F446726
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 451 | 231 | 450 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100160246|Ga0070659_1001602462 |
| Length | 292 |
| Sequence | MVGVPLVRARPQCRFKYHRDALAGRDPSGTMLHGKKIAVVMPAYRAAKTLAQCVRAIPPDVVDTTLLVDDGSDDETLAVARELGLATHRHPRNLGYGANQKTCYRAALADGADIVVMLHPDYQYEPRLITAMAGMIASGVYDVVIGSRILGNTALRGGMPLYKYVANRFLTAVQNLAIGSKLSEFHTGYRAFSRRVLAELPLLANSQDFIFDNQMLVQAHAFGLRIGEISCPTKYFEEASEIDFRRSVVYGLGVLRVSAQYRLWRMGIGRPAIFSDAPQLRLPGTPPEALTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 180 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 181 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 190 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 191 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 192 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 197 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 198 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 228 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 229 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.22 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.88 |
| Rhizosphere | 95.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10007484 | 3300001991 | Bacteria | 1895 |
| 2 | rootL2_10103520 | 3300003322 | Bacteria | 3333 |
| 3 | rootH1_10036757 | 3300003323 | Bacteria | 18703 |
| 4 | Ga0065712_10148464 | 3300005290 | Bacteria | 1389 |
| 5 | Ga0065715_10349467 | 3300005293 | Bacteria | 953 |
| 6 | Ga0065707_10106015 | 3300005295 | Bacteria | 2618 |
| 7 | Ga0070676_10049627 | 3300005328 | Bacteria | 2457 |
| 8 | Ga0070683_100005520 | 3300005329 | Bacteria | 10567 |
| 9 | Ga0070683_100021430 | 3300005329 | Bacteria | 5768 |
| 10 | Ga0070690_100021250 | 3300005330 | Bacteria | 3960 |
| 11 | Ga0070670_100077568 | 3300005331 | Bacteria | 2854 |
| 12 | Ga0070677_10033650 | 3300005333 | Bacteria | 1975 |
| 13 | Ga0068869_100016466 | 3300005334 | Bacteria | 4982 |
| 14 | Ga0070666_10025432 | 3300005335 | Bacteria | 3860 |
| 15 | Ga0070666_10050618 | 3300005335 | Bacteria | 2794 |
| 16 | Ga0068868_100097728 | 3300005338 | Bacteria | 2373 |
| 17 | Ga0070660_100000483 | 3300005339 | Bacteria | 26582 |
| 18 | Ga0070660_100120612 | 3300005339 | Bacteria | 2092 |
| 19 | Ga0070660_100519421 | 3300005339 | Bacteria | 992 |
| 20 | Ga0070689_100011771 | 3300005340 | Bacteria | 6276 |
| 21 | Ga0070689_100027011 | 3300005340 | Bacteria | 4326 |
| 22 | Ga0070687_100014609 | 3300005343 | Bacteria | 3530 |
| 23 | Ga0070661_100018125 | 3300005344 | Bacteria | 5003 |
| 24 | Ga0070661_100033659 | 3300005344 | Bacteria | 3713 |
| 25 | Ga0070661_100059967 | 3300005344 | Bacteria | 2792 |
| 26 | Ga0070661_100066162 | 3300005344 | Bacteria | 2655 |
| 27 | Ga0070661_100373026 | 3300005344 | Bacteria | 1123 |
| 28 | Ga0070692_10031581 | 3300005345 | Bacteria | 2656 |
| 29 | Ga0070692_10054275 | 3300005345 | Bacteria | 2092 |
| 30 | Ga0070669_100129175 | 3300005353 | Bacteria | 1936 |
| 31 | Ga0070675_100035179 | 3300005354 | Bacteria | 4068 |
| 32 | Ga0070675_100090951 | 3300005354 | Bacteria | 2556 |
| 33 | Ga0070675_100332901 | 3300005354 | Bacteria | 1343 |
| 34 | Ga0070675_100452752 | 3300005354 | Bacteria | 1151 |
| 35 | Ga0070671_100001539 | 3300005355 | Bacteria | 17332 |
| 36 | Ga0070671_100006349 | 3300005355 | Bacteria | 9432 |
| 37 | Ga0070671_100047697 | 3300005355 | Bacteria | 3561 |
| 38 | Ga0070671_100296473 | 3300005355 | Bacteria | 1376 |
| 39 | Ga0070674_100286207 | 3300005356 | Bacteria | 1308 |
| 40 | Ga0070673_100009292 | 3300005364 | Bacteria | 6596 |
| 41 | Ga0070673_100011373 | 3300005364 | Bacteria | 6072 |
| 42 | Ga0070673_100100648 | 3300005364 | Bacteria | 2380 |
| 43 | Ga0070688_100001676 | 3300005365 | Bacteria | 11084 |
| 44 | Ga0070688_100007052 | 3300005365 | Bacteria | 6045 |
| 45 | Ga0070659_100005159 | 3300005366 | Bacteria | 9366 |
| 46 | Ga0070659_100019023 | 3300005366 | Bacteria | 5193 |
| 47 | Ga0070659_100022296 | 3300005366 | Bacteria | 4833 |
| 48 | Ga0070659_100135699 | 3300005366 | Bacteria | 2001 |
| 49 | Ga0070659_100160246 | 3300005366 | Bacteria | 1839 |
| 50 | Ga0070659_100255171 | 3300005366 | Bacteria | 1454 |
| 51 | Ga0070667_100059119 | 3300005367 | Bacteria | 3242 |
| 52 | Ga0070667_100312218 | 3300005367 | Unclassified | 1417 |
| 53 | Ga0070709_10049545 | 3300005434 | Bacteria | 2627 |
| 54 | Ga0070714_100175902 | 3300005435 | Bacteria | 1945 |
| 55 | Ga0070711_100013374 | 3300005439 | Bacteria | 5155 |
| 56 | Ga0070663_100251615 | 3300005455 | Bacteria | 1398 |
| 57 | Ga0070678_100487723 | 3300005456 | Bacteria | 1085 |
| 58 | Ga0070662_100000180 | 3300005457 | Bacteria | 36959 |
| 59 | Ga0070662_100294075 | 3300005457 | Bacteria | 1317 |
| 60 | Ga0070662_100359988 | 3300005457 | Bacteria | 1194 |
| 61 | Ga0070681_10011292 | 3300005458 | Bacteria | 8836 |
| 62 | Ga0070681_10032422 | 3300005458 | Bacteria | 5243 |
| 63 | Ga0070681_10035460 | 3300005458 | Bacteria | 5011 |
| 64 | Ga0070681_10133685 | 3300005458 | Bacteria | 2412 |
| 65 | Ga0070685_10003791 | 3300005466 | Bacteria | 7646 |
| 66 | Ga0070707_100355490 | 3300005468 | Bacteria | 1423 |
| 67 | Ga0070679_100034494 | 3300005530 | Bacteria | 5015 |
| 68 | Ga0070679_100047639 | 3300005530 | Bacteria | 4271 |
| 69 | Ga0070679_100270465 | 3300005530 | Bacteria | 1653 |
| 70 | Ga0070684_100000955 | 3300005535 | Bacteria | 20577 |
| 71 | Ga0070697_100119943 | 3300005536 | Bacteria | 2199 |
| 72 | Ga0068853_100009357 | 3300005539 | Bacteria | 7899 |
| 73 | Ga0068853_100199527 | 3300005539 | Bacteria | 1820 |
| 74 | Ga0070672_100024146 | 3300005543 | Bacteria | 4488 |
| 75 | Ga0070672_100024480 | 3300005543 | Bacteria | 4463 |
| 76 | Ga0070672_100107041 | 3300005543 | Bacteria | 2275 |
| 77 | Ga0070672_100159074 | 3300005543 | Bacteria | 1873 |
| 78 | Ga0070686_100014903 | 3300005544 | Bacteria | 4489 |
| 79 | Ga0070695_100100000 | 3300005545 | Bacteria | 1951 |
| 80 | Ga0070693_100084634 | 3300005547 | Bacteria | 1899 |
| 81 | Ga0070665_100020075 | 3300005548 | Bacteria | 6709 |
| 82 | Ga0070665_100748084 | 3300005548 | Bacteria | 991 |
| 83 | Ga0070704_100005373 | 3300005549 | Bacteria | 7463 |
| 84 | Ga0068855_100010749 | 3300005563 | Bacteria | 11048 |
| 85 | Ga0068855_100044903 | 3300005563 | Bacteria | 5227 |
| 86 | Ga0068855_100053791 | 3300005563 | Bacteria | 4735 |
| 87 | Ga0068855_100238306 | 3300005563 | Bacteria | 2034 |
| 88 | Ga0068855_100307480 | 3300005563 | Bacteria | 1754 |
| 89 | Ga0068855_100662948 | 3300005563 | Bacteria | 1119 |
| 90 | Ga0068855_100791462 | 3300005563 | Bacteria | 1008 |
| 91 | Ga0070664_100016201 | 3300005564 | Bacteria | 6109 |
| 92 | Ga0070664_100027305 | 3300005564 | Bacteria | 4743 |
| 93 | Ga0070664_100073520 | 3300005564 | Bacteria | 2933 |
| 94 | Ga0070664_100089212 | 3300005564 | Bacteria | 2667 |
| 95 | Ga0070664_100132036 | 3300005564 | Bacteria | 2194 |
| 96 | Ga0068857_100030320 | 3300005577 | Bacteria | 4775 |
| 97 | Ga0068857_100057290 | 3300005577 | Bacteria | 3458 |
| 98 | Ga0068857_100078371 | 3300005577 | Bacteria | 2949 |
| 99 | Ga0068854_100000368 | 3300005578 | Bacteria | 28867 |
| 100 | Ga0068854_100166885 | 3300005578 | Bacteria | 1710 |
| 101 | Ga0068854_100175420 | 3300005578 | Bacteria | 1671 |
| 102 | Ga0068856_100002139 | 3300005614 | Bacteria | 20471 |
| 103 | Ga0068856_100002579 | 3300005614 | Bacteria | 18672 |
| 104 | Ga0068856_100120764 | 3300005614 | Bacteria | 2622 |
| 105 | Ga0068856_100243516 | 3300005614 | Bacteria | 1813 |
| 106 | Ga0068856_100685631 | 3300005614 | Bacteria | 1045 |
| 107 | Ga0068852_100014358 | 3300005616 | Bacteria | 6095 |
| 108 | Ga0068852_100014731 | 3300005616 | Bacteria | 6034 |
| 109 | Ga0068852_100375639 | 3300005616 | Bacteria | 1393 |
| 110 | Ga0068859_100071432 | 3300005617 | Bacteria | 3507 |
