281
95 Ga0068871_100537971 3300006358 Bacteria 1057
96 Ga0075428_100104254 3300006844 Bacteria 3092
97 Ga0075434_100097451 3300006871 Bacteria 2946
98 Ga0068865_100255590 3300006881 Bacteria 1385
99 Ga0075436_100512749 3300006914 Bacteria 878
100 Ga0097620_100025848 3300006931 Bacteria 5890
101 Ga0075435_100178399 3300007076 Bacteria 1795
102 Ga0099794_10086780 3300007265 Bacteria 1550
103 Ga0099795_10038673 3300007788 Bacteria 1685
104 Ga0099795_10110325 3300007788 Bacteria 1090
105 Ga0105251_10129971 3300009011 Bacteria 1142
106 Ga0105250_10047525 3300009092 Bacteria 1721
107 Ga0105240_10119387 3300009093 Bacteria 3176
108 Ga0105240_10804768 3300009093 Bacteria 1018
109 Ga0111539_10994317 3300009094 Bacteria 975
110 Ga0105245_10108049 3300009098 Bacteria 2584
111 Ga0105247_10058680 3300009101 Bacteria 2381
112 Ga0105247_10377852 3300009101 Bacteria 1004
113 Ga0105247_10517470 3300009101 Bacteria 872
114 Ga0114129_10240232 3300009147 Bacteria 2435
115 Ga0105243_10266421 3300009148 Bacteria 1536
116 Ga0105243_10377923 3300009148 Bacteria 1309
117 Ga0105241_10255360 3300009174 Bacteria 1488
118 Ga0105242_10356178 3300009176 Bacteria 1353
119 Ga0105248_10047100 3300009177 Bacteria 4834
120 Ga0105248_10078478 3300009177 Bacteria 3711
121 Ga0105248_10557351 3300009177 Bacteria 1293
122 Ga0105248_10866388 3300009177 Bacteria 1020
123 Ga0105237_10082630 3300009545 Bacteria 3203
124 Ga0105237_10841552 3300009545 Bacteria 924
125 Ga0105238_10424690 3300009551 Bacteria 1324
126 Ga0105238_10891058 3300009551 Bacteria 908
127 Ga0105249_10748667 3300009553 Bacteria 1039
128 Ga0105249_10932440 3300009553 Bacteria 936
129 Ga0099796_10014402 3300010159 Bacteria 2284
130 Ga0099796_10020624 3300010159 Bacteria 2017
131 Ga0099796_10044686 3300010159 Bacteria 1514
132 Ga0099796_10048625 3300010159 Bacteria 1463
133 Ga0105239_10007120 3300010375 Bacteria 12868
134 Ga0105239_10161914 3300010375 Bacteria 2500
135 Ga0105239_10487032 3300010375 Bacteria 1401
136 Ga0105246_10013421 3300011119 Bacteria 5136
137 Ga0105246_10038604 3300011119 Bacteria 3212
138 Ga0105246_10348082 3300011119 Bacteria 1213
139 Ga0105246_10685596 3300011119 Bacteria 896
140 Ga0105246_10715506 3300011119 Bacteria 879
141 Ga0157370_10113852 3300013104 Bacteria 2528
142 Ga0157374_10043178 3300013296 Bacteria 4163
143 Ga0157374_10103315 3300013296 Bacteria 2734
144 Ga0157374_10265540 3300013296 Bacteria 1691
145 Ga0157378_11267901 3300013297 Bacteria 777
146 Ga0163162_10264274 3300013306 Bacteria 1852
147 Ga0163162_10356599 3300013306 Bacteria 1595
148 Ga0163162_10747617 3300013306 Bacteria 1097
149 Ga0157375_10076483 3300013308 Bacteria 3374
150 Ga0163163_10181681 3300014325 Bacteria 2151
151 Ga0163163_10279797 3300014325 Bacteria 1720
152 Ga0163163_10376919 3300014325 Bacteria 1476
153 Ga0157380_10486220 3300014326 Bacteria 1195
154 Ga0157379_10404219 3300014968 Bacteria 1256
155 Ga0157379_10567196 3300014968 Bacteria 1057
156 Ga0157379_10993945 3300014968 Bacteria 800
157 Ga0157376_10168076 3300014969 Bacteria 1994
158 Ga0182007_10074425 3300015262 Bacteria 1113
159 Ga0163161_10615804 3300017792 Bacteria 897
160 Ga0209758_1002180 3300025297 Bacteria 20532
161 Ga0207697_10073831 3300025315 Bacteria 1432
162 Ga0207642_10136702 3300025899 Bacteria 1286
163 Ga0207710_10104127 3300025900 Bacteria 1342
164 Ga0207647_10085687 3300025904 Bacteria 1884
165 Ga0207643_10062650 3300025908 Bacteria 2125
166 Ga0207705_10095888 3300025909 Bacteria 2177
167 Ga0207654_10035557 3300025911 Bacteria 2777
168 Ga0207654_10332292 3300025911 Bacteria 1042
169 Ga0207707_10087061 3300025912 Bacteria 2730
