F446780

General Info

Members Datasets Scaffolds Average Seq Length
451 230 902 393

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10000796|Ga0099796_100007966
Length 464
Sequence VLQRDIIPDRQECLSYQRLLSVVTTCKRVKYKSLLRLGVRDVLEYNACRHTKLKTTLCGEFSAALPTGERMRHVRAVAAPRVVNIEDMRRMARRRLPDAVFDYLDGGAEGEITLRENCRAFEALTFRPRNAIAVPNCDLRTKVLGSELSFPALLAPVGYSRMMHPEGEVAAARGAGAAGLAYILSTISGHKLEDVKAATSGPVWYQLYLIGGRQASEAALERARVAGFSALAVTIDTGTAGMRERDVRNGTAQLMSGNIFGMIPFLGQFFSRPGWLISFLLDGGIHKLPNVIIPGSGPMALIDVAAALATSVVTWKDFEWLRVVWPGPIVVKGVLTAEDARRSIDAGAAGIIVSNHGGRQLDSVSATLRALPEIVKAVDGQIEVLMDGGIRRGSDIVKAICMGARAVLVGRAYAYGLGAAGEAGVHRSVEILRADLLRTMKLLGCTSIADLNESYVNIPKDWLT

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
152 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
226 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 3.1
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 7.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10000796 3300010159 Bacteria 5702
2 Ga0070676_10158706 3300005328 Bacteria 1454
3 Ga0070683_100009967 3300005329 Bacteria 8146
4 Ga0070677_10044011 3300005333 Bacteria 1775
5 Ga0068869_100002269 3300005334 Bacteria 11576
6 Ga0068868_100000900 3300005338 Bacteria 20245
7 Ga0070691_10012980 3300005341 Bacteria 3815
8 Ga0070687_100012617 3300005343 Bacteria 3738
9 Ga0070661_100014999 3300005344 Bacteria 5467
10 Ga0070668_100006859 3300005347 Bacteria 8444
11 Ga0070668_100101595 3300005347 Bacteria 2279
12 Ga0070669_100058591 3300005353 Bacteria 2827
13 Ga0070659_100048005 3300005366 Bacteria 3352
14 Ga0070709_10001867 3300005434 Bacteria 11426
15 Ga0070714_100007419 3300005435 Bacteria 8532
16 Ga0070714_100037943 3300005435 Bacteria 4051
17 Ga0070714_100042329 3300005435 Unclassified 3847
18 Ga0070713_100000693 3300005436 Bacteria 21629
19 Ga0070713_100001068 3300005436 Bacteria 17517
20 Ga0070713_100076558 3300005436 Bacteria 2842
21 Ga0070710_10002957 3300005437 Bacteria 8069
22 Ga0070711_100000181 3300005439 Bacteria 33192
23 Ga0070711_100002936 3300005439 Bacteria 9827
24 Ga0070711_100043735 3300005439 Bacteria 3035
25 Ga0070700_100113272 3300005441 Bacteria 1807
26 Ga0070708_100006662 3300005445 Bacteria 9196
27 Ga0070708_100026865 3300005445 Bacteria 4932
28 Ga0070708_100059815 3300005445 Unclassified 3398
29 Ga0070708_100096904 3300005445 Bacteria 2695
30 Ga0070678_100003370 3300005456 Bacteria 8909
31 Ga0070662_100011297 3300005457 Bacteria 5887
32 Ga0070662_100083347 3300005457 Bacteria 2386
33 Ga0070681_10013937 3300005458 Bacteria 7999
34 Ga0070681_10087005 3300005458 Bacteria 3078
35 Ga0070681_10153341 3300005458 Bacteria 2229
36 Ga0068867_100003034 3300005459 Bacteria 11842
37 Ga0070685_10025769 3300005466 Bacteria 3239
38 Ga0070706_100000149 3300005467 Bacteria 89007
39 Ga0070706_100000797 3300005467 Bacteria 35157
40 Ga0070706_100023240 3300005467 Bacteria 5711
41 Ga0070706_100047921 3300005467 Bacteria 3944
42 Ga0070706_100169203 3300005467 Bacteria 2040
43 Ga0070707_100000063 3300005468 Bacteria 96192
44 Ga0070707_100001075 3300005468 Bacteria 26987
45 Ga0070707_100004261 3300005468 Bacteria 13393
46 Ga0070707_100008007 3300005468 Bacteria 9822
47 Ga0070707_100039059 3300005468 Bacteria 4536
48 Ga0070707_100105034 3300005468 Bacteria 2739
49 Ga0070698_100000038 3300005471 Bacteria 92302
50 Ga0070698_100001579 3300005471 Bacteria 25333
51 Ga0070698_100007433 3300005471 Bacteria 11853
52 Ga0070698_100094926 3300005471 Bacteria 2961
53 Ga0070698_100240847 3300005471 Bacteria 1742
54 Ga0070699_100005703 3300005518 Bacteria 10904
55 Ga0070699_100009237 3300005518 Bacteria 8544
56 Ga0070699_100039182 3300005518 Bacteria 4103
57 Ga0070699_100061016 3300005518 Bacteria 3268
58 Ga0070699_100185268 3300005518 Bacteria 1848
59 Ga0070699_100259556 3300005518 Bacteria 1554
60 Ga0070679_100101222 3300005530 Bacteria 2868
61 Ga0070679_100193343 3300005530 Bacteria 2003
62 Ga0070697_100000166 3300005536 Bacteria 53539
63 Ga0070697_100000636 3300005536 Bacteria 26617
64 Ga0070697_100053913 3300005536 Bacteria 3268
65 Ga0070697_100085798 3300005536 Bacteria 2597
66 Ga0070697_100158930 3300005536 Bacteria 1909
67 Ga0070672_100011456 3300005543 Bacteria 6185
68 Ga0070693_100033177 3300005547 Bacteria 2847
69 Ga0070665_100005694 3300005548 Bacteria 12800
70 Ga0070665_100099680 3300005548 Bacteria 2909
71 Ga0070704_100001122 3300005549 Bacteria 13939
72 Ga0068855_100002722 3300005563 Bacteria 21786