| 111 | Ga0068864_100448583 | 3300005618 | Bacteria | 1233 |
| 112 | Ga0068866_10011808 | 3300005718 | Bacteria | 3791 |
| 113 | Ga0068861_100023515 | 3300005719 | Bacteria | 4445 |
| 114 | Ga0068861_100158453 | 3300005719 | Bacteria | 1865 |
| 115 | Ga0068861_100387849 | 3300005719 | Bacteria | 1236 |
| 116 | Ga0068851_10182189 | 3300005834 | Bacteria | 1164 |
| 117 | Ga0068870_10018782 | 3300005840 | Bacteria | 3343 |
| 118 | Ga0068863_100028841 | 3300005841 | Bacteria | 5300 |
| 119 | Ga0068863_100438649 | 3300005841 | Bacteria | 1280 |
| 120 | Ga0068858_100000081 | 3300005842 | Bacteria | 100314 |
| 121 | Ga0068858_100097726 | 3300005842 | Bacteria | 2737 |
| 122 | Ga0068860_100436507 | 3300005843 | Bacteria | 1300 |
| 123 | Ga0068862_100022663 | 3300005844 | Bacteria | 5254 |
| 124 | Ga0068871_100017712 | 3300006358 | Bacteria | 5397 |
| 125 | Ga0075433_10182227 | 3300006852 | Bacteria | 1869 |
| 126 | Ga0075434_100404051 | 3300006871 | Bacteria | 1387 |
| 127 | Ga0068865_100019854 | 3300006881 | Bacteria | 4352 |
| 128 | Ga0068865_100039315 | 3300006881 | Bacteria | 3208 |
| 129 | Ga0075436_100052207 | 3300006914 | Bacteria | 2821 |
| 130 | Ga0097620_100071428 | 3300006931 | Bacteria | 3507 |
| 131 | Ga0075435_100642289 | 3300007076 | Bacteria | 921 |
| 132 | Ga0105240_10365809 | 3300009093 | Bacteria | 1632 |
| 133 | Ga0105240_10383128 | 3300009093 | Bacteria | 1588 |
| 134 | Ga0105240_10599778 | 3300009093 | Bacteria | 1213 |
| 135 | Ga0105245_10054255 | 3300009098 | Bacteria | 3599 |
| 136 | Ga0105245_10057297 | 3300009098 | Bacteria | 3504 |
| 137 | Ga0105245_10329147 | 3300009098 | Bacteria | 1507 |
| 138 | Ga0105243_10292589 | 3300009148 | Bacteria | 1472 |
| 139 | Ga0105241_10005804 | 3300009174 | Bacteria | 9115 |
| 140 | Ga0105242_10029842 | 3300009176 | Bacteria | 4352 |
| 141 | Ga0105242_10042180 | 3300009176 | Bacteria | 3683 |
| 142 | Ga0105248_10000889 | 3300009177 | Bacteria | 33435 |
| 143 | Ga0105248_10004349 | 3300009177 | Bacteria | 15668 |
| 144 | Ga0105237_10087781 | 3300009545 | Bacteria | 3100 |
| 145 | Ga0105238_10163490 | 3300009551 | Bacteria | 2202 |
| 146 | Ga0105249_10046062 | 3300009553 | Bacteria | 3969 |
| 147 | Ga0105239_10058466 | 3300010375 | Bacteria | 4231 |
| 148 | Ga0105246_10066307 | 3300011119 | Bacteria | 2527 |
| 149 | Ga0157373_10012903 | 3300013100 | Bacteria | 6134 |
| 150 | Ga0157371_10000194 | 3300013102 | Bacteria | 90011 |
| 151 | Ga0157370_10003304 | 3300013104 | Bacteria | 19007 |
| 152 | Ga0157370_10043567 | 3300013104 | Bacteria | 4317 |
| 153 | Ga0157370_10089956 | 3300013104 | Bacteria | 2883 |
| 154 | Ga0157370_10316506 | 3300013104 | Unclassified | 1440 |
| 155 | Ga0157370_10332731 | 3300013104 | Bacteria | 1400 |
| 156 | Ga0157369_10167262 | 3300013105 | Bacteria | 2318 |
| 157 | Ga0157369_10201779 | 3300013105 | Bacteria | 2087 |
| 158 | Ga0157374_10362714 | 3300013296 | Bacteria | 1441 |
| 159 | Ga0157378_10041256 | 3300013297 | Bacteria | 4093 |
| 160 | Ga0157378_10079193 | 3300013297 | Bacteria | 2966 |
| 161 | Ga0163162_10161405 | 3300013306 | Bacteria | 2363 |
| 162 | Ga0163162_10162782 | 3300013306 | Bacteria | 2353 |
| 163 | Ga0157372_10002446 | 3300013307 | Bacteria | 20126 |
| 164 | Ga0157372_10009633 | 3300013307 | Bacteria | 10268 |
| 165 | Ga0157372_10033848 | 3300013307 | Bacteria | 5615 |
| 166 | Ga0157372_10071325 | 3300013307 | Bacteria | 3912 |
| 167 | Ga0157372_10101505 | 3300013307 | Bacteria | 3284 |
| 168 | Ga0157372_10117129 | 3300013307 | Bacteria | 3055 |
| 169 | Ga0157372_10217748 | 3300013307 | Bacteria | 2213 |
| 170 | Ga0157375_10023845 | 3300013308 | Bacteria | 5653 |
| 171 | Ga0157375_10096465 | 3300013308 | Bacteria | 3029 |
| 172 | Ga0163163_10108464 | 3300014325 | Bacteria | 2804 |
| 173 | Ga0163163_10148613 | 3300014325 | Bacteria | 2387 |
| 174 | Ga0182008_10044508 | 3300014497 | Bacteria | 2207 |
| 175 | Ga0157377_10008087 | 3300014745 | Bacteria | 5116 |
| 176 | Ga0157377_10119323 | 3300014745 | Bacteria | 1596 |
| 177 | Ga0157379_10000042 | 3300014968 | Bacteria | 77721 |
| 178 | Ga0157376_10176576 | 3300014969 | Bacteria | 1949 |
| 179 | Ga0206356_10503798 | 3300020070 | Bacteria | 3287 |
| 180 | Ga0207697_10001106 | 3300025315 | Bacteria | 14858 |
| 181 | Ga0207656_10045152 | 3300025321 | Bacteria | 1884 |
| 182 | Ga0207656_10133424 | 3300025321 | Bacteria | 1165 |
| 183 | Ga0207656_10160204 | 3300025321 | Bacteria | 1070 |
| 184 | Ga0207682_10001444 | 3300025893 | Bacteria | 10969 |
| 185 | Ga0207642_10007438 | 3300025899 | Bacteria | 3702 |
| 186 | Ga0207688_10071054 | 3300025901 | Bacteria | 1975 |
| 187 | Ga0207680_10051579 | 3300025903 | Bacteria | 2461 |
| 188 | Ga0207699_10064085 | 3300025906 | Bacteria | 2223 |
| 189 | Ga0207645_10010172 | 3300025907 | Bacteria | 6467 |
| 190 | Ga0207643_10002281 | 3300025908 | Bacteria | 10446 |
| 191 | Ga0207643_10010555 | 3300025908 | Bacteria | 4973 |
| 192 | Ga0207705_10032632 | 3300025909 | Bacteria | 3722 |
| 193 | Ga0207654_10040820 | 3300025911 | Bacteria | 2617 |
| 194 | Ga0207707_10056659 | 3300025912 | Bacteria | 3410 |
| 195 | Ga0207707_10070719 | 3300025912 | Bacteria | 3041 |
| 196 | Ga0207707_10118350 | 3300025912 | Bacteria | 2316 |
| 197 | Ga0207707_10213565 | 3300025912 | Bacteria | 1680 |
| 198 | Ga0207695_10054905 | 3300025913 | Bacteria | 4156 |
| 199 | Ga0207695_10682970 | 3300025913 | Bacteria | 907 |
| 200 | Ga0207695_10719110 | 3300025913 | Bacteria | 879 |
| 201 | Ga0207671_10065182 | 3300025914 | Bacteria | 2709 |
| 202 | Ga0207671_10067865 | 3300025914 | Bacteria | 2656 |
| 203 | Ga0207671_10070521 | 3300025914 | Bacteria | 2605 |
| 204 | Ga0207663_10035131 | 3300025916 | Bacteria | 3004 |
| 205 | Ga0207663_10086276 | 3300025916 | Bacteria | 2070 |
| 206 | Ga0207663_10088651 | 3300025916 | Bacteria | 2047 |
| 207 | Ga0207660_10007544 | 3300025917 | Bacteria | 7041 |
| 208 | Ga0207660_10269098 | 3300025917 | Bacteria | 1350 |
| 209 | Ga0207662_10003933 | 3300025918 | Bacteria | 7744 |
| 210 | Ga0207662_10298344 | 3300025918 | Bacteria | 1070 |
| 211 | Ga0207657_10002677 | 3300025919 | Bacteria | 19216 |
| 212 | Ga0207657_10011363 | 3300025919 | Bacteria | 8844 |
| 213 | Ga0207657_10018193 | 3300025919 | Bacteria | 6723 |
| 214 | Ga0207657_10027365 | 3300025919 | Bacteria | 5223 |
| 215 | Ga0207657_10153853 | 3300025919 | Bacteria | 1872 |
| 216 | Ga0207649_10040789 | 3300025920 | Unclassified | 2824 |
| 217 | Ga0207649_10044402 | 3300025920 | Bacteria | 2721 |
| 218 | Ga0207649_10044707 | 3300025920 | Bacteria | 2712 |
| 219 | Ga0207649_10065172 | 3300025920 | Bacteria | 2305 |
| 220 | Ga0207649_10151475 | 3300025920 | Bacteria | 1598 |
| 221 | Ga0207649_10174008 | 3300025920 | Bacteria | 1502 |
| 222 | Ga0207652_10030415 | 3300025921 | Bacteria | 4522 |
| 223 | Ga0207652_10036611 | 3300025921 | Bacteria | 4148 |
| 224 | Ga0207652_10181358 | 3300025921 | Bacteria | 1892 |
| 225 | Ga0207652_10246632 | 3300025921 | Bacteria | 1610 |
| 226 | Ga0207652_10754346 | 3300025921 | Bacteria | 866 |
| 227 | Ga0207681_10057028 | 3300025923 | Unclassified | 2667 |
| 228 | Ga0207681_10150447 | 3300025923 | Bacteria | 1744 |
| 229 | Ga0207694_10060709 | 3300025924 | Bacteria | 2942 |
| 230 | Ga0207694_10078485 | 3300025924 | Bacteria | 2588 |
| 231 | Ga0207650_10015479 | 3300025925 | Bacteria | 5313 |
| 232 | Ga0207659_10015085 | 3300025926 | Bacteria | 4997 |
| 233 | Ga0207659_10035630 | 3300025926 | Bacteria | 3441 |
| 234 | Ga0207659_10042852 | 3300025926 | Bacteria | 3175 |
| 235 | Ga0207659_10065635 | 3300025926 | Bacteria | 2631 |
| 236 | Ga0207687_10134524 | 3300025927 | Bacteria | 1868 |
| 237 | Ga0207687_10419598 | 3300025927 | Bacteria | 1104 |
| 238 | Ga0207664_10017655 | 3300025929 | Bacteria | 5236 |
| 239 | Ga0207664_10027030 | 3300025929 | Bacteria | 4345 |