170 Ga0207695_10193546 3300025913 Bacteria 1950
171 Ga0207695_10781036 3300025913 Bacteria 835
172 Ga0207671_10479968 3300025914 Bacteria 991
173 Ga0207693_10009898 3300025915 Bacteria 7753
174 Ga0207660_10044470 3300025917 Bacteria 3124
175 Ga0207662_10088633 3300025918 Bacteria 1900
176 Ga0207657_10036288 3300025919 Bacteria 4413
177 Ga0207646_10449982 3300025922 Bacteria 1162
178 Ga0207681_10144636 3300025923 Bacteria 1775
179 Ga0207659_10083593 3300025926 Bacteria 2367
180 Ga0207687_10044331 3300025927 Bacteria 3069
181 Ga0207644_10124251 3300025931 Bacteria 1968
182 Ga0207644_10232232 3300025931 Bacteria 1466
183 Ga0207706_10032724 3300025933 Bacteria 4629
184 Ga0207709_10070053 3300025935 Bacteria 2222
185 Ga0207670_10463797 3300025936 Bacteria 1023
186 Ga0207704_10092586 3300025938 Bacteria 1990
187 Ga0207704_10292854 3300025938 Bacteria 1243
188 Ga0207691_10445710 3300025940 Bacteria 1102
189 Ga0207711_10068163 3300025941 Bacteria 3081
190 Ga0207711_10135412 3300025941 Bacteria 2212
191 Ga0207689_10412813 3300025942 Bacteria 1126
192 Ga0207679_10894327 3300025945 Bacteria 812
193 Ga0207667_10021533 3300025949 Bacteria 7143
194 Ga0207667_10050800 3300025949 Bacteria 4373
195 Ga0207651_10433641 3300025960 Bacteria 1124
196 Ga0207668_10843970 3300025972 Bacteria 813
197 Ga0207703_10104780 3300026035 Bacteria 2403
198 Ga0207639_10183570 3300026041 Bacteria 1781
199 Ga0207678_10014901 3300026067 Bacteria 6838
200 Ga0207678_10019008 3300026067 Bacteria 6036
201 Ga0207678_10029500 3300026067 Bacteria 4788
202 Ga0207678_10155667 3300026067 Bacteria 1951
203 Ga0207678_10202950 3300026067 Bacteria 1695
204 Ga0207708_10071680 3300026075 Bacteria 2654
205 Ga0207702_10041361 3300026078 Bacteria 3865
206 Ga0207702_10175121 3300026078 Bacteria 1971
207 Ga0207702_11093130 3300026078 Bacteria 791
208 Ga0207641_10025123 3300026088 Bacteria 4911
209 Ga0207648_10651465 3300026089 Bacteria 973
210 Ga0207676_10418222 3300026095 Bacteria 1256
211 Ga0207674_10493012 3300026116 Bacteria 1184
212 Ga0207675_100046630 3300026118 Bacteria 4049
213 Ga0207683_10034046 3300026121 Bacteria 4427
214 Ga0207683_10174502 3300026121 Bacteria 1947
215 Ga0207683_10321050 3300026121 Bacteria 1418
216 Ga0207698_10083440 3300026142 Bacteria 2586
217 Ga0207698_10299046 3300026142 Bacteria 1497
218 Ga0209179_1043058 3300027512 Bacteria 954
219 Ga0209813_10054212 3300027866 Bacteria 1263
220 Ga0268266_10031885 3300028379 Bacteria 4477
221 Ga0268266_10048964 3300028379 Bacteria 3622
222 Ga0268265_10176704 3300028380 Bacteria 1830
223 Ga0268265_10775319 3300028380 Bacteria 932
224 Ga0268264_10083749 3300028381 Bacteria 2732
225 Ga0268264_10226084 3300028381 Bacteria 1725
226 Ga0307517_10006667 3300028786 Bacteria 17002
227 Ga0307517_10102407 3300028786 Bacteria 2245
228 Ga0307515_10043676 3300028794 Bacteria 6957
229 Ga0307513_10021103 3300031456 Bacteria 7696
230 Ga0307513_10275993 3300031456 Bacteria 1461
231 Ga0307509_10423599 3300031507 Bacteria 1031
232 Ga0307408_100785286 3300031548 Bacteria 863
233 Ga0307508_10166914 3300031616 Bacteria 1805
234 Ga0307516_10006009 3300031730 Bacteria 14346
235 Ga0307516_10139455 3300031730 Bacteria 2196
236 Ga0307516_10200411 3300031730 Bacteria 1716
237 Ga0307516_10250605 3300031730 Bacteria 1465
238 Ga0307405_10219097 3300031731 Bacteria 1395
239 Ga0307413_10022807 3300031824 Bacteria 3382
240 Ga0307406_10663654 3300031901 Bacteria 867
241 Ga0307411_10174681 3300032005 Bacteria 1624
242 Ga0307411_10472655 3300032005 Bacteria 1054
243 Ga0307415_100167411 3300032126 Bacteria 1710
244 Ga0307415_100682951 3300032126 Bacteria 924