73 Ga0070664_100043757 3300005564 Bacteria 3779
74 Ga0070664_100242509 3300005564 Bacteria 1618
75 Ga0070664_100322709 3300005564 Bacteria 1399
76 Ga0068854_100052255 3300005578 Bacteria 2930
77 Ga0068856_100000423 3300005614 Bacteria 46532
78 Ga0068856_100015308 3300005614 Bacteria 7412
79 Ga0068859_100001084 3300005617 Bacteria 27803
80 Ga0068859_100009390 3300005617 Bacteria 9878
81 Ga0068864_100023526 3300005618 Bacteria 5174
82 Ga0068866_10004443 3300005718 Bacteria 5757
83 Ga0068866_10043039 3300005718 Bacteria 2251
84 Ga0068866_10047778 3300005718 Bacteria 2160
85 Ga0068861_100010517 3300005719 Bacteria 6422
86 Ga0068861_100043862 3300005719 Bacteria 3360
87 Ga0068851_10087316 3300005834 Bacteria 1637
88 Ga0068863_100038167 3300005841 Bacteria 4571
89 Ga0068863_100053877 3300005841 Bacteria 3813
90 Ga0068863_100306759 3300005841 Bacteria 1540
91 Ga0068858_100000072 3300005842 Bacteria 105094
92 Ga0068858_100001931 3300005842 Bacteria 21124
93 Ga0068858_100015240 3300005842 Bacteria 7231
94 Ga0068858_100025407 3300005842 Bacteria 5511
95 Ga0068858_100034524 3300005842 Bacteria 4692
96 Ga0068858_100087532 3300005842 Bacteria 2897
97 Ga0068860_100066446 3300005843 Bacteria 3425
98 Ga0068862_100021295 3300005844 Bacteria 5417
99 Ga0068862_100305339 3300005844 Bacteria 1465
100 Ga0081455_10005519 3300005937 Bacteria 13856
101 Ga0081540_1071209 3300005983 Bacteria 1607
102 Ga0070717_10124506 3300006028 Bacteria 2212
103 Ga0070717_10204068 3300006028 Bacteria 1732
104 Ga0070717_10321480 3300006028 Bacteria 1379
105 Ga0070716_100004502 3300006173 Bacteria 6673
106 Ga0070712_100000401 3300006175 Bacteria 24660
107 Ga0070712_100002619 3300006175 Bacteria 11116
108 Ga0070712_100012337 3300006175 Bacteria 5431
109 Ga0070712_100022783 3300006175 Bacteria 4129
110 Ga0097621_100006226 3300006237 Bacteria 8462
111 Ga0097621_100018798 3300006237 Bacteria 5288
112 Ga0097621_100025295 3300006237 Bacteria 4643
113 Ga0068871_100072160 3300006358 Unclassified 2842
114 Ga0075428_100008302 3300006844 Bacteria 11509
115 Ga0075428_100037413 3300006844 Bacteria 5342
116 Ga0075428_100382212 3300006844 Bacteria 1509
117 Ga0075430_100111121 3300006846 Bacteria 2285
118 Ga0075430_100121013 3300006846 Bacteria 2182
119 Ga0075433_10083127 3300006852 Bacteria 2825
120 Ga0075433_10151850 3300006852 Bacteria 2060
121 Ga0075433_10349415 3300006852 Bacteria 1307
122 Ga0075434_100020036 3300006871 Bacteria 6479
123 Ga0075434_100213970 3300006871 Bacteria 1947
124 Ga0075429_100016583 3300006880 Bacteria 6383
125 Ga0075429_100045136 3300006880 Bacteria 3834
126 Ga0075429_100147303 3300006880 Bacteria 2061
127 Ga0068865_100002557 3300006881 Bacteria 10791
128 Ga0068865_100057397 3300006881 Bacteria 2715
129 Ga0068865_100070730 3300006881 Bacteria 2473
130 Ga0068865_100238244 3300006881 Bacteria 1430
131 Ga0075436_100079040 3300006914 Bacteria 2278
132 Ga0097620_100001083 3300006931 Bacteria 27803
133 Ga0097620_100009391 3300006931 Bacteria 9878
134 Ga0075435_100008907 3300007076 Bacteria 7231
135 Ga0075435_100178434 3300007076 Unclassified 1794
136 Ga0099794_10002799 3300007265 Bacteria 6527
137 Ga0099794_10061713 3300007265 Bacteria 1822
138 Ga0105240_10065599 3300009093 Bacteria 4506
139 Ga0105240_10161865 3300009093 Bacteria 2657
140 Ga0105240_10180864 3300009093 Bacteria 2488
141 Ga0111539_10000122 3300009094 Bacteria 87286
142 Ga0111539_10002594 3300009094 Bacteria 23935
143 Ga0111539_10003335 3300009094 Bacteria 21207
144 Ga0111539_10017330 3300009094 Bacteria 8915
145 Ga0111539_10145244 3300009094 Bacteria 2777
146 Ga0111539_10220336 3300009094 Bacteria 2210
147 Ga0111539_10255880 3300009094 Bacteria 2039
148 Ga0114129_10014604 3300009147 Bacteria 11189
149 Ga0114129_10017991 3300009147 Bacteria 10063
150 Ga0114129_10084517 3300009147 Bacteria 4406
151 Ga0114129_10137791 3300009147 Bacteria 3347
152 Ga0114129_10170901 3300009147 Unclassified 2963
153 Ga0114129_10532590 3300009147 Bacteria 1530
154 Ga0105243_10010401 3300009148 Bacteria 7066
155 Ga0105241_10003417 3300009174 Bacteria 11818
156 Ga0105241_10006243 3300009174 Bacteria 8786
157 Ga0105242_10020433 3300009176 Bacteria 5193
158 Ga0105242_10032590 3300009176 Bacteria 4167
159 Ga0105242_10056365 3300009176 Bacteria 3215
160 Ga0105242_10098489 3300009176 Bacteria 2473
161 Ga0105248_10036807 3300009177 Bacteria 5473
162 Ga0105248_10042157 3300009177 Bacteria 5118