| 240 | Ga0207644_10000646 | 3300025931 | Bacteria | 22034 |
| 241 | Ga0207644_10012522 | 3300025931 | Bacteria | 5637 |
| 242 | Ga0207644_10099966 | 3300025931 | Bacteria | 2177 |
| 243 | Ga0207690_10000286 | 3300025932 | Bacteria | 35939 |
| 244 | Ga0207690_10044205 | 3300025932 | Bacteria | 2935 |
| 245 | Ga0207690_10135063 | 3300025932 | Bacteria | 1810 |
| 246 | Ga0207690_10199142 | 3300025932 | Bacteria | 1520 |
| 247 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 248 | Ga0207706_10010334 | 3300025933 | Bacteria | 8531 |
| 249 | Ga0207706_10216004 | 3300025933 | Bacteria | 1680 |
| 250 | Ga0207709_10193540 | 3300025935 | Bacteria | 1447 |
| 251 | Ga0207670_10030216 | 3300025936 | Bacteria | 3460 |
| 252 | Ga0207669_10141311 | 3300025937 | Bacteria | 1671 |
| 253 | Ga0207704_10075143 | 3300025938 | Bacteria | 2159 |
| 254 | Ga0207691_10037224 | 3300025940 | Bacteria | 4507 |
| 255 | Ga0207691_10048455 | 3300025940 | Bacteria | 3896 |
| 256 | Ga0207691_10105672 | 3300025940 | Bacteria | 2508 |
| 257 | Ga0207711_10001041 | 3300025941 | Bacteria | 26508 |
| 258 | Ga0207711_10011289 | 3300025941 | Bacteria | 7420 |
| 259 | Ga0207711_10097704 | 3300025941 | Bacteria | 2593 |
| 260 | Ga0207689_10006353 | 3300025942 | Bacteria | 10464 |
| 261 | Ga0207661_10108085 | 3300025944 | Bacteria | 2347 |
| 262 | Ga0207661_10447956 | 3300025944 | Bacteria | 1176 |
| 263 | Ga0207679_10006473 | 3300025945 | Bacteria | 7405 |
| 264 | Ga0207679_10029990 | 3300025945 | Bacteria | 3793 |
| 265 | Ga0207679_10116926 | 3300025945 | Bacteria | 2115 |
| 266 | Ga0207679_10156518 | 3300025945 | Bacteria | 1861 |
| 267 | Ga0207679_10308440 | 3300025945 | Bacteria | 1366 |
| 268 | Ga0207667_10003835 | 3300025949 | Bacteria | 18478 |
| 269 | Ga0207667_10004238 | 3300025949 | Bacteria | 17604 |
| 270 | Ga0207667_10027041 | 3300025949 | Bacteria | 6255 |
| 271 | Ga0207667_10047005 | 3300025949 | Bacteria | 4569 |
| 272 | Ga0207667_10114121 | 3300025949 | Bacteria | 2785 |
| 273 | Ga0207667_10506297 | 3300025949 | Bacteria | 1224 |
| 274 | Ga0207667_10562939 | 3300025949 | Bacteria | 1152 |
| 275 | Ga0207667_10709777 | 3300025949 | Bacteria | 1008 |
| 276 | Ga0207651_10005314 | 3300025960 | Bacteria | 6598 |
| 277 | Ga0207651_10006814 | 3300025960 | Bacteria | 6025 |
| 278 | Ga0207651_10208977 | 3300025960 | Bacteria | 1570 |
| 279 | Ga0207651_10465406 | 3300025960 | Bacteria | 1087 |
| 280 | Ga0207668_10438945 | 3300025972 | Bacteria | 1111 |
| 281 | Ga0207668_10440903 | 3300025972 | Bacteria | 1109 |
| 282 | Ga0207640_10027725 | 3300025981 | Bacteria | 3454 |
| 283 | Ga0207640_10056175 | 3300025981 | Bacteria | 2582 |
| 284 | Ga0207640_10684618 | 3300025981 | Bacteria | 877 |
| 285 | Ga0207658_10083182 | 3300025986 | Bacteria | 2459 |
| 286 | Ga0207658_10101699 | 3300025986 | Bacteria | 2253 |
| 287 | Ga0207677_10120388 | 3300026023 | Bacteria | 1973 |
| 288 | Ga0207703_10000089 | 3300026035 | Bacteria | 105959 |
| 289 | Ga0207703_10012794 | 3300026035 | Bacteria | 6542 |
| 290 | Ga0207639_10020373 | 3300026041 | Bacteria | 4747 |
| 291 | Ga0207639_10138581 | 3300026041 | Bacteria | 2024 |
| 292 | Ga0207639_10193379 | 3300026041 | Bacteria | 1739 |
| 293 | Ga0207639_10232948 | 3300026041 | Bacteria | 1597 |
| 294 | Ga0207678_10002599 | 3300026067 | Bacteria | 16446 |
| 295 | Ga0207678_10118206 | 3300026067 | Bacteria | 2262 |
| 296 | Ga0207708_10004967 | 3300026075 | Bacteria | 9795 |
| 297 | Ga0207702_10001927 | 3300026078 | Bacteria | 20279 |
| 298 | Ga0207702_10047555 | 3300026078 | Bacteria | 3616 |
| 299 | Ga0207702_10207864 | 3300026078 | Bacteria | 1818 |
| 300 | Ga0207702_10620914 | 3300026078 | Bacteria | 1061 |
| 301 | Ga0207641_10577652 | 3300026088 | Bacteria | 1098 |
| 302 | Ga0207648_10015340 | 3300026089 | Bacteria | 7050 |
| 303 | Ga0207648_10030561 | 3300026089 | Bacteria | 4768 |
| 304 | Ga0207676_10113278 | 3300026095 | Bacteria | 2273 |
| 305 | Ga0207674_10000237 | 3300026116 | Bacteria | 68721 |
| 306 | Ga0207674_10009051 | 3300026116 | Bacteria | 11437 |
| 307 | Ga0207674_10010316 | 3300026116 | Bacteria | 10597 |
| 308 | Ga0207674_10084531 | 3300026116 | Bacteria | 3171 |
| 309 | Ga0207674_10121050 | 3300026116 | Bacteria | 2585 |
| 310 | Ga0207674_10275865 | 3300026116 | Bacteria | 1629 |
| 311 | Ga0207674_10315807 | 3300026116 | Bacteria | 1512 |
| 312 | Ga0207675_100000626 | 3300026118 | Bacteria | 34619 |
| 313 | Ga0207675_100047665 | 3300026118 | Bacteria | 4000 |
| 314 | Ga0207675_100058830 | 3300026118 | Bacteria | 3586 |
| 315 | Ga0207683_10050890 | 3300026121 | Bacteria | 3629 |
| 316 | Ga0207698_10022593 | 3300026142 | Bacteria | 4375 |
| 317 | Ga0207698_10051469 | 3300026142 | Bacteria | 3149 |
| 318 | Ga0209999_1008422 | 3300027543 | Bacteria | 1858 |
| 319 | Ga0209982_1005689 | 3300027552 | Bacteria | 1802 |
| 320 | Ga0209971_1004719 | 3300027682 | Bacteria | 3233 |
| 321 | Ga0209974_10000775 | 3300027876 | Bacteria | 10872 |
| 322 | Ga0209974_10007997 | 3300027876 | Bacteria | 3623 |
| 323 | Ga0207428_10238290 | 3300027907 | Bacteria | 1360 |
| 324 | Ga0268266_10408619 | 3300028379 | Bacteria | 1285 |
| 325 | Ga0265326_10001833 | 3300028558 | Bacteria | 7298 |
| 326 | Ga0265334_10003910 | 3300028573 | Bacteria | 6710 |
| 327 | Ga0265334_10003957 | 3300028573 | Bacteria | 6667 |
| 328 | Ga0265338_10009757 | 3300028800 | Bacteria | 11386 |
| 329 | Ga0265338_10286307 | 3300028800 | Bacteria | 1202 |
| 330 | Ga0307509_10103487 | 3300031507 | Bacteria | 2875 |
| 331 | Ga0265314_10121576 | 3300031711 | Bacteria | 1643 |
| 332 | Ga0307516_10027474 | 3300031730 | Bacteria | 5769 |
| 333 | Ga0307405_10001108 | 3300031731 | Bacteria | 11023 |
| 334 | Ga0307413_10000680 | 3300031824 | Bacteria | 11582 |
| 335 | Ga0307410_10001273 | 3300031852 | Bacteria | 11210 |
| 336 | Ga0307412_10183640 | 3300031911 | Bacteria | 1575 |
| 337 | Ga0307409_100002727 | 3300031995 | Bacteria | 9327 |
| 338 | Ga0307415_100005995 | 3300032126 | Bacteria | 6513 |
| 339 | Ga0373946_0147859 | 3300035171 | Bacteria | 1094 |
| 340 | Ga0373931_0252699 | 3300035691 | Bacteria | 1072 |
| 341 | Ga0373927_0138661 | 3300035695 | Bacteria | 1590 |
| 342 | Ga0373947_0422955 | 3300035725 | Bacteria | 900 |
| 343 | Ga0316584_0337873 | 3300036712 | Unclassified | 1083 |
| 344 | Ga0395898_0221671 | 3300037466 | Bacteria | 1804 |
| 345 | Ga0395905_0043353 | 3300037471 | Bacteria | 4221 |
| 346 | Ga0395901_0064899 | 3300038443 | Bacteria | 3801 |
| 347 | Ga0451853_1345624 | 3300041512 | Bacteria | 986 |
| 348 | Ga0451577_0000121 | 3300042876 | Bacteria | 172135 |
| 349 | Ga0451577_0005336 | 3300042876 | Bacteria | 13203 |
| 350 | Ga0451577_0024334 | 3300042876 | Bacteria | 5510 |
| 351 | Ga0453683_0012065 | 3300044673 | Bacteria | 5675 |
| 352 | Ga0453683_0257381 | 3300044673 | Bacteria | 1113 |
| 353 | Ga0466963_0190395 | 3300044694 | Bacteria | 1433 |
| 354 | Ga0453684_0000227 | 3300044712 | Bacteria | 244655 |
| 355 | Ga0453684_0010500 | 3300044712 | Bacteria | 15820 |
| 356 | Ga0453684_0011206 | 3300044712 | Bacteria | 15095 |
| 357 | Ga0453684_0030741 | 3300044712 | Bacteria | 7576 |
| 358 | Ga0453684_0056209 | 3300044712 | Bacteria | 5106 |
| 359 | Ga0453684_0283149 | 3300044712 | Bacteria | 1890 |
| 360 | Ga0451576_0003888 | 3300045051 | Bacteria | 19997 |
| 361 | Ga0451576_0224594 | 3300045051 | Bacteria | 1961 |
| 362 | Ga0466967_0239918 | 3300045976 | Bacteria | 1729 |
| 363 | Ga0495580_0170507 | 3300046472 | Bacteria | 1505 |
| 364 | Ga0495598_0135829 | 3300046537 | Bacteria | 847 |
| 365 | Ga0496101_0063504 | 3300048904 | Unclassified | 2688 |
| 366 | Ga0496101_0387542 | 3300048904 | Bacteria | 1100 |
| 367 | Ga0496104_0143938 | 3300048907 | Bacteria | 2289 |
| 368 | Ga0496105_0012283 | 3300048908 | Bacteria | 6781 |