245 Ga0307510_10023861 3300033180 Bacteria 7080
246 Ga0307510_10046908 3300033180 Bacteria 4638
247 Ga0373938_0071256 3300034957 Bacteria 831
248 Ga0373929_0093655 3300035085 Bacteria 749
249 Ga0373936_0004524 3300035113 Bacteria 5266
250 Ga0373941_0013593 3300035115 Bacteria 2156
251 Ga0373954_0161220 3300035118 Bacteria 1097
252 Ga0373943_0003930 3300035170 Bacteria 6767
253 Ga0373943_0130647 3300035170 Bacteria 1344
254 Ga0373946_0001903 3300035171 Bacteria 7278
255 Ga0373955_0014055 3300035172 Bacteria 3886
256 Ga0373931_0099366 3300035691 Bacteria 1634
257 Ga0373935_0000721 3300035692 Bacteria 17592
258 Ga0373927_0002042 3300035695 Bacteria 14870
259 Ga0373927_0023807 3300035695 Bacteria 4008
260 Ga0373927_0227269 3300035695 Bacteria 1226
261 Ga0373933_0000241 3300035724 Bacteria 35958
262 Ga0373947_0001351 3300035725 Bacteria 15069
263 Ga0373947_0098771 3300035725 Bacteria 1832
264 Ga0373925_0000797 3300037068 Bacteria 29074
265 Ga0439465_0042853 3300041413 Bacteria 1468
266 Ga0451849_0180358 3300041505 Bacteria 901
267 Ga0451849_1134788 3300041505 Bacteria 739
268 Ga0495617_047422 3300046452 Bacteria 1430
269 Ga0495603_0000579 3300046455 Bacteria 20567
270 Ga0495603_0012573 3300046455 Bacteria 5123
271 Ga0495603_0110791 3300046455 Bacteria 1601
272 Ga0495590_0088149 3300046457 Bacteria 1097
273 Ga0495629_0000341 3300046459 Bacteria 39851
274 Ga0495641_0004934 3300046461 Bacteria 9233
275 Ga0495641_0023391 3300046461 Bacteria 3070
276 Ga0495653_0056425 3300046463 Bacteria 2994
277 Ga0495650_0048895 3300046471 Bacteria 1759
278 Ga0495580_0000789 3300046472 Bacteria 27361
279 Ga0495582_0000459 3300046473 Bacteria 22279
280 Ga0495582_0173206 3300046473 Bacteria 1229
281 Ga0495605_0070850 3300046474 Bacteria 1648
282 Ga0495605_0208796 3300046474 Bacteria 848
283 Ga0495639_0000170 3300046475 Bacteria 34055
284 Ga0495639_0040130 3300046475 Bacteria 2105
285 Ga0495662_0000762 3300046476 Bacteria 15504
286 Ga0495662_0058561 3300046476 Bacteria 1861
287 Ga0495664_0003034 3300046477 Bacteria 9095
288 Ga0495594_0000325 3300046499 Bacteria 23654
289 Ga0495594_0017922 3300046499 Bacteria 3747
290 Ga0495594_0046040 3300046499 Bacteria 2395
291 Ga0495594_0080301 3300046499 Bacteria 1821
292 Ga0495596_0117198 3300046500 Bacteria 1034
293 Ga0495583_0129864 3300046506 Bacteria 1055
294 Ga0495606_0296692 3300046507 Bacteria 877
295 Ga0495616_0117224 3300046513 Bacteria 1232
296 Ga0495618_0355397 3300046514 Bacteria 902
297 Ga0495620_0030393 3300046515 Bacteria 2487
298 Ga0495620_0167334 3300046515 Bacteria 853
299 Ga0495628_0162031 3300046516 Bacteria 1699
300 Ga0495628_0448633 3300046516 Bacteria 937
301 Ga0495630_0001846 3300046517 Bacteria 14789
302 Ga0495630_0207652 3300046517 Bacteria 1495
303 Ga0495631_0126171 3300046518 Bacteria 1100
304 Ga0495632_0336696 3300046519 Bacteria 665
305 Ga0495643_0123647 3300046522 Bacteria 1305
306 Ga0495663_0024858 3300046525 Bacteria 1744
307 Ga0495666_0067093 3300046526 Bacteria 1710
308 Ga0495666_0199421 3300046526 Bacteria 920
309 Ga0495642_0188662 3300046528 Bacteria 898
310 Ga0495665_0000042 3300046531 Bacteria 49467
311 Ga0495640_0009805 3300046533 Bacteria 7437
312 Ga0495609_0209286 3300046538 Bacteria 813
313 Ga0495597_0091746 3300046542 Bacteria 1289
314 Ga0495622_0007881 3300046557 Bacteria 4943
315 Ga0495633_0037322 3300046558 Bacteria 2325
316 Ga0495667_0174248 3300046559 Bacteria 1382
317 Ga0495656_0016409 3300046615 Bacteria 2809
318 Ga0495656_0042661 3300046615 Bacteria 1900
319 Ga0495668_0112137 3300046616 Bacteria 1491
320 Ga0495668_0260413 3300046616 Bacteria 949