163 Ga0105248_10298412 3300009177 Bacteria 1814
164 Ga0105248_10437408 3300009177 Bacteria 1473
165 Ga0105237_10036248 3300009545 Unclassified 4989
166 Ga0105237_10134676 3300009545 Bacteria 2465
167 Ga0105238_10023938 3300009551 Bacteria 6225
168 Ga0105249_10017545 3300009553 Bacteria 6356
169 Ga0157371_10035318 3300013102 Bacteria 3582
170 Ga0157374_10082610 3300013296 Bacteria 3051
171 Ga0157374_10084312 3300013296 Bacteria 3020
172 Ga0157374_10089604 3300013296 Bacteria 2931
173 Ga0157374_10120625 3300013296 Bacteria 2530
174 Ga0157378_10005799 3300013297 Bacteria 10823
175 Ga0157378_10248693 3300013297 Bacteria 1701
176 Ga0163162_10000643 3300013306 Bacteria 32332
177 Ga0163162_10008663 3300013306 Bacteria 9901
178 Ga0163162_10141983 3300013306 Bacteria 2515
179 Ga0157372_10112927 3300013307 Unclassified 3113
180 Ga0157372_10126260 3300013307 Bacteria 2941
181 Ga0157375_10019096 3300013308 Bacteria 6226
182 Ga0157375_10177209 3300013308 Bacteria 2282
183 Ga0163163_10212071 3300014325 Bacteria 1986
184 Ga0157380_10060243 3300014326 Bacteria 3032
185 Ga0157380_10114938 3300014326 Unclassified 2269
186 Ga0157380_10160061 3300014326 Bacteria 1956
187 Ga0157379_10005943 3300014968 Bacteria 10511
188 Ga0157379_10011889 3300014968 Bacteria 7605
189 Ga0157379_10044820 3300014968 Bacteria 3947
190 Ga0157376_10009307 3300014969 Bacteria 7135
191 Ga0157376_10076984 3300014969 Bacteria 2852
192 Ga0182007_10016434 3300015262 Bacteria 2730
193 Ga0228598_1018729 3300024227 Unclassified 1366
194 Ga0207656_10054900 3300025321 Bacteria 1733
195 Ga0207656_10078618 3300025321 Bacteria 1478
196 Ga0207682_10031345 3300025893 Bacteria 2134
197 Ga0207692_10031932 3300025898 Bacteria 2526
198 Ga0207680_10022255 3300025903 Bacteria 3444
199 Ga0207647_10006065 3300025904 Bacteria 8810
200 Ga0207699_10036777 3300025906 Unclassified 2794
201 Ga0207699_10062123 3300025906 Bacteria 2251
202 Ga0207645_10010083 3300025907 Bacteria 6503
203 Ga0207643_10001752 3300025908 Bacteria 12121
204 Ga0207684_10000119 3300025910 Bacteria 144532
205 Ga0207684_10003887 3300025910 Bacteria 14331
206 Ga0207684_10009138 3300025910 Bacteria 8774
207 Ga0207684_10038155 3300025910 Bacteria 4077
208 Ga0207684_10077280 3300025910 Bacteria 2830
209 Ga0207684_10234270 3300025910 Unclassified 1584
210 Ga0207654_10001886 3300025911 Bacteria 10869
211 Ga0207654_10003930 3300025911 Bacteria 7479
212 Ga0207707_10020348 3300025912 Bacteria 5794
213 Ga0207707_10210619 3300025912 Bacteria 1693
214 Ga0207695_10189558 3300025913 Bacteria 1974
215 Ga0207693_10000125 3300025915 Bacteria 68979
216 Ga0207693_10000215 3300025915 Bacteria 53182
217 Ga0207693_10000411 3300025915 Bacteria 38941
218 Ga0207693_10058044 3300025915 Bacteria 3032
219 Ga0207693_10085541 3300025915 Unclassified 2470
220 Ga0207663_10000917 3300025916 Bacteria 13468
221 Ga0207663_10002363 3300025916 Bacteria 9059
222 Ga0207663_10010647 3300025916 Bacteria 4905
223 Ga0207660_10095592 3300025917 Bacteria 2211
224 Ga0207660_10173393 3300025917 Bacteria 1671
225 Ga0207660_10199393 3300025917 Bacteria 1562
226 Ga0207657_10002189 3300025919 Bacteria 21178
227 Ga0207657_10003609 3300025919 Bacteria 16490
228 Ga0207652_10099850 3300025921 Bacteria 2562
229 Ga0207646_10000052 3300025922 Bacteria 167602
230 Ga0207646_10000321 3300025922 Bacteria 64997
231 Ga0207646_10012075 3300025922 Bacteria 8316
232 Ga0207646_10020541 3300025922 Bacteria 6118
233 Ga0207646_10024435 3300025922 Bacteria 5536
234 Ga0207646_10136423 3300025922 Bacteria 2209
235 Ga0207659_10025939 3300025926 Bacteria 3947
236 Ga0207659_10042416 3300025926 Unclassified 3190
237 Ga0207687_10059551 3300025927 Bacteria 2691
238 Ga0207687_10096559 3300025927 Unclassified 2166
239 Ga0207700_10000256 3300025928 Bacteria 31770
240 Ga0207700_10001787 3300025928 Bacteria 12213
241 Ga0207700_10089199 3300025928 Bacteria 2430
242 Ga0207700_10151694 3300025928 Bacteria 1916
243 Ga0207664_10015645 3300025929 Bacteria 5514
244 Ga0207664_10017806 3300025929 Bacteria 5220
245 Ga0207706_10000102 3300025933 Bacteria 89878
246 Ga0207706_10046751 3300025933 Bacteria 3831
247 Ga0207686_10119226 3300025934 Bacteria 1793
248 Ga0207665_10004107 3300025939 Bacteria 9708
249 Ga0207691_10017127 3300025940 Bacteria 6874
250 Ga0207711_10002678 3300025941 Bacteria 15751
251 Ga0207711_10014895 3300025941 Bacteria 6459
252 Ga0207689_10000728 3300025942 Bacteria 31608
253 Ga0207689_10085686 3300025942 Bacteria 2590