| 369 | Ga0496106_0000779 | 3300048909 | Bacteria | 23016 |
| 370 | Ga0496106_0053196 | 3300048909 | Bacteria | 3057 |
| 371 | Ga0496107_0027118 | 3300048910 | Bacteria | 4067 |
| 372 | Ga0496108_0008085 | 3300048911 | Bacteria | 8533 |
| 373 | Ga0496109_0004103 | 3300048912 | Bacteria | 12173 |
| 374 | Ga0496109_0409053 | 3300048912 | Bacteria | 1282 |
| 375 | Ga0496110_0010969 | 3300048913 | Bacteria | 7393 |
| 376 | Ga0496110_0192675 | 3300048913 | Unclassified | 1851 |
| 377 | Ga0496114_0164085 | 3300048917 | Bacteria | 1933 |
| 378 | Ga0496118_0043741 | 3300048921 | Bacteria | 3516 |
| 379 | Ga0501031_0183522 | 3300049568 | Bacteria | 1366 |
| 380 | Ga0501032_0007054 | 3300049569 | Bacteria | 8244 |
| 381 | Ga0501032_0019576 | 3300049569 | Bacteria | 4733 |
| 382 | Ga0501032_0169389 | 3300049569 | Bacteria | 1432 |
| 383 | Ga0501033_0000253 | 3300049570 | Bacteria | 51648 |
| 384 | Ga0501033_0012037 | 3300049570 | Bacteria | 6604 |
| 385 | Ga0501034_0001222 | 3300049571 | Bacteria | 35142 |
| 386 | Ga0501034_0014473 | 3300049571 | Bacteria | 8123 |
| 387 | Ga0501034_0156346 | 3300049571 | Bacteria | 2253 |
| 388 | Ga0501036_0001687 | 3300049572 | Bacteria | 17142 |
| 389 | Ga0501036_0036253 | 3300049572 | Bacteria | 4173 |
| 390 | Ga0501037_0003126 | 3300049573 | Bacteria | 12006 |
| 391 | Ga0501037_0167685 | 3300049573 | Bacteria | 1562 |
| 392 | Ga0501037_0295792 | 3300049573 | Bacteria | 1125 |
| 393 | Ga0501038_0007353 | 3300049574 | Bacteria | 10161 |
| 394 | Ga0501038_0047245 | 3300049574 | Bacteria | 3729 |
| 395 | Ga0501039_0005731 | 3300049575 | Bacteria | 9408 |
| 396 | Ga0501039_0047435 | 3300049575 | Bacteria | 3320 |
| 397 | Ga0501040_0100961 | 3300049576 | Bacteria | 2012 |
| 398 | Ga0501043_0045794 | 3300049579 | Bacteria | 3439 |
| 399 | Ga0501043_0060821 | 3300049579 | Bacteria | 2965 |
| 400 | Ga0501046_0026708 | 3300049580 | Bacteria | 4715 |
| 401 | Ga0501046_0109597 | 3300049580 | Bacteria | 2110 |
| 402 | Ga0501047_0000238 | 3300049581 | Bacteria | 65182 |
| 403 | Ga0501047_0026549 | 3300049581 | Bacteria | 5572 |
| 404 | Ga0501047_0046190 | 3300049581 | Bacteria | 4208 |
| 405 | Ga0501067_0000055 | 3300049583 | Bacteria | 66700 |
| 406 | Ga0501067_0006731 | 3300049583 | Bacteria | 6375 |
| 407 | Ga0501068_0002026 | 3300049584 | Bacteria | 10787 |
| 408 | Ga0501068_0002629 | 3300049584 | Bacteria | 9514 |
| 409 | Ga0501069_0004152 | 3300049585 | Bacteria | 7482 |
| 410 | Ga0501069_0004184 | 3300049585 | Bacteria | 7458 |
| 411 | Ga0501070_0005863 | 3300049586 | Bacteria | 10473 |
| 412 | Ga0501070_0053105 | 3300049586 | Bacteria | 3362 |
| 413 | Ga0501070_0263679 | 3300049586 | Bacteria | 1408 |
| 414 | Ga0501071_0004253 | 3300049587 | Bacteria | 9068 |
| 415 | Ga0501072_0012242 | 3300049588 | Bacteria | 6555 |
| 416 | Ga0501073_0000072 | 3300049589 | Bacteria | 62953 |
| 417 | Ga0501073_0070075 | 3300049589 | Bacteria | 2443 |
| 418 | Ga0501073_0108741 | 3300049589 | Bacteria | 1924 |
| 419 | Ga0501073_0111153 | 3300049589 | Bacteria | 1900 |
| 420 | Ga0501073_0220355 | 3300049589 | Bacteria | 1310 |
| 421 | Ga0501074_0003782 | 3300049590 | Bacteria | 10752 |
| 422 | Ga0501074_0007967 | 3300049590 | Bacteria | 7673 |
| 423 | Ga0501074_0025965 | 3300049590 | Bacteria | 4248 |
| 424 | Ga0501076_0070586 | 3300049592 | Bacteria | 2793 |
| 425 | Ga0501077_0096100 | 3300049593 | Bacteria | 1878 |
| 426 | Ga0501079_0013054 | 3300049741 | Bacteria | 6336 |
| 427 | Ga0501079_0026009 | 3300049741 | Bacteria | 4488 |
| 428 | Ga0501080_0000097 | 3300049742 | Bacteria | 59356 |
| 429 | Ga0501080_0024614 | 3300049742 | Bacteria | 5582 |
| 430 | Ga0501080_0028762 | 3300049742 | Bacteria | 5174 |
| 431 | Ga0501080_0110707 | 3300049742 | Bacteria | 2545 |
| 432 | Ga0501080_0283956 | 3300049742 | Bacteria | 1504 |
| 433 | Ga0501081_0012136 | 3300049743 | Bacteria | 5650 |
| 434 | Ga0501083_0000128 | 3300049744 | Bacteria | 51820 |
| 435 | Ga0501035_0010585 | 3300049822 | Bacteria | 8542 |
| 436 | Ga0501035_0123293 | 3300049822 | Bacteria | 2263 |
| 437 | Ga0501044_0004361 | 3300049823 | Bacteria | 15845 |
| 438 | Ga0501044_0005237 | 3300049823 | Bacteria | 14426 |
| 439 | Ga0501044_0005861 | 3300049823 | Bacteria | 13610 |
| 440 | Ga0501044_0017680 | 3300049823 | Bacteria | 7647 |
| 441 | Ga0501044_0090744 | 3300049823 | Bacteria | 3082 |
| 442 | Ga0501044_0091891 | 3300049823 | Bacteria | 3061 |
| 443 | Ga0501045_0006433 | 3300049824 | Bacteria | 8136 |
| 444 | nmdc:mga08y16_55101_c1 | 3300050511 | Bacteria | 4156 |
| 445 | nmdc:mga0n895_167712_c1 | 3300050512 | Bacteria | 2227 |
| 446 | nmdc:mga0n895_923825_c1 | 3300050512 | Bacteria | 857 |
| 447 | Ga0501084_0034902 | 3300054114 | Bacteria | 4206 |
| 448 | Ga0501082_0066481 | 3300060353 | Bacteria | 3105 |
| 449 | Ga0530510_0014611 | 3300061734 | Bacteria | 5541 |
| 450 | Ga0530510_0205312 | 3300061734 | Bacteria | 1464 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028573 | Ga0265334_10003957 | Ga0265334_100039574 | 225 |
| 2 | 3300009093 | Ga0105240_10365809 | Ga0105240_103658093 | 227 |
| 3 | 3300025913 | Ga0207695_10682970 | Ga0207695_106829702 | 227 |
| 4 | 3300025914 | Ga0207671_10065182 | Ga0207671_100651822 | 227 |
| 5 | 3300031507 | Ga0307509_10103487 | Ga0307509_101034874 | 232 |
| 6 | 3300028573 | Ga0265334_10003910 | Ga0265334_100039104 | 233 |
| 7 | 3300028800 | Ga0265338_10009757 | Ga0265338_100097575 | 233 |
| 8 | 3300005354 | Ga0070675_100452752 | Ga0070675_1004527521 | 236 |
| 9 | 3300005295 | Ga0065707_10106015 | Ga0065707_101060154 | 237 |
| 10 | 3300005842 | Ga0068858_100000081 | Ga0068858_10000008194 | 237 |
| 11 | 3300009177 | Ga0105248_10000889 | Ga0105248_1000088932 | 237 |
| 12 | 3300014325 | Ga0163163_10148613 | Ga0163163_101486133 | 237 |
| 13 | 3300014968 | Ga0157379_10000042 | Ga0157379_100000423 | 237 |
| 14 | 3300025941 | Ga0207711_10001041 | Ga0207711_1000104125 | 237 |
| 15 | 3300026035 | Ga0207703_10000089 | Ga0207703_1000008934 | 237 |
| 16 | 3300044673 | Ga0453683_0012065 | Ga0453683_0012065_4141_4884 | 237 |
| 17 | 3300045051 | Ga0451576_0003888 | Ga0451576_0003888_3388_4131 | 237 |
| 18 | 3300028800 | Ga0265338_10286307 | Ga0265338_102863072 | 238 |
| 19 | 3300037471 | Ga0395905_0043353 | Ga0395905_0043353_1485_2240 | 238 |
| 20 | iso_pu_bacteria | 2574179768 | 2574431601 | 239 |
| 21 | 3300048921 | Ga0496118_0043741 | Ga0496118_0043741_2229_2993 | 240 |
| 22 | 3300025918 | Ga0207662_10298344 | Ga0207662_102983442 | 241 |
| 23 | 3300025921 | Ga0207652_10246632 | Ga0207652_102466322 | 241 |
| 24 | 3300003322 | rootL2_10103520 | rootL2_101035202 | 242 |
| 25 | 3300003323 | rootH1_10036757 | rootH1_100367575 | 242 |
| 26 | 3300005344 | Ga0070661_100033659 | Ga0070661_1000336596 | 243 |
| 27 | 3300009093 | Ga0105240_10599778 | Ga0105240_105997782 | 243 |
| 28 | 3300025924 | Ga0207694_10060709 | Ga0207694_100607091 | 243 |
| 29 | 3300036712 | Ga0316584_0337873 | Ga0316584_0337873_194_982 | 243 |
| 30 | 3300042876 | Ga0451577_0005336 | Ga0451577_0005336_7750_8514 | 243 |
| 31 | 3300044712 | Ga0453684_0056209 | Ga0453684_0056209_1322_2086 | 243 |
| 32 | 3300049742 | Ga0501080_0024614 | Ga0501080_0024614_1807_2577 | 243 |
| 33 | 3300006914 | Ga0075436_100052207 | Ga0075436_1000522072 | 244 |
| 34 | 3300025916 | Ga0207663_10035131 | Ga0207663_100351312 | 244 |
| 35 | 3300005435 | Ga0070714_100175902 | Ga0070714_1001759022 | 245 |
| 36 | 3300005458 | Ga0070681_10032422 | Ga0070681_100324223 | 245 |
| 37 | 3300005614 | Ga0068856_100685631 | Ga0068856_1006856311 | 245 |
| 38 | 3300013104 | Ga0157370_10003304 | Ga0157370_1000330415 | 245 |
| 39 | 3300013104 | Ga0157370_10332731 | Ga0157370_103327312 | 245 |
| 40 | 3300025917 | Ga0207660_10269098 | Ga0207660_102690981 | 245 |
| 41 | 3300025949 | Ga0207667_10047005 | Ga0207667_100470053 | 245 |