321 Ga0495634_0000249 3300046642 Bacteria 50835
322 Ga0495611_0094230 3300046648 Bacteria 1385
323 Ga0495611_0130600 3300046648 Bacteria 1171
324 Ga0495625_0429710 3300046660 Bacteria 819
325 Ga0495635_0000474 3300046663 Bacteria 25424
326 Ga0495635_0153797 3300046663 Bacteria 1566
327 Ga0495659_0009566 3300046664 Bacteria 3097
328 Ga0495661_0113011 3300046665 Bacteria 1511
329 Ga0495599_0265489 3300046678 Bacteria 1042
330 Ga0495647_0027939 3300046681 Bacteria 2077
331 Ga0495658_0003515 3300046683 Bacteria 7754
332 Ga0495658_0426281 3300046683 Bacteria 846
333 Ga0495669_0277928 3300046684 Bacteria 805
334 Ga0495613_0001536 3300046689 Bacteria 17570
335 Ga0495624_0000758 3300046690 Bacteria 25442
336 Ga0495670_0287158 3300046691 Bacteria 880
337 Ga0495649_0418571 3300046694 Bacteria 671
338 Ga0495589_0054221 3300046794 Bacteria 1977
339 Ga0495600_0174397 3300046809 Bacteria 1387
340 Ga0495581_0000010 3300047315 Bacteria 64779
341 Ga0495581_0025037 3300047315 Bacteria 3458
342 Ga0495604_0327947 3300047317 Bacteria 1022
343 Ga0495674_0000082 3300047319 Bacteria 65609
344 Ga0495672_0007715 3300047320 Bacteria 8056
345 Ga0495672_0138178 3300047320 Bacteria 1275
346 Ga0495677_0052724 3300047445 Bacteria 1499
347 Ga0495685_024974 3300047447 Bacteria 2057
348 Ga0495673_0008722 3300047469 Bacteria 5666
349 Ga0495673_0082029 3300047469 Bacteria 1334
350 Ga0495673_0139847 3300047469 Bacteria 944
351 Ga0495684_0713278 3300047471 Bacteria 664
352 Ga0495686_0086026 3300047472 Bacteria 1913
353 Ga0495686_0208915 3300047472 Bacteria 1116
354 Ga0495593_0000034 3300047673 Bacteria 57993
355 Ga0496101_0462971 3300048904 Bacteria 1001
356 Ga0496102_0069670 3300048905 Bacteria 3228
357 Ga0496102_0186289 3300048905 Bacteria 1956
358 Ga0496102_0208161 3300048905 Bacteria 1844
359 Ga0496102_0234561 3300048905 Bacteria 1730
360 Ga0496102_0748560 3300048905 Bacteria 900
361 Ga0496103_0013317 3300048906 Bacteria 4874
362 Ga0496103_0149913 3300048906 Bacteria 1494
363 Ga0496103_0209557 3300048906 Bacteria 1253
364 Ga0496105_0161313 3300048908 Bacteria 1840
365 Ga0496106_0383344 3300048909 Bacteria 1129
366 Ga0496107_0083363 3300048910 Bacteria 2331
367 Ga0496107_0689037 3300048910 Bacteria 752
368 Ga0496108_0311422 3300048911 Bacteria 1372
369 Ga0496108_0368278 3300048911 Bacteria 1254
370 Ga0496108_0735138 3300048911 Bacteria 854
371 Ga0496109_0076921 3300048912 Bacteria 3070
372 Ga0496109_0247594 3300048912 Bacteria 1678
373 Ga0496109_0437078 3300048912 Bacteria 1236
374 Ga0496110_0049362 3300048913 Bacteria 3691
375 Ga0496110_0459702 3300048913 Bacteria 1160
376 Ga0496110_0945265 3300048913 Bacteria 768
377 Ga0496110_1093361 3300048913 Bacteria 705
378 Ga0496111_0149915 3300048914 Bacteria 1730
379 Ga0496111_0181971 3300048914 Bacteria 1562
380 Ga0496111_0490617 3300048914 Bacteria 904
381 Ga0496112_0082032 3300048915 Bacteria 3189
382 Ga0496112_0085394 3300048915 Bacteria 3122
383 Ga0496112_0153828 3300048915 Bacteria 2267
384 Ga0496112_0927310 3300048915 Bacteria 792
385 Ga0496113_0258408 3300048916 Bacteria 1391
386 Ga0496114_0223127 3300048917 Bacteria 1654
387 Ga0496114_0279806 3300048917 Bacteria 1471
388 Ga0496114_0956724 3300048917 Bacteria 739
389 Ga0496115_0006080 3300048918 Bacteria 8816
390 Ga0496115_0245669 3300048918 Bacteria 1475
391 Ga0496116_0083948 3300048919 Bacteria 1964
392 Ga0496117_0335719 3300048920 Bacteria 786
393 Ga0496119_0140111 3300048922 Bacteria 1307
394 Ga0496121_0065418 3300048924 Bacteria 2958
395 Ga0496121_0065618 3300048924 Bacteria 2952
396 Ga0496124_0112828 3300048927 Bacteria 2185
397 Ga0496125_0183421 3300048928 Bacteria 1391