254 Ga0207667_10028794 3300025949 Bacteria 6031
255 Ga0207668_10008833 3300025972 Bacteria 6023
256 Ga0207668_10105509 3300025972 Bacteria 2103
257 Ga0207640_10100514 3300025981 Bacteria 2027
258 Ga0207677_10011220 3300026023 Bacteria 5100
259 Ga0207677_10056168 3300026023 Bacteria 2695
260 Ga0207703_10000016 3300026035 Bacteria 285487
261 Ga0207703_10003241 3300026035 Bacteria 13674
262 Ga0207703_10034745 3300026035 Unclassified 4002
263 Ga0207703_10302917 3300026035 Bacteria 1458
264 Ga0207678_10004393 3300026067 Bacteria 12677
265 Ga0207702_10044800 3300026078 Bacteria 3719
266 Ga0207641_10025464 3300026088 Unclassified 4879
267 Ga0207641_10134084 3300026088 Bacteria 2227
268 Ga0207641_10287228 3300026088 Bacteria 1549
269 Ga0207648_10000819 3300026089 Bacteria 35169
270 Ga0207648_10004319 3300026089 Bacteria 14635
271 Ga0207648_10019602 3300026089 Bacteria 6104
272 Ga0207648_10350580 3300026089 Bacteria 1330
273 Ga0207676_10035203 3300026095 Bacteria 3798
274 Ga0207674_10068522 3300026116 Bacteria 3570
275 Ga0207675_100004144 3300026118 Bacteria 14034
276 Ga0207683_10004192 3300026121 Bacteria 12465
277 Ga0207698_10007440 3300026142 Bacteria 6857
278 Ga0207428_10000033 3300027907 Bacteria 232081
279 Ga0207428_10012273 3300027907 Bacteria 7531
280 Ga0207428_10197027 3300027907 Bacteria 1516
281 Ga0268266_10067555 3300028379 Bacteria 3094
282 Ga0268265_10305119 3300028380 Bacteria 1435
283 Ga0265319_1000541 3300028563 Bacteria 25792
284 Ga0265318_10000360 3300028577 Bacteria 36030
285 Ga0265338_10000787 3300028800 Bacteria 53693
286 Ga0265338_10011795 3300028800 Bacteria 10047
287 Ga0265320_10000136 3300031240 Bacteria 63022
288 Ga0265325_10002951 3300031241 Bacteria 11309
289 Ga0265329_10000040 3300031242 Bacteria 53851
290 Ga0265339_10004439 3300031249 Bacteria 9577
291 Ga0265339_10029638 3300031249 Bacteria 3104
292 Ga0265339_10122692 3300031249 Bacteria 1334
293 Ga0265331_10000021 3300031250 Bacteria 242632
294 Ga0265313_10000320 3300031595 Bacteria 52305
295 Ga0265313_10068325 3300031595 Bacteria 1642
296 Ga0265342_10000032 3300031712 Bacteria 150633
297 Ga0307410_10008231 3300031852 Bacteria 5770
298 Ga0307406_10067036 3300031901 Bacteria 2338
299 Ga0307407_10007601 3300031903 Bacteria 4918
300 Ga0307412_10014785 3300031911 Bacteria 4612
301 Ga0307409_100053908 3300031995 Bacteria 3093
302 Ga0307409_100347619 3300031995 Bacteria 1398
303 Ga0307416_100001773 3300032002 Bacteria 11961
304 Ga0307416_100349711 3300032002 Bacteria 1495
305 Ga0307414_10004966 3300032004 Bacteria 7271
306 Ga0307411_10046629 3300032005 Bacteria 2795
307 Ga0307415_100002170 3300032126 Bacteria 9730
308 Ga0373949_0000525 3300035090 Bacteria 12667
309 Ga0373955_0136086 3300035172 Unclassified 1437
310 Ga0373961_0006716 3300035241 Bacteria 2767
311 Ga0373962_0003456 3300035242 Bacteria 3794
312 Ga0373935_0059188 3300035692 Unclassified 2448
313 Ga0373927_0042923 3300035695 Bacteria 2929
314 Ga0373947_0015212 3300035725 Bacteria 4417
315 Ga0373947_0073660 3300035725 Unclassified 2099
316 Ga0373937_0056895 3300036401 Bacteria 3591
317 Ga0373937_0059807 3300036401 Bacteria 3502
318 Ga0373925_0009336 3300037068 Bacteria 7142
319 Ga0373925_0025646 3300037068 Unclassified 4309
320 Ga0373925_0157306 3300037068 Bacteria 1788
321 Ga0373925_0192327 3300037068 Bacteria 1619
322 Ga0436361_0671371 3300039447 Bacteria 40185
323 Ga0451577_0021534 3300042876 Bacteria 5897
324 Ga0453683_0005170 3300044673 Bacteria 9138
325 Ga0453684_0009160 3300044712 Bacteria 17411
326 Ga0451576_0029314 3300045051 Bacteria 5889
327 Ga0451576_0032782 3300045051 Bacteria 5525
328 Ga0495592_0064555 3300046454 Bacteria 2683
329 Ga0495651_0000153 3300046462 Bacteria 50701
330 Ga0495651_0010587 3300046462 Bacteria 7091
331 Ga0495653_0030875 3300046463 Bacteria 4263
332 Ga0495580_0000027 3300046472 Bacteria 81294
333 Ga0495580_0000247 3300046472 Bacteria 42646
334 Ga0495580_0008044 3300046472 Bacteria 8418
335 Ga0495580_0035576 3300046472 Bacteria 3581
336 Ga0495580_0065264 3300046472 Bacteria 2550
337 Ga0495580_0218753 3300046472 Unclassified 1309
338 Ga0495582_0000997 3300046473 Bacteria 15865
339 Ga0495582_0072721 3300046473 Bacteria 1903
340 Ga0495608_0013056 3300046511 Bacteria 5763
341 Ga0495608_0080596 3300046511 Unclassified 2116
342 Ga0495618_0010185 3300046514 Bacteria 5687
343 Ga0495628_0013582 3300046516 Bacteria 6849