| 42 | 3300025981 | Ga0207640_10684618 | Ga0207640_106846182 | 245 |
| 43 | 3300026078 | Ga0207702_10620914 | Ga0207702_106209142 | 245 |
| 44 | 3300028558 | Ga0265326_10001833 | Ga0265326_100018331 | 245 |
| 45 | 3300031711 | Ga0265314_10121576 | Ga0265314_101215761 | 245 |
| 46 | 3300050512 | nmdc:mga0n895_923825_c1 | nmdc:mga0n895_923825_c1_59_826 | 245 |
| 47 | 3300042876 | Ga0451577_0024334 | Ga0451577_0024334_3684_4454 | 246 |
| 48 | 3300044712 | Ga0453684_0030741 | Ga0453684_0030741_6416_7186 | 246 |
| 49 | 3300044712 | Ga0453684_0283149 | Ga0453684_0283149_382_1152 | 246 |
| 50 | 3300061734 | Ga0530510_0014611 | Ga0530510_0014611_1635_2375 | 246 |
| 51 | 3300009176 | Ga0105242_10042180 | Ga0105242_100421805 | 249 |
| 52 | 3300013297 | Ga0157378_10079193 | Ga0157378_100791933 | 249 |
| 53 | 3300044712 | Ga0453684_0011206 | Ga0453684_0011206_3969_4748 | 249 |
| 54 | 3300005344 | Ga0070661_100066162 | Ga0070661_1000661622 | 250 |
| 55 | 3300005344 | Ga0070661_100373026 | Ga0070661_1003730262 | 250 |
| 56 | 3300005434 | Ga0070709_10049545 | Ga0070709_100495453 | 250 |
| 57 | 3300005439 | Ga0070711_100013374 | Ga0070711_1000133744 | 250 |
| 58 | 3300005458 | Ga0070681_10035460 | Ga0070681_100354602 | 250 |
| 59 | 3300005530 | Ga0070679_100047639 | Ga0070679_1000476392 | 250 |
| 60 | 3300005539 | Ga0068853_100199527 | Ga0068853_1001995273 | 250 |
| 61 | 3300005563 | Ga0068855_100307480 | Ga0068855_1003074802 | 250 |
| 62 | 3300005577 | Ga0068857_100057290 | Ga0068857_1000572902 | 250 |
| 63 | 3300005614 | Ga0068856_100243516 | Ga0068856_1002435162 | 250 |
| 64 | 3300005616 | Ga0068852_100375639 | Ga0068852_1003756392 | 250 |
| 65 | 3300005618 | Ga0068864_100448583 | Ga0068864_1004485831 | 250 |
| 66 | 3300005841 | Ga0068863_100438649 | Ga0068863_1004386492 | 250 |
| 67 | 3300006358 | Ga0068871_100017712 | Ga0068871_1000177123 | 250 |
| 68 | 3300006871 | Ga0075434_100404051 | Ga0075434_1004040511 | 250 |
| 69 | 3300006881 | Ga0068865_100019854 | Ga0068865_1000198543 | 250 |
| 70 | 3300009098 | Ga0105245_10054255 | Ga0105245_100542553 | 250 |
| 71 | 3300013105 | Ga0157369_10167262 | Ga0157369_101672623 | 250 |
| 72 | 3300013296 | Ga0157374_10362714 | Ga0157374_103627142 | 250 |
| 73 | 3300013306 | Ga0163162_10162782 | Ga0163162_101627825 | 250 |
| 74 | 3300013308 | Ga0157375_10023845 | Ga0157375_100238459 | 250 |
| 75 | 3300014969 | Ga0157376_10176576 | Ga0157376_101765762 | 250 |
| 76 | 3300025321 | Ga0207656_10160204 | Ga0207656_101602041 | 250 |
| 77 | 3300025912 | Ga0207707_10213565 | Ga0207707_102135652 | 250 |
| 78 | 3300025916 | Ga0207663_10088651 | Ga0207663_100886512 | 250 |
| 79 | 3300025920 | Ga0207649_10044707 | Ga0207649_100447072 | 250 |
| 80 | 3300025920 | Ga0207649_10174008 | Ga0207649_101740082 | 250 |
| 81 | 3300025921 | Ga0207652_10181358 | Ga0207652_101813582 | 250 |
| 82 | 3300025944 | Ga0207661_10447956 | Ga0207661_104479562 | 250 |
| 83 | 3300026023 | Ga0207677_10120388 | Ga0207677_101203882 | 250 |
| 84 | 3300026041 | Ga0207639_10193379 | Ga0207639_101933792 | 250 |
| 85 | 3300026088 | Ga0207641_10577652 | Ga0207641_105776522 | 250 |
| 86 | 3300026089 | Ga0207648_10015340 | Ga0207648_100153403 | 250 |
| 87 | 3300026116 | Ga0207674_10121050 | Ga0207674_101210502 | 250 |
| 88 | 3300049569 | Ga0501032_0169389 | Ga0501032_0169389_211_993 | 250 |
| 89 | 3300049571 | Ga0501034_0001222 | Ga0501034_0001222_5007_5789 | 250 |
| 90 | 3300049573 | Ga0501037_0295792 | Ga0501037_0295792_262_1044 | 250 |
| 91 | 3300049574 | Ga0501038_0047245 | Ga0501038_0047245_770_1552 | 250 |
| 92 | 3300049581 | Ga0501047_0000238 | Ga0501047_0000238_28017_28799 | 250 |
| 93 | 3300049583 | Ga0501067_0000055 | Ga0501067_0000055_36169_36951 | 250 |
| 94 | 3300049584 | Ga0501068_0002629 | Ga0501068_0002629_2669_3451 | 250 |
| 95 | 3300049585 | Ga0501069_0004152 | Ga0501069_0004152_61_843 | 250 |
| 96 | 3300049586 | Ga0501070_0005863 | Ga0501070_0005863_8967_9749 | 250 |
| 97 | 3300049588 | Ga0501072_0012242 | Ga0501072_0012242_3447_4229 | 250 |
| 98 | 3300049589 | Ga0501073_0000072 | Ga0501073_0000072_49578_50360 | 250 |
| 99 | 3300049589 | Ga0501073_0108741 | Ga0501073_0108741_12_803 | 250 |
| 100 | 3300049590 | Ga0501074_0025965 | Ga0501074_0025965_437_1219 | 250 |
| 101 | 3300049741 | Ga0501079_0026009 | Ga0501079_0026009_3216_3998 | 250 |
| 102 | 3300049742 | Ga0501080_0000097 | Ga0501080_0000097_45307_46089 | 250 |
| 103 | 3300049742 | Ga0501080_0110707 | Ga0501080_0110707_135_926 | 250 |
| 104 | 3300049744 | Ga0501083_0000128 | Ga0501083_0000128_42315_43097 | 250 |
| 105 | 3300049823 | Ga0501044_0005861 | Ga0501044_0005861_10206_10988 | 250 |
| 106 | 3300049823 | Ga0501044_0090744 | Ga0501044_0090744_1608_2399 | 250 |
| 107 | 3300050512 | nmdc:mga0n895_167712_c1 | nmdc:mga0n895_167712_c1_785_1567 | 250 |
| 108 | 3300005340 | Ga0070689_100027011 | Ga0070689_1000270113 | 251 |
| 109 | 3300005354 | Ga0070675_100035179 | Ga0070675_1000351793 | 251 |
| 110 | 3300005364 | Ga0070673_100100648 | Ga0070673_1001006483 | 251 |
| 111 | 3300005365 | Ga0070688_100001676 | Ga0070688_10000167612 | 251 |
| 112 | 3300005543 | Ga0070672_100159074 | Ga0070672_1001590742 | 251 |
| 113 | 3300005719 | Ga0068861_100158453 | Ga0068861_1001584532 | 251 |
| 114 | 3300005719 | Ga0068861_100387849 | Ga0068861_1003878492 | 251 |
| 115 | 3300005842 | Ga0068858_100097726 | Ga0068858_1000977263 | 251 |
| 116 | 3300009098 | Ga0105245_10329147 | Ga0105245_103291472 | 251 |
| 117 | 3300013308 | Ga0157375_10096465 | Ga0157375_100964652 | 251 |
| 118 | 3300014745 | Ga0157377_10119323 | Ga0157377_101193232 | 251 |
| 119 | 3300025901 | Ga0207688_10071054 | Ga0207688_100710543 | 251 |
| 120 | 3300025908 | Ga0207643_10010555 | Ga0207643_100105553 | 251 |
| 121 | 3300025923 | Ga0207681_10150447 | Ga0207681_101504472 | 251 |
| 122 | 3300025926 | Ga0207659_10015085 | Ga0207659_100150852 | 251 |
| 123 | 3300025927 | Ga0207687_10419598 | Ga0207687_104195982 | 251 |
| 124 | 3300025936 | Ga0207670_10030216 | Ga0207670_100302166 | 251 |
| 125 | 3300025940 | Ga0207691_10048455 | Ga0207691_100484552 | 251 |
| 126 | 3300025945 | Ga0207679_10308440 | Ga0207679_103084402 | 251 |
| 127 | 3300025960 | Ga0207651_10208977 | Ga0207651_102089772 | 251 |
| 128 | 3300026035 | Ga0207703_10012794 | Ga0207703_100127947 | 251 |
| 129 | 3300026116 | Ga0207674_10010316 | Ga0207674_100103164 | 251 |
| 130 | 3300026118 | Ga0207675_100058830 | Ga0207675_1000588306 | 251 |
| 131 | 3300031730 | Ga0307516_10027474 | Ga0307516_100274742 | 251 |
| 132 | 3300049568 | Ga0501031_0183522 | Ga0501031_0183522_197_994 | 251 |
| 133 | 3300049569 | Ga0501032_0007054 | Ga0501032_0007054_5508_6305 | 251 |
| 134 | 3300049569 | Ga0501032_0019576 | Ga0501032_0019576_3452_4249 | 251 |
| 135 | 3300049570 | Ga0501033_0000253 | Ga0501033_0000253_37883_38680 | 251 |
| 136 | 3300049570 | Ga0501033_0012037 | Ga0501033_0012037_291_1088 | 251 |
| 137 | 3300049571 | Ga0501034_0014473 | Ga0501034_0014473_4016_4813 | 251 |
| 138 | 3300049571 | Ga0501034_0156346 | Ga0501034_0156346_267_1064 | 251 |
| 139 | 3300049572 | Ga0501036_0001687 | Ga0501036_0001687_8915_9712 | 251 |
| 140 | 3300049572 | Ga0501036_0036253 | Ga0501036_0036253_2867_3664 | 251 |
| 141 | 3300049573 | Ga0501037_0003126 | Ga0501037_0003126_4284_5081 | 251 |
| 142 | 3300049573 | Ga0501037_0167685 | Ga0501037_0167685_256_1053 | 251 |
| 143 | 3300049574 | Ga0501038_0007353 | Ga0501038_0007353_976_1773 | 251 |
| 144 | 3300049575 | Ga0501039_0005731 | Ga0501039_0005731_2288_3085 | 251 |
| 145 | 3300049575 | Ga0501039_0047435 | Ga0501039_0047435_2189_2986 | 251 |
| 146 | 3300049576 | Ga0501040_0100961 | Ga0501040_0100961_372_1169 | 251 |
| 147 | 3300049579 | Ga0501043_0045794 | Ga0501043_0045794_1190_1987 | 251 |
| 148 | 3300049579 | Ga0501043_0060821 | Ga0501043_0060821_1706_2503 | 251 |