398 Ga0496126_0033287 3300048929 Bacteria 4849
399 Ga0495678_086103 3300049459 Bacteria 1118
400 Ga0501039_0267673 3300049575 Bacteria 1343
401 nmdc:mga03n38_100338_c1 3300050490 Bacteria 1395
402 nmdc:mga00v17_109802_c1 3300050491 Bacteria 1749
403 nmdc:mga00v17_386188_c1 3300050491 Bacteria 910
404 nmdc:mga0yw44_86560_c1 3300050492 Bacteria 1974
405 nmdc:mga0k408_91132_c1 3300050493 Bacteria 884
406 nmdc:mga06z11_318175_c1 3300050494 Bacteria 928
407 nmdc:mga06z11_32420_c1 3300050494 Bacteria 2548
408 nmdc:mga06z11_97939_c1 3300050494 Bacteria 1604
409 nmdc:mga04h51_24187_c1 3300050495 Bacteria 1858
410 nmdc:mga07m45_29567_c1 3300050496 Bacteria 3031
411 nmdc:mga07m45_310534_c1 3300050496 Bacteria 917
412 nmdc:mga05p37_45620_c1 3300050507 Bacteria 5389
413 nmdc:mga09592_282877_c1 3300050508 Bacteria 1438
414 nmdc:mga0n895_247738_c1 3300050512 Bacteria 1808
415 nmdc:mga0rr50_167805_c1 3300050513 Bacteria 1786
416 nmdc:mga08x19_408997_c1 3300050514 Bacteria 952
417 nmdc:mga0a205_732983_c1 3300050515 Bacteria 837
418 nmdc:mga0sz30_201977_c1 3300050516 Bacteria 883
419 Ga0495601_0104078 3300053077 Bacteria 1835
420 Ga0500610_0132219 3300053079 Bacteria 1268
421 Ga0500610_0193173 3300053079 Bacteria 987
422 Ga0500635_0004483 3300053080 Bacteria 3603
423 Ga0495655_0019353 3300053083 Bacteria 1511
424 Ga0495619_0057755 3300053085 Bacteria 2575
425 Ga0500641_0004230 3300053096 Bacteria 5064
426 Ga0500641_0020927 3300053096 Bacteria 2486
427 Ga0500650_0122880 3300053098 Bacteria 1209
428 Ga0500554_040768 3300053102 Bacteria 1424
429 Ga0500562_032245 3300053108 Bacteria 1382
430 Ga0500594_0120791 3300053118 Bacteria 822
431 Ga0500595_003594 3300053119 Bacteria 7194
432 Ga0500655_009033 3300053133 Bacteria 1794
433 Ga0500655_065373 3300053133 Bacteria 737
434 Ga0500561_0023392 3300053137 Bacteria 1480
435 Ga0500589_056870 3300053147 Bacteria 1802
436 Ga0500603_000076 3300053150 Bacteria 22738
437 Ga0500622_0168786 3300053156 Bacteria 1020
438 Ga0500636_0245609 3300053177 Bacteria 916
439 Ga0500637_0000672 3300053178 Bacteria 13572
440 Ga0500637_0114942 3300053178 Bacteria 1561
441 Ga0500645_038470 3300053730 Bacteria 1419
442 2723843045 2721755755 Bacteria 8322773
443 2876817777 2876808645 Bacteria 8824342
444 2879118061 2879110137 Bacteria 8907982
445 2889033654 2889033259 Bacteria 9099371
446 2922367020 2922361189 Bacteria 7436256
447 2922390200 2922386360 Bacteria 7017218
448 8006966556 8006964411 Bacteria 8966052
449 8006989394 8006984368 Bacteria 9651211
450 8006997869 8006994254 Bacteria 8309700
451 8056695497 8056689827 Bacteria 6712655
452 Ga0207665_10243339
453 JGI25153J46596_10004077
454 rootL2_10053669
455 Ga0070658_10297391
456 Ga0070666_10328050
457 Ga0070666_10452834
458 Ga0070680_100050906
459 Ga0070682_100136274
460 Ga0070682_100332999
461 Ga0068868_100053907
462 Ga0070660_100066999
463 Ga0070660_100483812
464 Ga0070691_10392931
465 Ga0070661_100240547
466 Ga0070661_100727848
467 Ga0070668_100424762
468 Ga0070669_100479086
469 Ga0070675_100770268
470 Ga0070671_100102255
471 Ga0070671_100157178
472 Ga0070671_100217450
473 Ga0070688_100063221
474 Ga0070701_10254024
475 Ga0070700_100220161
476 Ga0070694_100106796
477 Ga0070663_100508412
478 Ga0070678_100033929
479 Ga0070678_100137260
480 Ga0070678_100294056
481 Ga0070678_100302451
482 Ga0070662_100221316
483 Ga0070681_10051506
484 Ga0070685_10155102
485 Ga0070706_100589758
486 Ga0070706_100872523
487 Ga0070679_100073700
488 Ga0070684_100635586
489 Ga0068853_100153536
490 Ga0068853_100203838
491 Ga0068853_100271135
492 Ga0070686_100201027
493 Ga0070693_100077691