344 Ga0495628_0015431 3300046516 Bacteria 6378
345 Ga0495628_0105830 3300046516 Unclassified 2167
346 Ga0495630_0004179 3300046517 Bacteria 10109
347 Ga0495630_0015552 3300046517 Bacteria 5558
348 Ga0495630_0043257 3300046517 Unclassified 3364
349 Ga0495630_0070613 3300046517 Bacteria 2627
350 Ga0495666_0027110 3300046526 Bacteria 2821
351 Ga0495652_0001272 3300046529 Bacteria 28214
352 Ga0495652_0010885 3300046529 Bacteria 8241
353 Ga0495652_0271669 3300046529 Bacteria 1246
354 Ga0495665_0012641 3300046531 Bacteria 4570
355 Ga0495665_0024276 3300046531 Bacteria 3257
356 Ga0495640_0070642 3300046533 Bacteria 2345
357 Ga0495640_0096712 3300046533 Unclassified 1942
358 Ga0495587_0000844 3300046536 Bacteria 20270
359 Ga0495645_0001686 3300046543 Bacteria 15010
360 Ga0495645_0063446 3300046543 Bacteria 2675
361 Ga0495667_0003877 3300046559 Bacteria 10035
362 Ga0495667_0006339 3300046559 Bacteria 8028
363 Ga0495667_0059064 3300046559 Bacteria 2517
364 Ga0495634_0046331 3300046642 Unclassified 2935
365 Ga0495635_0123689 3300046663 Bacteria 1764
366 Ga0495657_0010217 3300046675 Bacteria 7068
367 Ga0495657_0022290 3300046675 Unclassified 4539
368 Ga0495657_0056709 3300046675 Bacteria 2607
369 Ga0495599_0006811 3300046678 Bacteria 6908
370 Ga0495623_0001205 3300046679 Bacteria 17527
371 Ga0495647_0018195 3300046681 Bacteria 2498
372 Ga0495658_0050288 3300046683 Bacteria 2357
373 Ga0495669_0124415 3300046684 Bacteria 1211
374 Ga0495613_0053265 3300046689 Unclassified 2978
375 Ga0495613_0133225 3300046689 Bacteria 1779
376 Ga0495624_0021029 3300046690 Bacteria 4332
377 Ga0495600_0005377 3300046809 Bacteria 7724
378 Ga0495581_0106960 3300047315 Bacteria 1626
379 Ga0495604_0000323 3300047317 Bacteria 42953
380 Ga0495604_0002137 3300047317 Bacteria 15897
381 Ga0495604_0220115 3300047317 Unclassified 1307
382 Ga0495674_0000882 3300047319 Bacteria 28766
383 Ga0495674_0025738 3300047319 Bacteria 5389
384 Ga0495674_0039424 3300047319 Bacteria 4235
385 Ga0495674_0062750 3300047319 Bacteria 3235
386 Ga0495674_0074180 3300047319 Unclassified 2931
387 Ga0495674_0132088 3300047319 Eukaryota 2103
388 Ga0495674_0165074 3300047319 Bacteria 1851
389 Ga0495680_0000715 3300047322 Bacteria 37324
390 Ga0495680_0009288 3300047322 Bacteria 8859
391 Ga0495680_0133675 3300047322 Bacteria 1820
392 Ga0495680_0247054 3300047322 Bacteria 1266
393 Ga0495675_0005255 3300047444 Bacteria 7884
394 Ga0495675_0017820 3300047444 Unclassified 4503
395 Ga0495675_0142377 3300047444 Eukaryota 1485
396 Ga0495684_0040756 3300047471 Bacteria 3559
397 Ga0495684_0049892 3300047471 Bacteria 3197
398 Ga0495593_0005083 3300047673 Bacteria 7781
399 Ga0495602_0008134 3300048088 Bacteria 10953
400 Ga0496100_0088860 3300048903 Bacteria 2104
401 Ga0496104_0042900 3300048907 Bacteria 4248
402 Ga0496104_0238854 3300048907 Bacteria 1729
403 Ga0496105_0039583 3300048908 Bacteria 3886
404 Ga0496106_0097114 3300048909 Bacteria 2281
405 Ga0496108_0112407 3300048911 Bacteria 2330
406 Ga0496112_0100927 3300048915 Bacteria 2855
407 Ga0496112_0230197 3300048915 Unclassified 1808
408 Ga0496112_0260476 3300048915 Bacteria 1683
409 Ga0496114_0047282 3300048917 Bacteria 3579
410 Ga0496114_0095488 3300048917 Bacteria 2530
411 Ga0496114_0250223 3300048917 Bacteria 1559
412 Ga0496115_0014186 3300048918 Bacteria 6029
413 Ga0496115_0031669 3300048918 Bacteria 4167
414 Ga0501031_0173915 3300049568 Bacteria 1407
415 Ga0501034_0015679 3300049571 Bacteria 7781
416 Ga0501039_0031802 3300049575 Bacteria 4069
417 Ga0501041_0129137 3300049577 Bacteria 1574
418 Ga0501072_0014025 3300049588 Bacteria 6142
419 Ga0501076_0017714 3300049592 Bacteria 5416
420 Ga0501045_0247762 3300049824 Bacteria 1326
421 nmdc:mga05p37_115913_c1 3300050507 Bacteria 3293
422 nmdc:mga05p37_291344_c1 3300050507 Unclassified 1943
423 nmdc:mga05p37_35152_c1 3300050507 Bacteria 6143
424 nmdc:mga05p37_56964_c1 3300050507 Bacteria 4813
425 nmdc:mga05p37_62946_c1 3300050507 Bacteria 4566
426 nmdc:mga09592_139481_c1 3300050508 Bacteria 2089
427 nmdc:mga0qj67_32047_c1 3300050509 Bacteria 4097
428 nmdc:mga06r32_19007_c1 3300050510 Bacteria 6300
429 nmdc:mga06r32_386288_c1 3300050510 Bacteria 1382
430 nmdc:mga06r32_8041_c1 3300050510 Bacteria 9490
431 nmdc:mga08y16_10957_c1 3300050511 Bacteria 9523
432 nmdc:mga08y16_111391_c1 3300050511 Bacteria 2849
433 nmdc:mga08y16_168_c1 3300050511 Bacteria 57276
434 nmdc:mga08y16_3893_c1 3300050511 Bacteria 15540