| 149 | 3300049580 | Ga0501046_0026708 | Ga0501046_0026708_2392_3189 | 251 |
| 150 | 3300049580 | Ga0501046_0109597 | Ga0501046_0109597_91_888 | 251 |
| 151 | 3300049581 | Ga0501047_0026549 | Ga0501047_0026549_4115_4912 | 251 |
| 152 | 3300049581 | Ga0501047_0046190 | Ga0501047_0046190_545_1342 | 251 |
| 153 | 3300049583 | Ga0501067_0006731 | Ga0501067_0006731_525_1322 | 251 |
| 154 | 3300049584 | Ga0501068_0002026 | Ga0501068_0002026_3771_4568 | 251 |
| 155 | 3300049585 | Ga0501069_0004184 | Ga0501069_0004184_6022_6819 | 251 |
| 156 | 3300049586 | Ga0501070_0053105 | Ga0501070_0053105_2189_2986 | 251 |
| 157 | 3300049586 | Ga0501070_0263679 | Ga0501070_0263679_591_1388 | 251 |
| 158 | 3300049587 | Ga0501071_0004253 | Ga0501071_0004253_6716_7513 | 251 |
| 159 | 3300049589 | Ga0501073_0070075 | Ga0501073_0070075_1390_2187 | 251 |
| 160 | 3300049589 | Ga0501073_0111153 | Ga0501073_0111153_976_1773 | 251 |
| 161 | 3300049589 | Ga0501073_0220355 | Ga0501073_0220355_179_976 | 251 |
| 162 | 3300049590 | Ga0501074_0003782 | Ga0501074_0003782_9411_10208 | 251 |
| 163 | 3300049590 | Ga0501074_0007967 | Ga0501074_0007967_1321_2118 | 251 |
| 164 | 3300049592 | Ga0501076_0070586 | Ga0501076_0070586_668_1465 | 251 |
| 165 | 3300049593 | Ga0501077_0096100 | Ga0501077_0096100_844_1641 | 251 |
| 166 | 3300049741 | Ga0501079_0013054 | Ga0501079_0013054_163_960 | 251 |
| 167 | 3300049742 | Ga0501080_0028762 | Ga0501080_0028762_163_960 | 251 |
| 168 | 3300049742 | Ga0501080_0283956 | Ga0501080_0283956_198_995 | 251 |
| 169 | 3300049743 | Ga0501081_0012136 | Ga0501081_0012136_4350_5147 | 251 |
| 170 | 3300049822 | Ga0501035_0010585 | Ga0501035_0010585_7031_7828 | 251 |
| 171 | 3300049822 | Ga0501035_0123293 | Ga0501035_0123293_976_1773 | 251 |
| 172 | 3300049823 | Ga0501044_0004361 | Ga0501044_0004361_13091_13888 | 251 |
| 173 | 3300049823 | Ga0501044_0005237 | Ga0501044_0005237_4337_5134 | 251 |
| 174 | 3300049823 | Ga0501044_0017680 | Ga0501044_0017680_1340_2137 | 251 |
| 175 | 3300049823 | Ga0501044_0091891 | Ga0501044_0091891_1033_1830 | 251 |
| 176 | 3300049824 | Ga0501045_0006433 | Ga0501045_0006433_5684_6481 | 251 |
| 177 | 3300054114 | Ga0501084_0034902 | Ga0501084_0034902_1802_2599 | 251 |
| 178 | 3300060353 | Ga0501082_0066481 | Ga0501082_0066481_462_1259 | 251 |
| 179 | 3300061734 | Ga0530510_0205312 | Ga0530510_0205312_112_909 | 251 |
| 180 | 3300005339 | Ga0070660_100519421 | Ga0070660_1005194211 | 252 |
| 181 | 3300005366 | Ga0070659_100135699 | Ga0070659_1001356991 | 252 |
| 182 | 3300005366 | Ga0070659_100160246 | Ga0070659_1001602462 | 252 |
| 183 | 3300005458 | Ga0070681_10011292 | Ga0070681_100112921 | 252 |
| 184 | 3300005458 | Ga0070681_10133685 | Ga0070681_101336852 | 252 |
| 185 | 3300005530 | Ga0070679_100034494 | Ga0070679_1000344945 | 252 |
| 186 | 3300005530 | Ga0070679_100270465 | Ga0070679_1002704652 | 252 |
| 187 | 3300005563 | Ga0068855_100044903 | Ga0068855_1000449033 | 252 |
| 188 | 3300005563 | Ga0068855_100238306 | Ga0068855_1002383062 | 252 |
| 189 | 3300005563 | Ga0068855_100662948 | Ga0068855_1006629482 | 252 |
| 190 | 3300005563 | Ga0068855_100791462 | Ga0068855_1007914621 | 252 |
| 191 | 3300005564 | Ga0070664_100027305 | Ga0070664_1000273054 | 252 |
| 192 | 3300005578 | Ga0068854_100166885 | Ga0068854_1001668852 | 252 |
| 193 | 3300005614 | Ga0068856_100002579 | Ga0068856_1000025793 | 252 |
| 194 | 3300009098 | Ga0105245_10057297 | Ga0105245_100572974 | 252 |
| 195 | 3300013104 | Ga0157370_10043567 | Ga0157370_100435674 | 252 |
| 196 | 3300013104 | Ga0157370_10089956 | Ga0157370_100899562 | 252 |
| 197 | 3300013307 | Ga0157372_10009633 | Ga0157372_100096336 | 252 |
| 198 | 3300013307 | Ga0157372_10033848 | Ga0157372_100338484 | 252 |
| 199 | 3300013307 | Ga0157372_10117129 | Ga0157372_101171294 | 252 |
| 200 | 3300013307 | Ga0157372_10217748 | Ga0157372_102177482 | 252 |
| 201 | 3300025912 | Ga0207707_10070719 | Ga0207707_100707193 | 252 |
| 202 | 3300025912 | Ga0207707_10118350 | Ga0207707_101183503 | 252 |
| 203 | 3300025913 | Ga0207695_10719110 | Ga0207695_107191101 | 252 |
| 204 | 3300025919 | Ga0207657_10011363 | Ga0207657_100113637 | 252 |
| 205 | 3300025919 | Ga0207657_10153853 | Ga0207657_101538533 | 252 |
| 206 | 3300025920 | Ga0207649_10151475 | Ga0207649_101514752 | 252 |
| 207 | 3300025921 | Ga0207652_10030415 | Ga0207652_100304152 | 252 |
| 208 | 3300025921 | Ga0207652_10754346 | Ga0207652_107543461 | 252 |
| 209 | 3300025927 | Ga0207687_10134524 | Ga0207687_101345243 | 252 |
| 210 | 3300025929 | Ga0207664_10027030 | Ga0207664_100270305 | 252 |
| 211 | 3300025932 | Ga0207690_10044205 | Ga0207690_100442052 | 252 |
| 212 | 3300025932 | Ga0207690_10199142 | Ga0207690_101991422 | 252 |
| 213 | 3300025949 | Ga0207667_10027041 | Ga0207667_100270411 | 252 |
| 214 | 3300025949 | Ga0207667_10506297 | Ga0207667_105062972 | 252 |
| 215 | 3300025949 | Ga0207667_10562939 | Ga0207667_105629391 | 252 |
| 216 | 3300025949 | Ga0207667_10709777 | Ga0207667_107097771 | 252 |
| 217 | 3300026078 | Ga0207702_10047555 | Ga0207702_100475553 | 252 |
| 218 | 3300038443 | Ga0395901_0064899 | Ga0395901_0064899_405_1193 | 252 |
| 219 | 3300042876 | Ga0451577_0000121 | Ga0451577_0000121_34615_35403 | 252 |
| 220 | 3300044694 | Ga0466963_0190395 | Ga0466963_0190395_603_1391 | 252 |
| 221 | 3300044712 | Ga0453684_0000227 | Ga0453684_0000227_75600_76388 | 252 |
| 222 | 3300045976 | Ga0466967_0239918 | Ga0466967_0239918_96_884 | 252 |
| 223 | 3300005367 | Ga0070667_100059119 | Ga0070667_1000591192 | 253 |
| 224 | 3300005468 | Ga0070707_100355490 | Ga0070707_1003554902 | 253 |
| 225 | 3300005536 | Ga0070697_100119943 | Ga0070697_1001199431 | 253 |
| 226 | 3300005545 | Ga0070695_100100000 | Ga0070695_1001000002 | 253 |
| 227 | 3300005548 | Ga0070665_100748084 | Ga0070665_1007480842 | 253 |
| 228 | 3300005549 | Ga0070704_100005373 | Ga0070704_1000053733 | 253 |
| 229 | 3300006852 | Ga0075433_10182227 | Ga0075433_101822273 | 253 |
| 230 | 3300014497 | Ga0182008_10044508 | Ga0182008_100445083 | 253 |
| 231 | 3300025960 | Ga0207651_10465406 | Ga0207651_104654062 | 253 |
| 232 | 3300025972 | Ga0207668_10440903 | Ga0207668_104409032 | 253 |
| 233 | 3300025986 | Ga0207658_10101699 | Ga0207658_101016992 | 253 |
| 234 | 3300027543 | Ga0209999_1008422 | Ga0209999_10084222 | 253 |
| 235 | 3300027552 | Ga0209982_1005689 | Ga0209982_10056891 | 253 |
| 236 | 3300027682 | Ga0209971_1004719 | Ga0209971_10047193 | 253 |
| 237 | 3300027876 | Ga0209974_10000775 | Ga0209974_100007752 | 253 |
| 238 | 3300005290 | Ga0065712_10148464 | Ga0065712_101484642 | 254 |
| 239 | 3300005329 | Ga0070683_100005520 | Ga0070683_1000055204 | 254 |
| 240 | 3300005339 | Ga0070660_100000483 | Ga0070660_1000004833 | 254 |
| 241 | 3300005344 | Ga0070661_100018125 | Ga0070661_1000181253 | 254 |
| 242 | 3300005344 | Ga0070661_100059967 | Ga0070661_1000599672 | 254 |
| 243 | 3300005345 | Ga0070692_10031581 | Ga0070692_100315814 | 254 |
| 244 | 3300005354 | Ga0070675_100090951 | Ga0070675_1000909512 | 254 |
| 245 | 3300005355 | Ga0070671_100001539 | Ga0070671_10000153924 | 254 |
| 246 | 3300005355 | Ga0070671_100047697 | Ga0070671_1000476972 | 254 |
| 247 | 3300005364 | Ga0070673_100009292 | Ga0070673_1000092927 | 254 |
| 248 | 3300005366 | Ga0070659_100005159 | Ga0070659_1000051594 | 254 |
| 249 | 3300005366 | Ga0070659_100022296 | Ga0070659_1000222964 | 254 |
| 250 | 3300005366 | Ga0070659_100255171 | Ga0070659_1002551712 | 254 |
| 251 | 3300005367 | Ga0070667_100312218 | Ga0070667_1003122181 | 254 |
| 252 | 3300005457 | Ga0070662_100000180 | Ga0070662_10000018030 | 254 |
| 253 | 3300005457 | Ga0070662_100359988 | Ga0070662_1003599882 | 254 |
| 254 | 3300005535 | Ga0070684_100000955 | Ga0070684_10000095515 | 254 |
| 255 | 3300005539 | Ga0068853_100009357 | Ga0068853_10000935711 | 254 |