494 Ga0070693_100165307
495 Ga0070665_100017212
496 Ga0070665_100064844
497 Ga0070665_100831429
498 Ga0068855_100008500
499 Ga0068855_100064277
500 Ga0068857_100408728
501 Ga0068856_100102134
502 Ga0068856_100269376
503 Ga0068852_100103780
504 Ga0068852_100260535
505 Ga0068852_100421390
506 Ga0068859_100025848
507 Ga0068864_100108510
508 Ga0068861_100690091
509 Ga0068851_10137924
510 Ga0068870_10019559
511 Ga0068858_100616180
512 Ga0068860_100036330
513 Ga0068860_100162554
514 Ga0068862_100576347
515 Ga0081455_10009024
516 Ga0081455_10017754
517 Ga0081455_10030094
518 Ga0081538_10087125
519 Ga0081540_1007732
520 Ga0081540_1008133
521 Ga0081540_1012690
522 Ga0081540_1014117
523 Ga0081540_1031240
524 Ga0081539_10000191
525 Ga0070717_10005130
526 Ga0075365_10095484
527 Ga0075365_10139466
528 Ga0075365_10232860
529 Ga0075368_10039678
530 Ga0075363_100048805
531 Ga0075363_100124999
532 Ga0075364_10115707
533 Ga0075364_10300445
534 Ga0075364_10456828
535 Ga0070716_100287290
536 Ga0070712_100681617
537 Ga0075362_10044367
538 Ga0075362_10060323
539 Ga0075367_10253342
540 Ga0075369_10012585
541 Ga0075369_10033498
542 Ga0075366_10122837
543 Ga0075366_10214392
544 Ga0097621_100181728
545 Ga0075370_10053960
546 Ga0068871_100537971
547 Ga0075428_100104254
548 Ga0075434_100097451
549 Ga0068865_100255590
550 Ga0075436_100512749
551 Ga0097620_100025848
552 Ga0075435_100178399
553 Ga0099794_10086780
554 Ga0099795_10038673
555 Ga0099795_10110325
556 Ga0105251_10129971
557 Ga0105250_10047525
558 Ga0105240_10119387
559 Ga0105240_10804768
560 Ga0111539_10994317
561 Ga0105245_10108049
562 Ga0105247_10058680
563 Ga0105247_10377852
564 Ga0105247_10517470
565 Ga0114129_10240232
566 Ga0105243_10266421
567 Ga0105243_10377923
568 Ga0105241_10255360
569 Ga0105242_10356178
570 Ga0105248_10047100
571 Ga0105248_10078478
572 Ga0105248_10557351
573 Ga0105248_10866388
574 Ga0105237_10082630
575 Ga0105237_10841552
576 Ga0105238_10424690
577 Ga0105238_10891058
578 Ga0105249_10748667
579 Ga0105249_10932440
580 Ga0099796_10014402
581 Ga0099796_10020624
582 Ga0099796_10044686
583 Ga0099796_10048625
584 Ga0105239_10007120
585 Ga0105239_10161914
586 Ga0105239_10487032
587 Ga0105246_10013421
588 Ga0105246_10038604
589 Ga0105246_10348082
590 Ga0105246_10685596
591 Ga0105246_10715506
592 Ga0157370_10113852
593 Ga0157374_10043178
594 Ga0157374_10103315
595 Ga0157374_10265540
596 Ga0157378_11267901
597 Ga0163162_10264274
598 Ga0163162_10356599
599 Ga0163162_10747617
600 Ga0157375_10076483
601 Ga0163163_10181681
602 Ga0163163_10279797
603 Ga0163163_10376919
604 Ga0157380_10486220
605 Ga0157379_10404219
606 Ga0157379_10567196
607 Ga0157379_10993945
608 Ga0157376_10168076
609 Ga0182007_10074425
610 Ga0163161_10615804
611 Ga0209758_1002180
612 Ga0207697_10073831
613 Ga0207642_10136702
614 Ga0207710_10104127
615 Ga0207647_10085687
616 Ga0207643_10062650
617 Ga0207705_10095888
618 Ga0207654_10035557
619 Ga0207654_10332292
620 Ga0207707_10087061
621 Ga0207695_10193546
622 Ga0207695_10781036
623 Ga0207671_10479968
624 Ga0207693_10009898
625 Ga0207660_10044470
626 Ga0207662_10088633
627 Ga0207657_10036288
628 Ga0207646_10449982
629 Ga0207681_10144636
630 Ga0207659_10083593
631 Ga0207687_10044331
632 Ga0207644_10124251
633 Ga0207644_10232232
634 Ga0207706_10032724
635 Ga0207709_10070053
636 Ga0207670_10463797
637 Ga0207704_10092586
638 Ga0207704_10292854
639 Ga0207691_10445710
640 Ga0207711_10068163
641 Ga0207711_10135412
642 Ga0207689_10412813
643 Ga0207679_10894327
644 Ga0207667_10021533
645 Ga0207667_10050800
646 Ga0207651_10433641
647 Ga0207668_10843970
648 Ga0207703_10104780