435 nmdc:mga0n895_160228_c1 3300050512 Bacteria 2282
436 nmdc:mga0n895_62728_c1 3300050512 Unclassified 3674
437 nmdc:mga0rr50_77687_c1 3300050513 Bacteria 2552
438 nmdc:mga0rr50_92245_c1 3300050513 Unclassified 2361
439 nmdc:mga08x19_177469_c1 3300050514 Bacteria 1453
440 nmdc:mga08x19_25287_c1 3300050514 Bacteria 3698
441 nmdc:mga08x19_46250_c1 3300050514 Bacteria 2783
442 nmdc:mga0a205_248167_c1 3300050515 Bacteria 1660
443 nmdc:mga0a205_85783_c1 3300050515 Bacteria 3041
444 Ga0495619_0022590 3300053085 Bacteria 4028
445 Ga0495619_0152920 3300053085 Bacteria 1592
446 Ga0500597_000341 3300053120 Bacteria 9685
447 Ga0500636_0135579 3300053177 Bacteria 1367
448 Ga0590071_000059 3300059421 Bacteria 29361
449 Ga0590074_000081 3300059423 Bacteria 10265
450 Ga0590075_000343 3300059424 Bacteria 12990
451 Ga0590077_000134 3300059426 Bacteria 20027
452 Ga0099796_10000796
453 Ga0070676_10158706
454 Ga0070683_100009967
455 Ga0070677_10044011
456 Ga0068869_100002269
457 Ga0068868_100000900
458 Ga0070691_10012980
459 Ga0070687_100012617
460 Ga0070661_100014999
461 Ga0070668_100006859
462 Ga0070668_100101595
463 Ga0070669_100058591
464 Ga0070659_100048005
465 Ga0070709_10001867
466 Ga0070714_100007419
467 Ga0070714_100037943
468 Ga0070714_100042329
469 Ga0070713_100000693
470 Ga0070713_100001068
471 Ga0070713_100076558
472 Ga0070710_10002957
473 Ga0070711_100000181
474 Ga0070711_100002936
475 Ga0070711_100043735
476 Ga0070700_100113272
477 Ga0070708_100006662
478 Ga0070708_100026865
479 Ga0070708_100059815
480 Ga0070708_100096904
481 Ga0070678_100003370
482 Ga0070662_100011297
483 Ga0070662_100083347
484 Ga0070681_10013937
485 Ga0070681_10087005
486 Ga0070681_10153341
487 Ga0068867_100003034
488 Ga0070685_10025769
489 Ga0070706_100000149
490 Ga0070706_100000797
491 Ga0070706_100023240
492 Ga0070706_100047921
493 Ga0070706_100169203
494 Ga0070707_100000063
495 Ga0070707_100001075
496 Ga0070707_100004261
497 Ga0070707_100008007
498 Ga0070707_100039059
499 Ga0070707_100105034
500 Ga0070698_100000038
501 Ga0070698_100001579
502 Ga0070698_100007433
503 Ga0070698_100094926
504 Ga0070698_100240847
505 Ga0070699_100005703
506 Ga0070699_100009237
507 Ga0070699_100039182
508 Ga0070699_100061016
509 Ga0070699_100185268
510 Ga0070699_100259556
511 Ga0070679_100101222
512 Ga0070679_100193343
513 Ga0070697_100000166
514 Ga0070697_100000636
515 Ga0070697_100053913
516 Ga0070697_100085798
517 Ga0070697_100158930
518 Ga0070672_100011456
519 Ga0070693_100033177
520 Ga0070665_100005694
521 Ga0070665_100099680
522 Ga0070704_100001122
523 Ga0068855_100002722
524 Ga0070664_100043757
525 Ga0070664_100242509
526 Ga0070664_100322709
527 Ga0068854_100052255
528 Ga0068856_100000423
529 Ga0068856_100015308
530 Ga0068859_100001084
531 Ga0068859_100009390
532 Ga0068864_100023526
533 Ga0068866_10004443
534 Ga0068866_10043039
535 Ga0068866_10047778
536 Ga0068861_100010517
537 Ga0068861_100043862
538 Ga0068851_10087316
539 Ga0068863_100038167
540 Ga0068863_100053877
541 Ga0068863_100306759
542 Ga0068858_100000072
543 Ga0068858_100001931
544 Ga0068858_100015240
545 Ga0068858_100025407
546 Ga0068858_100034524
547 Ga0068858_100087532
548 Ga0068860_100066446
549 Ga0068862_100021295
550 Ga0068862_100305339
551 Ga0081455_10005519
552 Ga0081540_1071209
553 Ga0070717_10124506
554 Ga0070717_10204068
555 Ga0070717_10321480
556 Ga0070716_100004502
557 Ga0070712_100000401
558 Ga0070712_100002619
559 Ga0070712_100012337
560 Ga0070712_100022783
561 Ga0097621_100006226
562 Ga0097621_100018798
563 Ga0097621_100025295
564 Ga0068871_100072160
565 Ga0075428_100008302
566 Ga0075428_100037413
567 Ga0075428_100382212
568 Ga0075430_100111121
569 Ga0075430_100121013
570 Ga0075433_10083127
571 Ga0075433_10151850
572 Ga0075433_10349415
573 Ga0075434_100020036
574 Ga0075434_100213970
575 Ga0075429_100016583
576 Ga0075429_100045136
577 Ga0075429_100147303
578 Ga0068865_100002557
579 Ga0068865_100057397
580 Ga0068865_100070730
581 Ga0068865_100238244
582 Ga0075436_100079040
583 Ga0097620_100001083
584 Ga0097620_100009391
585 Ga0075435_100008907
586 Ga0075435_100178434
587 Ga0099794_10002799
588 Ga0099794_10061713
589 Ga0105240_10065599
590 Ga0105240_10161865
591 Ga0105240_10180864
592 Ga0111539_10000122
593 Ga0111539_10002594
594 Ga0111539_10003335
595 Ga0111539_10017330
596 Ga0111539_10145244
597 Ga0111539_10220336
598 Ga0111539_10255880
599 Ga0114129_10014604
600 Ga0114129_10017991
601 Ga0114129_10084517
602 Ga0114129_10137791
603 Ga0114129_10170901
604 Ga0114129_10532590
605 Ga0105243_10010401
606 Ga0105241_10003417
607 Ga0105241_10006243
608 Ga0105242_10020433
609 Ga0105242_10032590
610 Ga0105242_10056365
611 Ga0105242_10098489
612 Ga0105248_10036807
613 Ga0105248_10042157
614 Ga0105248_10298412
615 Ga0105248_10437408
616 Ga0105237_10036248
617 Ga0105237_10134676
618 Ga0105238_10023938
619 Ga0105249_10017545
620 Ga0157371_10035318
621 Ga0157374_10082610
622 Ga0157374_10084312
623 Ga0157374_10089604
624 Ga0157374_10120625
625 Ga0157378_10005799
626 Ga0157378_10248693
627 Ga0163162_10000643
628 Ga0163162_10008663
629 Ga0163162_10141983
630 Ga0157372_10112927
631 Ga0157372_10126260
632 Ga0157375_10019096
633 Ga0157375_10177209
634 Ga0163163_10212071
635 Ga0157380_10060243
636 Ga0157380_10114938
637 Ga0157380_10160061
638 Ga0157379_10005943
639 Ga0157379_10011889
640 Ga0157379_10044820
641 Ga0157376_10009307
642 Ga0157376_10076984
643 Ga0182007_10016434
644 Ga0228598_1018729
645 Ga0207656_10054900
646 Ga0207656_10078618
647 Ga0207682_10031345
648 Ga0207692_10031932
649 Ga0207680_10022255
650 Ga0207647_10006065
651 Ga0207699_10036777
652 Ga0207699_10062123
653 Ga0207645_10010083
654 Ga0207643_10001752
655 Ga0207684_10000119
656 Ga0207684_10003887
657 Ga0207684_10009138
658 Ga0207684_10038155
659 Ga0207684_10077280
660 Ga0207684_10234270
661 Ga0207654_10001886
662 Ga0207654_10003930
663 Ga0207707_10020348
664 Ga0207707_10210619
665 Ga0207695_10189558
666 Ga0207693_10000125
667 Ga0207693_10000215
668 Ga0207693_10000411
669 Ga0207693_10058044
670 Ga0207693_10085541
671 Ga0207663_10000917
672 Ga0207663_10002363
673 Ga0207663_10010647
674 Ga0207660_10095592
675 Ga0207660_10173393
676 Ga0207660_10199393
677 Ga0207657_10002189
678 Ga0207657_10003609
679 Ga0207652_10099850
680 Ga0207646_10000052
681 Ga0207646_10000321
682 Ga0207646_10012075
683 Ga0207646_10020541
684 Ga0207646_10024435
685 Ga0207646_10136423
686 Ga0207659_10025939
687 Ga0207659_10042416
688 Ga0207687_10059551
689 Ga0207687_10096559
690 Ga0207700_10000256
691 Ga0207700_10001787
692 Ga0207700_10089199
693 Ga0207700_10151694
694 Ga0207664_10015645
695 Ga0207664_10017806
696 Ga0207706_10000102
697 Ga0207706_10046751
698 Ga0207686_10119226
699 Ga0207665_10004107
700 Ga0207691_10017127
701 Ga0207711_10002678
702 Ga0207711_10014895
703 Ga0207689_10000728
704 Ga0207689_10085686
705 Ga0207667_10028794
706 Ga0207668_10008833
707 Ga0207668_10105509
708 Ga0207640_10100514
709 Ga0207677_10011220
710 Ga0207677_10056168
711 Ga0207703_10000016
712 Ga0207703_10003241
713 Ga0207703_10034745
714 Ga0207703_10302917
715 Ga0207678_10004393
716 Ga0207702_10044800
717 Ga0207641_10025464
718 Ga0207641_10134084
719 Ga0207641_10287228
720 Ga0207648_10000819
721 Ga0207648_10004319
722 Ga0207648_10019602
723 Ga0207648_10350580
724 Ga0207676_10035203
725 Ga0207674_10068522
726 Ga0207675_100004144
727 Ga0207683_10004192
728 Ga0207698_10007440
729 Ga0207428_10000033
730 Ga0207428_10012273
731 Ga0207428_10197027
732 Ga0268266_10067555
733 Ga0268265_10305119
734 Ga0265319_1000541
735 Ga0265318_10000360
736 Ga0265338_10000787
737 Ga0265338_10011795
738 Ga0265320_10000136
739 Ga0265325_10002951
740 Ga0265329_10000040
741 Ga0265339_10004439
742 Ga0265339_10029638
743 Ga0265339_10122692
744 Ga0265331_10000021
745 Ga0265313_10000320
746 Ga0265313_10068325
747 Ga0265342_10000032
748 Ga0307410_10008231
749 Ga0307406_10067036
750 Ga0307407_10007601
751 Ga0307412_10014785
752 Ga0307409_100053908
753 Ga0307409_100347619
754 Ga0307416_100001773
755 Ga0307416_100349711
756 Ga0307414_10004966
757 Ga0307411_10046629
758 Ga0307415_100002170
759 Ga0373949_0000525
760 Ga0373955_0136086
761 Ga0373961_0006716
762 Ga0373962_0003456
763 Ga0373935_0059188
764 Ga0373927_0042923
765 Ga0373947_0015212
766 Ga0373947_0073660
767 Ga0373937_0056895
768 Ga0373937_0059807
769 Ga0373925_0009336
770 Ga0373925_0025646
771 Ga0373925_0157306
772 Ga0373925_0192327
773 Ga0436361_0671371
774 Ga0451577_0021534
775 Ga0453683_0005170
776 Ga0453684_0009160
777 Ga0451576_0029314
778 Ga0451576_0032782
779 Ga0495592_0064555
780 Ga0495651_0000153
781 Ga0495651_0010587
782 Ga0495653_0030875
783 Ga0495580_0000027
784 Ga0495580_0000247
785 Ga0495580_0008044
786 Ga0495580_0035576
787 Ga0495580_0065264
788 Ga0495580_0218753
789 Ga0495582_0000997
790 Ga0495582_0072721
791 Ga0495608_0013056
792 Ga0495608_0080596
793 Ga0495618_0010185
794 Ga0495628_0013582
795 Ga0495628_0015431
796 Ga0495628_0105830
797 Ga0495630_0004179
798 Ga0495630_0015552
799 Ga0495630_0043257
800 Ga0495630_0070613
801 Ga0495666_0027110
802 Ga0495652_0001272
803 Ga0495652_0010885
804 Ga0495652_0271669
805 Ga0495665_0012641
806 Ga0495665_0024276
807 Ga0495640_0070642
808 Ga0495640_0096712
809 Ga0495587_0000844
810 Ga0495645_0001686
811 Ga0495645_0063446
812 Ga0495667_0003877
813 Ga0495667_0006339
814 Ga0495667_0059064
815 Ga0495634_0046331
816 Ga0495635_0123689
817 Ga0495657_0010217
818 Ga0495657_0022290
819 Ga0495657_0056709
820 Ga0495599_0006811
821 Ga0495623_0001205
822 Ga0495647_0018195
823 Ga0495658_0050288
824 Ga0495669_0124415
825 Ga0495613_0053265
826 Ga0495613_0133225
827 Ga0495624_0021029
828 Ga0495600_0005377
829 Ga0495581_0106960
830 Ga0495604_0000323
831 Ga0495604_0002137
832 Ga0495604_0220115
833 Ga0495674_0000882
834 Ga0495674_0025738
835 Ga0495674_0039424
836 Ga0495674_0062750
837 Ga0495674_0074180
838 Ga0495674_0132088
839 Ga0495674_0165074
840 Ga0495680_0000715
841 Ga0495680_0009288
842 Ga0495680_0133675
843 Ga0495680_0247054
844 Ga0495675_0005255
845 Ga0495675_0017820
846 Ga0495675_0142377
847 Ga0495684_0040756
848 Ga0495684_0049892
849 Ga0495593_0005083
850 Ga0495602_0008134
851 Ga0496100_0088860
852 Ga0496104_0042900
853 Ga0496104_0238854
854 Ga0496105_0039583
855 Ga0496106_0097114
856 Ga0496108_0112407
857 Ga0496112_0100927
858 Ga0496112_0230197
859 Ga0496112_0260476
860 Ga0496114_0047282
861 Ga0496114_0095488
862 Ga0496114_0250223
863 Ga0496115_0014186
864 Ga0496115_0031669
865 Ga0501031_0173915
866 Ga0501034_0015679
867 Ga0501039_0031802
868 Ga0501041_0129137
869 Ga0501072_0014025
870 Ga0501076_0017714
871 Ga0501045_0247762
872 nmdc:mga05p37_115913_c1
873 nmdc:mga05p37_291344_c1
874 nmdc:mga05p37_35152_c1
875 nmdc:mga05p37_56964_c1
876 nmdc:mga05p37_62946_c1
877 nmdc:mga09592_139481_c1
878 nmdc:mga0qj67_32047_c1
879 nmdc:mga06r32_19007_c1
880 nmdc:mga06r32_386288_c1
881 nmdc:mga06r32_8041_c1
882 nmdc:mga08y16_10957_c1
883 nmdc:mga08y16_111391_c1
884 nmdc:mga08y16_168_c1
885 nmdc:mga08y16_3893_c1
886 nmdc:mga0n895_160228_c1
887 nmdc:mga0n895_62728_c1
888 nmdc:mga0rr50_77687_c1
889 nmdc:mga0rr50_92245_c1
890 nmdc:mga08x19_177469_c1
891 nmdc:mga08x19_25287_c1
892 nmdc:mga08x19_46250_c1
893 nmdc:mga0a205_248167_c1
894 nmdc:mga0a205_85783_c1
895 Ga0495619_0022590
896 Ga0495619_0152920
897 Ga0500597_000341
898 Ga0500636_0135579
899 Ga0590071_000059
900 Ga0590074_000081
901 Ga0590075_000343
902 Ga0590077_000134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01070

FMN_dh

FMN-dependent dehydrogenase

92

458

0.96

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

299

429

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bfg-assembly1.cif.gz_A crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase 0.8969 10 372
6w4c-assembly1.cif.gz_A crystal structure of hao1 in complex with indazole acid inhibitor - compound 5 0.8938 8 370
1tb3-assembly3.cif.gz_E crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase 0.8869 10 370
6w4c-assembly1.cif.gz_A crystal structure of hao1 in complex with indazole acid inhibitor - compound 5 0.886 8 370
1tb3-assembly3.cif.gz_D crystal structure analysis of recombinant rat kidney long-chain hydroxy acid oxidase 0.8851 10 370
ID Description Score Start End Superfamily
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9225 10 372 3.20.20.70
af_P33232_3_380_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8853 10 372 3.20.20.70
af_P9WND5_34_407_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8835 10 371 3.20.20.70
3sgzB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8817 10 370 3.20.20.70
af_P9WND7_8_384_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8773 13 372 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q7YV64-F1-model_v4 FMN hydroxy acid dehydrogenase domain-containing protein 0.9803 109 370 GO:0010181
GO:0016491
AF-A0A2V5WKW0-F1-model_v4 Alpha-hydroxy-acid oxidizing protein 0.9768 1 377 GO:0004459
GO:0005886
GO:0009060
GO:0010181
AF-A0A2V5N580-F1-model_v4 FMN hydroxy acid dehydrogenase domain-containing protein 0.9763 141 379 GO:0010181
GO:0016491
AF-A0A2V7X0U9-F1-model_v4 Alpha-hydroxy-acid oxidizing protein 0.9748 20 375 GO:0010181
GO:0016491
AF-A0A2V8EG78-F1-model_v4 Alpha-hydroxy-acid oxidizing protein 0.9701 28 375 GO:0010181
GO:0016491

Map