| 256 | 3300005543 | Ga0070672_100024146 | Ga0070672_1000241464 | 254 |
| 257 | 3300005563 | Ga0068855_100010749 | Ga0068855_10001074912 | 254 |
| 258 | 3300005563 | Ga0068855_100053791 | Ga0068855_1000537914 | 254 |
| 259 | 3300005564 | Ga0070664_100089212 | Ga0070664_1000892123 | 254 |
| 260 | 3300005564 | Ga0070664_100132036 | Ga0070664_1001320363 | 254 |
| 261 | 3300005577 | Ga0068857_100078371 | Ga0068857_1000783712 | 254 |
| 262 | 3300005578 | Ga0068854_100000368 | Ga0068854_10000036817 | 254 |
| 263 | 3300005614 | Ga0068856_100002139 | Ga0068856_10000213911 | 254 |
| 264 | 3300005616 | Ga0068852_100014731 | Ga0068852_1000147316 | 254 |
| 265 | 3300005834 | Ga0068851_10182189 | Ga0068851_101821892 | 254 |
| 266 | 3300007076 | Ga0075435_100642289 | Ga0075435_1006422891 | 254 |
| 267 | 3300009093 | Ga0105240_10383128 | Ga0105240_103831282 | 254 |
| 268 | 3300009174 | Ga0105241_10005804 | Ga0105241_100058043 | 254 |
| 269 | 3300009545 | Ga0105237_10087781 | Ga0105237_100877814 | 254 |
| 270 | 3300009551 | Ga0105238_10163490 | Ga0105238_101634902 | 254 |
| 271 | 3300010375 | Ga0105239_10058466 | Ga0105239_100584664 | 254 |
| 272 | 3300013100 | Ga0157373_10012903 | Ga0157373_100129037 | 254 |
| 273 | 3300013102 | Ga0157371_10000194 | Ga0157371_1000019445 | 254 |
| 274 | 3300013104 | Ga0157370_10316506 | Ga0157370_103165062 | 254 |
| 275 | 3300013105 | Ga0157369_10201779 | Ga0157369_102017792 | 254 |
| 276 | 3300013307 | Ga0157372_10002446 | Ga0157372_1000244617 | 254 |
| 277 | 3300013307 | Ga0157372_10101505 | Ga0157372_101015053 | 254 |
| 278 | 3300020070 | Ga0206356_10503798 | Ga0206356_105037983 | 254 |
| 279 | 3300025321 | Ga0207656_10045152 | Ga0207656_100451522 | 254 |
| 280 | 3300025321 | Ga0207656_10133424 | Ga0207656_101334241 | 254 |
| 281 | 3300025906 | Ga0207699_10064085 | Ga0207699_100640852 | 254 |
| 282 | 3300025909 | Ga0207705_10032632 | Ga0207705_100326325 | 254 |
| 283 | 3300025911 | Ga0207654_10040820 | Ga0207654_100408202 | 254 |
| 284 | 3300025912 | Ga0207707_10056659 | Ga0207707_100566593 | 254 |
| 285 | 3300025913 | Ga0207695_10054905 | Ga0207695_100549054 | 254 |
| 286 | 3300025914 | Ga0207671_10067865 | Ga0207671_100678653 | 254 |
| 287 | 3300025914 | Ga0207671_10070521 | Ga0207671_100705212 | 254 |
| 288 | 3300025916 | Ga0207663_10086276 | Ga0207663_100862761 | 254 |
| 289 | 3300025917 | Ga0207660_10007544 | Ga0207660_100075444 | 254 |
| 290 | 3300025919 | Ga0207657_10002677 | Ga0207657_1000267720 | 254 |
| 291 | 3300025919 | Ga0207657_10018193 | Ga0207657_100181933 | 254 |
| 292 | 3300025920 | Ga0207649_10040789 | Ga0207649_100407892 | 254 |
| 293 | 3300025920 | Ga0207649_10044402 | Ga0207649_100444022 | 254 |
| 294 | 3300025920 | Ga0207649_10065172 | Ga0207649_100651722 | 254 |
| 295 | 3300025921 | Ga0207652_10036611 | Ga0207652_100366114 | 254 |
| 296 | 3300025923 | Ga0207681_10057028 | Ga0207681_100570282 | 254 |
| 297 | 3300025924 | Ga0207694_10078485 | Ga0207694_100784853 | 254 |
| 298 | 3300025926 | Ga0207659_10035630 | Ga0207659_100356304 | 254 |
| 299 | 3300025926 | Ga0207659_10065635 | Ga0207659_100656352 | 254 |
| 300 | 3300025929 | Ga0207664_10017655 | Ga0207664_100176552 | 254 |
| 301 | 3300025931 | Ga0207644_10000646 | Ga0207644_1000064620 | 254 |
| 302 | 3300025932 | Ga0207690_10000286 | Ga0207690_1000028628 | 254 |
| 303 | 3300025932 | Ga0207690_10135063 | Ga0207690_101350632 | 254 |
| 304 | 3300025933 | Ga0207706_10000002 | Ga0207706_10000002256 | 254 |
| 305 | 3300025944 | Ga0207661_10108085 | Ga0207661_101080853 | 254 |
| 306 | 3300025945 | Ga0207679_10006473 | Ga0207679_100064737 | 254 |
| 307 | 3300025945 | Ga0207679_10116926 | Ga0207679_101169262 | 254 |
| 308 | 3300025945 | Ga0207679_10156518 | Ga0207679_101565182 | 254 |
| 309 | 3300025949 | Ga0207667_10003835 | Ga0207667_100038357 | 254 |
| 310 | 3300025949 | Ga0207667_10004238 | Ga0207667_1000423816 | 254 |
| 311 | 3300025949 | Ga0207667_10114121 | Ga0207667_101141212 | 254 |
| 312 | 3300025960 | Ga0207651_10005314 | Ga0207651_100053144 | 254 |
| 313 | 3300025981 | Ga0207640_10027725 | Ga0207640_100277254 | 254 |
| 314 | 3300026041 | Ga0207639_10020373 | Ga0207639_100203733 | 254 |
| 315 | 3300026041 | Ga0207639_10138581 | Ga0207639_101385812 | 254 |
| 316 | 3300026067 | Ga0207678_10118206 | Ga0207678_101182063 | 254 |
| 317 | 3300026078 | Ga0207702_10001927 | Ga0207702_1000192716 | 254 |
| 318 | 3300026078 | Ga0207702_10207864 | Ga0207702_102078642 | 254 |
| 319 | 3300026116 | Ga0207674_10000237 | Ga0207674_1000023760 | 254 |
| 320 | 3300026116 | Ga0207674_10084531 | Ga0207674_100845313 | 254 |
| 321 | 3300026116 | Ga0207674_10275865 | Ga0207674_102758651 | 254 |
| 322 | 3300026142 | Ga0207698_10022593 | Ga0207698_100225934 | 254 |
| 323 | 3300027876 | Ga0209974_10007997 | Ga0209974_100079974 | 254 |
| 324 | 3300031731 | Ga0307405_10001108 | Ga0307405_1000110812 | 254 |
| 325 | 3300031824 | Ga0307413_10000680 | Ga0307413_100006809 | 254 |
| 326 | 3300031852 | Ga0307410_10001273 | Ga0307410_100012737 | 254 |
| 327 | 3300031911 | Ga0307412_10183640 | Ga0307412_101836402 | 254 |
| 328 | 3300031995 | Ga0307409_100002727 | Ga0307409_1000027272 | 254 |
| 329 | 3300032126 | Ga0307415_100005995 | Ga0307415_1000059957 | 254 |
| 330 | 3300035691 | Ga0373931_0252699 | Ga0373931_0252699_195_989 | 254 |
| 331 | 3300035695 | Ga0373927_0138661 | Ga0373927_0138661_250_1047 | 254 |
| 332 | 3300035725 | Ga0373947_0422955 | Ga0373947_0422955_22_786 | 254 |
| 333 | 3300037466 | Ga0395898_0221671 | Ga0395898_0221671_447_1250 | 254 |
| 334 | 3300041512 | Ga0451853_1345624 | Ga0451853_1345624_23_817 | 254 |
| 335 | 3300044673 | Ga0453683_0257381 | Ga0453683_0257381_164_961 | 254 |
| 336 | 3300044712 | Ga0453684_0010500 | Ga0453684_0010500_14867_15664 | 254 |
| 337 | 3300045051 | Ga0451576_0224594 | Ga0451576_0224594_995_1792 | 254 |
| 338 | 3300046472 | Ga0495580_0170507 | Ga0495580_0170507_79_876 | 254 |
| 339 | 3300048904 | Ga0496101_0063504 | Ga0496101_0063504_1300_2094 | 254 |
| 340 | 3300048904 | Ga0496101_0387542 | Ga0496101_0387542_106_900 | 254 |
| 341 | 3300048909 | Ga0496106_0000779 | Ga0496106_0000779_14193_14987 | 254 |
| 342 | 3300048913 | Ga0496110_0192675 | Ga0496110_0192675_30_824 | 254 |
| 343 | 3300001991 | JGI24743J22301_10007484 | JGI24743J22301_100074842 | 255 |
| 344 | 3300005293 | Ga0065715_10349467 | Ga0065715_103494671 | 255 |
| 345 | 3300005328 | Ga0070676_10049627 | Ga0070676_100496271 | 255 |
| 346 | 3300005329 | Ga0070683_100021430 | Ga0070683_1000214302 | 255 |
| 347 | 3300005330 | Ga0070690_100021250 | Ga0070690_1000212503 | 255 |
| 348 | 3300005331 | Ga0070670_100077568 | Ga0070670_1000775682 | 255 |
| 349 | 3300005333 | Ga0070677_10033650 | Ga0070677_100336502 | 255 |
| 350 | 3300005334 | Ga0068869_100016466 | Ga0068869_1000164662 | 255 |
| 351 | 3300005335 | Ga0070666_10025432 | Ga0070666_100254322 | 255 |
| 352 | 3300005335 | Ga0070666_10050618 | Ga0070666_100506182 | 255 |
| 353 | 3300005338 | Ga0068868_100097728 | Ga0068868_1000977282 | 255 |
| 354 | 3300005339 | Ga0070660_100120612 | Ga0070660_1001206122 | 255 |
| 355 | 3300005340 | Ga0070689_100011771 | Ga0070689_1000117712 | 255 |
| 356 | 3300005343 | Ga0070687_100014609 | Ga0070687_1000146092 | 255 |
| 357 | 3300005345 | Ga0070692_10054275 | Ga0070692_100542752 | 255 |
| 358 | 3300005353 | Ga0070669_100129175 | Ga0070669_1001291752 | 255 |
| 359 | 3300005354 | Ga0070675_100332901 | Ga0070675_1003329012 | 255 |
| 360 | 3300005355 | Ga0070671_100006349 | Ga0070671_1000063492 | 255 |
| 361 | 3300005355 | Ga0070671_100296473 | Ga0070671_1002964731 | 255 |
| 362 | 3300005356 | Ga0070674_100286207 | Ga0070674_1002862071 | 255 |
| 363 | 3300005364 | Ga0070673_100011373 | Ga0070673_1000113735 | 255 |