649 Ga0207639_10183570
650 Ga0207678_10014901
651 Ga0207678_10019008
652 Ga0207678_10029500
653 Ga0207678_10155667
654 Ga0207678_10202950
655 Ga0207708_10071680
656 Ga0207702_10041361
657 Ga0207702_10175121
658 Ga0207702_11093130
659 Ga0207641_10025123
660 Ga0207648_10651465
661 Ga0207676_10418222
662 Ga0207674_10493012
663 Ga0207675_100046630
664 Ga0207683_10034046
665 Ga0207683_10174502
666 Ga0207683_10321050
667 Ga0207698_10083440
668 Ga0207698_10299046
669 Ga0209179_1043058
670 Ga0209813_10054212
671 Ga0268266_10031885
672 Ga0268266_10048964
673 Ga0268265_10176704
674 Ga0268265_10775319
675 Ga0268264_10083749
676 Ga0268264_10226084
677 Ga0307517_10006667
678 Ga0307517_10102407
679 Ga0307515_10043676
680 Ga0307513_10021103
681 Ga0307513_10275993
682 Ga0307509_10423599
683 Ga0307408_100785286
684 Ga0307508_10166914
685 Ga0307516_10006009
686 Ga0307516_10139455
687 Ga0307516_10200411
688 Ga0307516_10250605
689 Ga0307405_10219097
690 Ga0307413_10022807
691 Ga0307406_10663654
692 Ga0307411_10174681
693 Ga0307411_10472655
694 Ga0307415_100167411
695 Ga0307415_100682951
696 Ga0307510_10023861
697 Ga0307510_10046908
698 Ga0373938_0071256
699 Ga0373929_0093655
700 Ga0373936_0004524
701 Ga0373941_0013593
702 Ga0373954_0161220
703 Ga0373943_0003930
704 Ga0373943_0130647
705 Ga0373946_0001903
706 Ga0373955_0014055
707 Ga0373931_0099366
708 Ga0373935_0000721
709 Ga0373927_0002042
710 Ga0373927_0023807
711 Ga0373927_0227269
712 Ga0373933_0000241
713 Ga0373947_0001351
714 Ga0373947_0098771
715 Ga0373925_0000797
716 Ga0439465_0042853
717 Ga0451849_0180358
718 Ga0451849_1134788
719 Ga0495617_047422
720 Ga0495603_0000579
721 Ga0495603_0012573
722 Ga0495603_0110791
723 Ga0495590_0088149
724 Ga0495629_0000341
725 Ga0495641_0004934
726 Ga0495641_0023391
727 Ga0495653_0056425
728 Ga0495650_0048895
729 Ga0495580_0000789
730 Ga0495582_0000459
731 Ga0495582_0173206
732 Ga0495605_0070850
733 Ga0495605_0208796
734 Ga0495639_0000170
735 Ga0495639_0040130
736 Ga0495662_0000762
737 Ga0495662_0058561
738 Ga0495664_0003034
739 Ga0495594_0000325
740 Ga0495594_0017922
741 Ga0495594_0046040
742 Ga0495594_0080301
743 Ga0495596_0117198
744 Ga0495583_0129864
745 Ga0495606_0296692
746 Ga0495616_0117224
747 Ga0495618_0355397
748 Ga0495620_0030393
749 Ga0495620_0167334
750 Ga0495628_0162031
751 Ga0495628_0448633
752 Ga0495630_0001846
753 Ga0495630_0207652
754 Ga0495631_0126171
755 Ga0495632_0336696
756 Ga0495643_0123647
757 Ga0495663_0024858
758 Ga0495666_0067093
759 Ga0495666_0199421
760 Ga0495642_0188662
761 Ga0495665_0000042
762 Ga0495640_0009805
763 Ga0495609_0209286
764 Ga0495597_0091746
765 Ga0495622_0007881
766 Ga0495633_0037322
767 Ga0495667_0174248
768 Ga0495656_0016409
769 Ga0495656_0042661
770 Ga0495668_0112137
771 Ga0495668_0260413
772 Ga0495634_0000249
773 Ga0495611_0094230
774 Ga0495611_0130600
775 Ga0495625_0429710
776 Ga0495635_0000474
777 Ga0495635_0153797
778 Ga0495659_0009566
779 Ga0495661_0113011
780 Ga0495599_0265489
781 Ga0495647_0027939
782 Ga0495658_0003515
783 Ga0495658_0426281
784 Ga0495669_0277928
785 Ga0495613_0001536
786 Ga0495624_0000758
787 Ga0495670_0287158
788 Ga0495649_0418571
789 Ga0495589_0054221
790 Ga0495600_0174397
791 Ga0495581_0000010
792 Ga0495581_0025037
793 Ga0495604_0327947
794 Ga0495674_0000082
795 Ga0495672_0007715
796 Ga0495672_0138178
797 Ga0495677_0052724
798 Ga0495685_024974
799 Ga0495673_0008722
800 Ga0495673_0082029
801 Ga0495673_0139847
802 Ga0495684_0713278
803 Ga0495686_0086026
804 Ga0495686_0208915
805 Ga0495593_0000034
806 Ga0496101_0462971
807 Ga0496102_0069670
808 Ga0496102_0186289
809 Ga0496102_0208161
810 Ga0496102_0234561
811 Ga0496102_0748560
812 Ga0496103_0013317
813 Ga0496103_0149913
814 Ga0496103_0209557
815 Ga0496105_0161313
816 Ga0496106_0383344
817 Ga0496107_0083363
818 Ga0496107_0689037
819 Ga0496108_0311422
820 Ga0496108_0368278
821 Ga0496108_0735138
822 Ga0496109_0076921
823 Ga0496109_0247594
824 Ga0496109_0437078
825 Ga0496110_0049362
826 Ga0496110_0459702
827 Ga0496110_0945265
828 Ga0496110_1093361
829 Ga0496111_0149915
830 Ga0496111_0181971
831 Ga0496111_0490617
832 Ga0496112_0082032
833 Ga0496112_0085394
834 Ga0496112_0153828
835 Ga0496112_0927310
836 Ga0496113_0258408
837 Ga0496114_0223127
838 Ga0496114_0279806
839 Ga0496114_0956724
840 Ga0496115_0006080
841 Ga0496115_0245669
842 Ga0496116_0083948
843 Ga0496117_0335719
844 Ga0496119_0140111
845 Ga0496121_0065418
846 Ga0496121_0065618
847 Ga0496124_0112828
848 Ga0496125_0183421
849 Ga0496126_0033287
850 Ga0495678_086103
851 Ga0501039_0267673
852 nmdc:mga03n38_100338_c1
853 nmdc:mga00v17_109802_c1
854 nmdc:mga00v17_386188_c1
855 nmdc:mga0yw44_86560_c1
856 nmdc:mga0k408_91132_c1
857 nmdc:mga06z11_318175_c1
858 nmdc:mga06z11_32420_c1
859 nmdc:mga06z11_97939_c1
860 nmdc:mga04h51_24187_c1
861 nmdc:mga07m45_29567_c1
862 nmdc:mga07m45_310534_c1
863 nmdc:mga05p37_45620_c1
864 nmdc:mga09592_282877_c1
865 nmdc:mga0n895_247738_c1
866 nmdc:mga0rr50_167805_c1
867 nmdc:mga08x19_408997_c1
868 nmdc:mga0a205_732983_c1
869 nmdc:mga0sz30_201977_c1
870 Ga0495601_0104078
871 Ga0500610_0132219
872 Ga0500610_0193173
873 Ga0500635_0004483
874 Ga0495655_0019353
875 Ga0495619_0057755
876 Ga0500641_0004230
877 Ga0500641_0020927
878 Ga0500650_0122880
879 Ga0500554_040768
880 Ga0500562_032245
881 Ga0500594_0120791
882 Ga0500595_003594
883 Ga0500655_009033
884 Ga0500655_065373
885 Ga0500561_0023392
886 Ga0500589_056870
887 Ga0500603_000076
888 Ga0500622_0168786
889 Ga0500636_0245609
890 Ga0500637_0000672
891 Ga0500637_0114942
892 Ga0500645_038470
893 2723843045
894 2876817777
895 2879118061
896 2889033654
897 2922367020
898 2922390200
899 8006966556
900 8006989394
901 8006997869
902 8056695497

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

21

67

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.798 2 192
4dw6-assembly1.cif.gz_A novel n-phenyl-phenoxyacetamide derivatives as potential ethr inhibitors and ethionamide boosters. discovery and optimization using high-throughput synthesis. 0.7846 2 192
3whc-assembly2.cif.gz_D crystal structure of a transcriptional regulator fadr from bacillus subtilis in complex with stearoyl-coa 0.7833 2 192
5gpc-assembly1.cif.gz_B structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.7816 1 192
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.7804 2 84
ID Description Score Start End Superfamily
5gpaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9701 5 45 1.10.10.60
5gp9B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9681 5 45 1.10.10.60
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9635 3 45 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9627 6 53 1.10.10.60
3whcF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9615 5 45 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A537M4I1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9575 1 166 GO:0000976
GO:0003700
AF-A0A537M4I1-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9462 1 166 GO:0000976
GO:0003700
AF-A0A0R3CTJ4-F1-model_v4 deleted 0.9135 1 218
AF-A0A494XV10-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9126 5 192 GO:0000976
GO:0003700
AF-A0A3G9GB49-F1-model_v4 HTH tetR-type domain-containing protein 0.9072 6 192 GO:0000976
GO:0003700

Map