| 364 | 3300005365 | Ga0070688_100007052 | Ga0070688_1000070523 | 255 |
| 365 | 3300005366 | Ga0070659_100019023 | Ga0070659_1000190232 | 255 |
| 366 | 3300005455 | Ga0070663_100251615 | Ga0070663_1002516152 | 255 |
| 367 | 3300005456 | Ga0070678_100487723 | Ga0070678_1004877231 | 255 |
| 368 | 3300005457 | Ga0070662_100294075 | Ga0070662_1002940752 | 255 |
| 369 | 3300005466 | Ga0070685_10003791 | Ga0070685_100037912 | 255 |
| 370 | 3300005543 | Ga0070672_100024480 | Ga0070672_1000244802 | 255 |
| 371 | 3300005543 | Ga0070672_100107041 | Ga0070672_1001070412 | 255 |
| 372 | 3300005544 | Ga0070686_100014903 | Ga0070686_1000149031 | 255 |
| 373 | 3300005547 | Ga0070693_100084634 | Ga0070693_1000846342 | 255 |
| 374 | 3300005548 | Ga0070665_100020075 | Ga0070665_1000200753 | 255 |
| 375 | 3300005564 | Ga0070664_100016201 | Ga0070664_1000162013 | 255 |
| 376 | 3300005564 | Ga0070664_100073520 | Ga0070664_1000735202 | 255 |
| 377 | 3300005577 | Ga0068857_100030320 | Ga0068857_1000303202 | 255 |
| 378 | 3300005578 | Ga0068854_100175420 | Ga0068854_1001754201 | 255 |
| 379 | 3300005614 | Ga0068856_100120764 | Ga0068856_1001207642 | 255 |
| 380 | 3300005616 | Ga0068852_100014358 | Ga0068852_1000143583 | 255 |
| 381 | 3300005617 | Ga0068859_100071432 | Ga0068859_1000714322 | 255 |
| 382 | 3300005718 | Ga0068866_10011808 | Ga0068866_100118082 | 255 |
| 383 | 3300005719 | Ga0068861_100023515 | Ga0068861_1000235153 | 255 |
| 384 | 3300005840 | Ga0068870_10018782 | Ga0068870_100187822 | 255 |
| 385 | 3300005841 | Ga0068863_100028841 | Ga0068863_1000288412 | 255 |
| 386 | 3300005843 | Ga0068860_100436507 | Ga0068860_1004365072 | 255 |
| 387 | 3300005844 | Ga0068862_100022663 | Ga0068862_1000226631 | 255 |
| 388 | 3300006881 | Ga0068865_100039315 | Ga0068865_1000393152 | 255 |
| 389 | 3300006931 | Ga0097620_100071428 | Ga0097620_1000714282 | 255 |
| 390 | 3300009148 | Ga0105243_10292589 | Ga0105243_102925892 | 255 |
| 391 | 3300009176 | Ga0105242_10029842 | Ga0105242_100298423 | 255 |
| 392 | 3300009177 | Ga0105248_10004349 | Ga0105248_1000434910 | 255 |
| 393 | 3300009553 | Ga0105249_10046062 | Ga0105249_100460622 | 255 |
| 394 | 3300011119 | Ga0105246_10066307 | Ga0105246_100663072 | 255 |
| 395 | 3300013297 | Ga0157378_10041256 | Ga0157378_100412563 | 255 |
| 396 | 3300013306 | Ga0163162_10161405 | Ga0163162_101614052 | 255 |
| 397 | 3300013307 | Ga0157372_10071325 | Ga0157372_100713253 | 255 |
| 398 | 3300014325 | Ga0163163_10108464 | Ga0163163_101084642 | 255 |
| 399 | 3300014745 | Ga0157377_10008087 | Ga0157377_100080872 | 255 |
| 400 | 3300025315 | Ga0207697_10001106 | Ga0207697_1000110616 | 255 |
| 401 | 3300025893 | Ga0207682_10001444 | Ga0207682_100014443 | 255 |
| 402 | 3300025899 | Ga0207642_10007438 | Ga0207642_100074382 | 255 |
| 403 | 3300025903 | Ga0207680_10051579 | Ga0207680_100515791 | 255 |
| 404 | 3300025907 | Ga0207645_10010172 | Ga0207645_100101726 | 255 |
| 405 | 3300025908 | Ga0207643_10002281 | Ga0207643_1000228111 | 255 |
| 406 | 3300025918 | Ga0207662_10003933 | Ga0207662_100039339 | 255 |
| 407 | 3300025919 | Ga0207657_10027365 | Ga0207657_100273653 | 255 |
| 408 | 3300025925 | Ga0207650_10015479 | Ga0207650_100154792 | 255 |
| 409 | 3300025926 | Ga0207659_10042852 | Ga0207659_100428522 | 255 |
| 410 | 3300025931 | Ga0207644_10012522 | Ga0207644_100125224 | 255 |
| 411 | 3300025931 | Ga0207644_10099966 | Ga0207644_100999662 | 255 |
| 412 | 3300025933 | Ga0207706_10010334 | Ga0207706_1001033411 | 255 |
| 413 | 3300025933 | Ga0207706_10216004 | Ga0207706_102160042 | 255 |
| 414 | 3300025935 | Ga0207709_10193540 | Ga0207709_101935402 | 255 |
| 415 | 3300025937 | Ga0207669_10141311 | Ga0207669_101413112 | 255 |
| 416 | 3300025938 | Ga0207704_10075143 | Ga0207704_100751432 | 255 |
| 417 | 3300025940 | Ga0207691_10037224 | Ga0207691_100372244 | 255 |
| 418 | 3300025940 | Ga0207691_10105672 | Ga0207691_101056722 | 255 |
| 419 | 3300025941 | Ga0207711_10011289 | Ga0207711_100112899 | 255 |
| 420 | 3300025941 | Ga0207711_10097704 | Ga0207711_100977042 | 255 |
| 421 | 3300025942 | Ga0207689_10006353 | Ga0207689_100063533 | 255 |
| 422 | 3300025945 | Ga0207679_10029990 | Ga0207679_100299902 | 255 |
| 423 | 3300025960 | Ga0207651_10006814 | Ga0207651_100068142 | 255 |
| 424 | 3300025972 | Ga0207668_10438945 | Ga0207668_104389452 | 255 |
| 425 | 3300025981 | Ga0207640_10056175 | Ga0207640_100561752 | 255 |
| 426 | 3300025986 | Ga0207658_10083182 | Ga0207658_100831822 | 255 |
| 427 | 3300026041 | Ga0207639_10232948 | Ga0207639_102329482 | 255 |
| 428 | 3300026067 | Ga0207678_10002599 | Ga0207678_100025993 | 255 |
| 429 | 3300026075 | Ga0207708_10004967 | Ga0207708_100049679 | 255 |
| 430 | 3300026089 | Ga0207648_10030561 | Ga0207648_100305614 | 255 |
| 431 | 3300026095 | Ga0207676_10113278 | Ga0207676_101132781 | 255 |
| 432 | 3300026116 | Ga0207674_10009051 | Ga0207674_100090514 | 255 |
| 433 | 3300026116 | Ga0207674_10315807 | Ga0207674_103158072 | 255 |
| 434 | 3300026118 | Ga0207675_100000626 | Ga0207675_1000006262 | 255 |
| 435 | 3300026118 | Ga0207675_100047665 | Ga0207675_1000476652 | 255 |
| 436 | 3300026121 | Ga0207683_10050890 | Ga0207683_100508903 | 255 |
| 437 | 3300026142 | Ga0207698_10051469 | Ga0207698_100514693 | 255 |
| 438 | 3300027907 | Ga0207428_10238290 | Ga0207428_102382902 | 255 |
| 439 | 3300028379 | Ga0268266_10408619 | Ga0268266_104086192 | 255 |
| 440 | 3300035171 | Ga0373946_0147859 | Ga0373946_0147859_97_894 | 255 |
| 441 | 3300046537 | Ga0495598_0135829 | Ga0495598_0135829_65_832 | 255 |
| 442 | 3300048907 | Ga0496104_0143938 | Ga0496104_0143938_873_1670 | 255 |
| 443 | 3300048908 | Ga0496105_0012283 | Ga0496105_0012283_5055_5852 | 255 |
| 444 | 3300048909 | Ga0496106_0053196 | Ga0496106_0053196_58_855 | 255 |
| 445 | 3300048910 | Ga0496107_0027118 | Ga0496107_0027118_1684_2481 | 255 |
| 446 | 3300048911 | Ga0496108_0008085 | Ga0496108_0008085_2468_3265 | 255 |
| 447 | 3300048912 | Ga0496109_0004103 | Ga0496109_0004103_6326_7123 | 255 |
| 448 | 3300048912 | Ga0496109_0409053 | Ga0496109_0409053_247_1047 | 255 |
| 449 | 3300048913 | Ga0496110_0010969 | Ga0496110_0010969_2167_2964 | 255 |
| 450 | 3300048917 | Ga0496114_0164085 | Ga0496114_0164085_598_1395 | 255 |
| 451 | 3300050511 | nmdc:mga08y16_55101_c1 | nmdc:mga08y16_55101_c1_2708_3505 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e26-assembly1.cif.gz_A-2 | crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase | 0.752 | 2 | 230 |
| 7pe4-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose | 0.7485 | 2 | 230 |
| 7pdo-assembly1.cif.gz_A-2 | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp | 0.7478 | 2 | 230 |
| 5jud-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with uridine-diphosphate (udp) - gpgs*udp | 0.7435 | 2 | 230 |
| 7pho-assembly1.cif.gz_A | crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde | 0.7421 | 2 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8851 | 2 | 227 | 3.90.550.10 |
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8674 | 2 | 217 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8566 | 2 | 220 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.853 | 2 | 214 | 3.90.550.10 |
| af_Q8WSL9_63_329_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8354 | 2 | 221 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383DKP0-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9906 | 1 | 199 |
GO:0016757
|
| AF-A0A2E5G6E6-F1-model_v4 | Glycosyl transferase family 2 | 0.989 | 2 | 245 |
GO:0016757
|
| AF-A0A2V8M3K3-F1-model_v4 | Glycosyl transferase family 2 | 0.989 | 39 | 244 |
GO:0016740
|
| AF-A0A3P0X608-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9877 | 2 | 247 |
GO:0016757
|
| AF-A0A6N7EZJ0-F1-model_v4 | Glycosyltransferase | 0.9869 | 1 | 234 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar