F446726

General Info

Members Datasets Scaffolds Average Seq Length
451 231 450 261

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100160246|Ga0070659_1001602462
Length 292
Sequence MVGVPLVRARPQCRFKYHRDALAGRDPSGTMLHGKKIAVVMPAYRAAKTLAQCVRAIPPDVVDTTLLVDDGSDDETLAVARELGLATHRHPRNLGYGANQKTCYRAALADGADIVVMLHPDYQYEPRLITAMAGMIASGVYDVVIGSRILGNTALRGGMPLYKYVANRFLTAVQNLAIGSKLSEFHTGYRAFSRRVLAELPLLANSQDFIFDNQMLVQAHAFGLRIGEISCPTKYFEEASEIDFRRSVVYGLGVLRVSAQYRLWRMGIGRPAIFSDAPQLRLPGTPPEALTQ

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.88
Rhizosphere 95.57
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10007484 3300001991 Bacteria 1895
2 rootL2_10103520 3300003322 Bacteria 3333
3 rootH1_10036757 3300003323 Bacteria 18703
4 Ga0065712_10148464 3300005290 Bacteria 1389
5 Ga0065715_10349467 3300005293 Bacteria 953
6 Ga0065707_10106015 3300005295 Bacteria 2618
7 Ga0070676_10049627 3300005328 Bacteria 2457
8 Ga0070683_100005520 3300005329 Bacteria 10567
9 Ga0070683_100021430 3300005329 Bacteria 5768
10 Ga0070690_100021250 3300005330 Bacteria 3960
11 Ga0070670_100077568 3300005331 Bacteria 2854
12 Ga0070677_10033650 3300005333 Bacteria 1975
13 Ga0068869_100016466 3300005334 Bacteria 4982
14 Ga0070666_10025432 3300005335 Bacteria 3860
15 Ga0070666_10050618 3300005335 Bacteria 2794
16 Ga0068868_100097728 3300005338 Bacteria 2373
17 Ga0070660_100000483 3300005339 Bacteria 26582
18 Ga0070660_100120612 3300005339 Bacteria 2092
19 Ga0070660_100519421 3300005339 Bacteria 992
20 Ga0070689_100011771 3300005340 Bacteria 6276
21 Ga0070689_100027011 3300005340 Bacteria 4326
22 Ga0070687_100014609 3300005343 Bacteria 3530
23 Ga0070661_100018125 3300005344 Bacteria 5003
24 Ga0070661_100033659 3300005344 Bacteria 3713
25 Ga0070661_100059967 3300005344 Bacteria 2792
26 Ga0070661_100066162 3300005344 Bacteria 2655
27 Ga0070661_100373026 3300005344 Bacteria 1123
28 Ga0070692_10031581 3300005345 Bacteria 2656
29 Ga0070692_10054275 3300005345 Bacteria 2092
30 Ga0070669_100129175 3300005353 Bacteria 1936
31 Ga0070675_100035179 3300005354 Bacteria 4068
32 Ga0070675_100090951 3300005354 Bacteria 2556
33 Ga0070675_100332901 3300005354 Bacteria 1343
34 Ga0070675_100452752 3300005354 Bacteria 1151
35 Ga0070671_100001539 3300005355 Bacteria 17332
36 Ga0070671_100006349 3300005355 Bacteria 9432
37 Ga0070671_100047697 3300005355 Bacteria 3561
38 Ga0070671_100296473 3300005355 Bacteria 1376
39 Ga0070674_100286207 3300005356 Bacteria 1308
40 Ga0070673_100009292 3300005364 Bacteria 6596
41 Ga0070673_100011373 3300005364 Bacteria 6072
42 Ga0070673_100100648 3300005364 Bacteria 2380
43 Ga0070688_100001676 3300005365 Bacteria 11084
44 Ga0070688_100007052 3300005365 Bacteria 6045
45 Ga0070659_100005159 3300005366 Bacteria 9366
46 Ga0070659_100019023 3300005366 Bacteria 5193
47 Ga0070659_100022296 3300005366 Bacteria 4833
48 Ga0070659_100135699 3300005366 Bacteria 2001
49 Ga0070659_100160246 3300005366 Bacteria 1839
50 Ga0070659_100255171 3300005366 Bacteria 1454
51 Ga0070667_100059119 3300005367 Bacteria 3242
52 Ga0070667_100312218 3300005367 Unclassified 1417
53 Ga0070709_10049545 3300005434 Bacteria 2627
54 Ga0070714_100175902 3300005435 Bacteria 1945
55 Ga0070711_100013374 3300005439 Bacteria 5155
56 Ga0070663_100251615 3300005455 Bacteria 1398
57 Ga0070678_100487723 3300005456 Bacteria 1085
58 Ga0070662_100000180 3300005457 Bacteria 36959
59 Ga0070662_100294075 3300005457 Bacteria 1317
60 Ga0070662_100359988 3300005457 Bacteria 1194
61 Ga0070681_10011292 3300005458 Bacteria 8836
62 Ga0070681_10032422 3300005458 Bacteria 5243
63 Ga0070681_10035460 3300005458 Bacteria 5011
64 Ga0070681_10133685 3300005458 Bacteria 2412
65 Ga0070685_10003791 3300005466 Bacteria 7646
66 Ga0070707_100355490 3300005468 Bacteria 1423
67 Ga0070679_100034494 3300005530 Bacteria 5015
68 Ga0070679_100047639 3300005530 Bacteria 4271
69 Ga0070679_100270465 3300005530 Bacteria 1653
70 Ga0070684_100000955 3300005535 Bacteria 20577
71 Ga0070697_100119943 3300005536 Bacteria 2199
72 Ga0068853_100009357 3300005539 Bacteria 7899
73 Ga0068853_100199527 3300005539 Bacteria 1820
74 Ga0070672_100024146 3300005543 Bacteria 4488
75 Ga0070672_100024480 3300005543 Bacteria 4463
76 Ga0070672_100107041 3300005543 Bacteria 2275
77 Ga0070672_100159074 3300005543 Bacteria 1873
78 Ga0070686_100014903 3300005544 Bacteria 4489
79 Ga0070695_100100000 3300005545 Bacteria 1951
80 Ga0070693_100084634 3300005547 Bacteria 1899
81 Ga0070665_100020075 3300005548 Bacteria 6709
82 Ga0070665_100748084 3300005548 Bacteria 991
83 Ga0070704_100005373 3300005549 Bacteria 7463
84 Ga0068855_100010749 3300005563 Bacteria 11048
85 Ga0068855_100044903 3300005563 Bacteria 5227
86 Ga0068855_100053791 3300005563 Bacteria 4735
87 Ga0068855_100238306 3300005563 Bacteria 2034
88 Ga0068855_100307480 3300005563 Bacteria 1754
89 Ga0068855_100662948 3300005563 Bacteria 1119
90 Ga0068855_100791462 3300005563 Bacteria 1008
91 Ga0070664_100016201 3300005564 Bacteria 6109
92 Ga0070664_100027305 3300005564 Bacteria 4743
93 Ga0070664_100073520 3300005564 Bacteria 2933
94 Ga0070664_100089212 3300005564 Bacteria 2667
95 Ga0070664_100132036 3300005564 Bacteria 2194
96 Ga0068857_100030320 3300005577 Bacteria 4775
97 Ga0068857_100057290 3300005577 Bacteria 3458
98 Ga0068857_100078371 3300005577 Bacteria 2949
99 Ga0068854_100000368 3300005578 Bacteria 28867
100 Ga0068854_100166885 3300005578 Bacteria 1710
101 Ga0068854_100175420 3300005578 Bacteria 1671
102 Ga0068856_100002139 3300005614 Bacteria 20471
103 Ga0068856_100002579 3300005614 Bacteria 18672
104 Ga0068856_100120764 3300005614 Bacteria 2622
105 Ga0068856_100243516 3300005614 Bacteria 1813
106 Ga0068856_100685631 3300005614 Bacteria 1045
107 Ga0068852_100014358 3300005616 Bacteria 6095
108 Ga0068852_100014731 3300005616 Bacteria 6034
109 Ga0068852_100375639 3300005616 Bacteria 1393
110 Ga0068859_100071432 3300005617 Bacteria 3507
111 Ga0068864_100448583 3300005618 Bacteria 1233
112 Ga0068866_10011808 3300005718 Bacteria 3791
113 Ga0068861_100023515 3300005719 Bacteria 4445
114 Ga0068861_100158453 3300005719 Bacteria 1865
115 Ga0068861_100387849 3300005719 Bacteria 1236
116 Ga0068851_10182189 3300005834 Bacteria 1164
117 Ga0068870_10018782 3300005840 Bacteria 3343
118 Ga0068863_100028841 3300005841 Bacteria 5300
119 Ga0068863_100438649 3300005841 Bacteria 1280
120 Ga0068858_100000081 3300005842 Bacteria 100314
121 Ga0068858_100097726 3300005842 Bacteria 2737
122 Ga0068860_100436507 3300005843 Bacteria 1300
123 Ga0068862_100022663 3300005844 Bacteria 5254
124 Ga0068871_100017712 3300006358 Bacteria 5397
125 Ga0075433_10182227 3300006852 Bacteria 1869
126 Ga0075434_100404051 3300006871 Bacteria 1387
127 Ga0068865_100019854 3300006881 Bacteria 4352
128 Ga0068865_100039315 3300006881 Bacteria 3208
129 Ga0075436_100052207 3300006914 Bacteria 2821
130 Ga0097620_100071428 3300006931 Bacteria 3507
131 Ga0075435_100642289 3300007076 Bacteria 921
132 Ga0105240_10365809 3300009093 Bacteria 1632
133 Ga0105240_10383128 3300009093 Bacteria 1588
134 Ga0105240_10599778 3300009093 Bacteria 1213
135 Ga0105245_10054255 3300009098 Bacteria 3599
136 Ga0105245_10057297 3300009098 Bacteria 3504
137 Ga0105245_10329147 3300009098 Bacteria 1507
138 Ga0105243_10292589 3300009148 Bacteria 1472
139 Ga0105241_10005804 3300009174 Bacteria 9115
140 Ga0105242_10029842 3300009176 Bacteria 4352
141 Ga0105242_10042180 3300009176 Bacteria 3683
142 Ga0105248_10000889 3300009177 Bacteria 33435
143 Ga0105248_10004349 3300009177 Bacteria 15668
144 Ga0105237_10087781 3300009545 Bacteria 3100
145 Ga0105238_10163490 3300009551 Bacteria 2202
146 Ga0105249_10046062 3300009553 Bacteria 3969
147 Ga0105239_10058466 3300010375 Bacteria 4231
148 Ga0105246_10066307 3300011119 Bacteria 2527
149 Ga0157373_10012903 3300013100 Bacteria 6134
150 Ga0157371_10000194 3300013102 Bacteria 90011
151 Ga0157370_10003304 3300013104 Bacteria 19007
152 Ga0157370_10043567 3300013104 Bacteria 4317
153 Ga0157370_10089956 3300013104 Bacteria 2883
154 Ga0157370_10316506 3300013104 Unclassified 1440
155 Ga0157370_10332731 3300013104 Bacteria 1400
156 Ga0157369_10167262 3300013105 Bacteria 2318
157 Ga0157369_10201779 3300013105 Bacteria 2087
158 Ga0157374_10362714 3300013296 Bacteria 1441
159 Ga0157378_10041256 3300013297 Bacteria 4093
160 Ga0157378_10079193 3300013297 Bacteria 2966
161 Ga0163162_10161405 3300013306 Bacteria 2363
162 Ga0163162_10162782 3300013306 Bacteria 2353
163 Ga0157372_10002446 3300013307 Bacteria 20126
164 Ga0157372_10009633 3300013307 Bacteria 10268
165 Ga0157372_10033848 3300013307 Bacteria 5615
166 Ga0157372_10071325 3300013307 Bacteria 3912
167 Ga0157372_10101505 3300013307 Bacteria 3284
168 Ga0157372_10117129 3300013307 Bacteria 3055
169 Ga0157372_10217748 3300013307 Bacteria 2213
170 Ga0157375_10023845 3300013308 Bacteria 5653
171 Ga0157375_10096465 3300013308 Bacteria 3029
172 Ga0163163_10108464 3300014325 Bacteria 2804
173 Ga0163163_10148613 3300014325 Bacteria 2387
174 Ga0182008_10044508 3300014497 Bacteria 2207
175 Ga0157377_10008087 3300014745 Bacteria 5116
176 Ga0157377_10119323 3300014745 Bacteria 1596
177 Ga0157379_10000042 3300014968 Bacteria 77721
178 Ga0157376_10176576 3300014969 Bacteria 1949
179 Ga0206356_10503798 3300020070 Bacteria 3287
180 Ga0207697_10001106 3300025315 Bacteria 14858
181 Ga0207656_10045152 3300025321 Bacteria 1884
182 Ga0207656_10133424 3300025321 Bacteria 1165
183 Ga0207656_10160204 3300025321 Bacteria 1070
184 Ga0207682_10001444 3300025893 Bacteria 10969
185 Ga0207642_10007438 3300025899 Bacteria 3702
186 Ga0207688_10071054 3300025901 Bacteria 1975
187 Ga0207680_10051579 3300025903 Bacteria 2461
188 Ga0207699_10064085 3300025906 Bacteria 2223
189 Ga0207645_10010172 3300025907 Bacteria 6467
190 Ga0207643_10002281 3300025908 Bacteria 10446
191 Ga0207643_10010555 3300025908 Bacteria 4973
192 Ga0207705_10032632 3300025909 Bacteria 3722
193 Ga0207654_10040820 3300025911 Bacteria 2617
194 Ga0207707_10056659 3300025912 Bacteria 3410
195 Ga0207707_10070719 3300025912 Bacteria 3041
196 Ga0207707_10118350 3300025912 Bacteria 2316
197 Ga0207707_10213565 3300025912 Bacteria 1680
198 Ga0207695_10054905 3300025913 Bacteria 4156
199 Ga0207695_10682970 3300025913 Bacteria 907
200 Ga0207695_10719110 3300025913 Bacteria 879
201 Ga0207671_10065182 3300025914 Bacteria 2709
202 Ga0207671_10067865 3300025914 Bacteria 2656
203 Ga0207671_10070521 3300025914 Bacteria 2605
204 Ga0207663_10035131 3300025916 Bacteria 3004
205 Ga0207663_10086276 3300025916 Bacteria 2070
206 Ga0207663_10088651 3300025916 Bacteria 2047
207 Ga0207660_10007544 3300025917 Bacteria 7041
208 Ga0207660_10269098 3300025917 Bacteria 1350
209 Ga0207662_10003933 3300025918 Bacteria 7744
210 Ga0207662_10298344 3300025918 Bacteria 1070
211 Ga0207657_10002677 3300025919 Bacteria 19216
212 Ga0207657_10011363 3300025919 Bacteria 8844
213 Ga0207657_10018193 3300025919 Bacteria 6723
214 Ga0207657_10027365 3300025919 Bacteria 5223
215 Ga0207657_10153853 3300025919 Bacteria 1872
216 Ga0207649_10040789 3300025920 Unclassified 2824
217 Ga0207649_10044402 3300025920 Bacteria 2721
218 Ga0207649_10044707 3300025920 Bacteria 2712
219 Ga0207649_10065172 3300025920 Bacteria 2305
220 Ga0207649_10151475 3300025920 Bacteria 1598
221 Ga0207649_10174008 3300025920 Bacteria 1502
222 Ga0207652_10030415 3300025921 Bacteria 4522
223 Ga0207652_10036611 3300025921 Bacteria 4148
224 Ga0207652_10181358 3300025921 Bacteria 1892
225 Ga0207652_10246632 3300025921 Bacteria 1610
226 Ga0207652_10754346 3300025921 Bacteria 866
227 Ga0207681_10057028 3300025923 Unclassified 2667
228 Ga0207681_10150447 3300025923 Bacteria 1744
229 Ga0207694_10060709 3300025924 Bacteria 2942
230 Ga0207694_10078485 3300025924 Bacteria 2588
231 Ga0207650_10015479 3300025925 Bacteria 5313
232 Ga0207659_10015085 3300025926 Bacteria 4997
233 Ga0207659_10035630 3300025926 Bacteria 3441
234 Ga0207659_10042852 3300025926 Bacteria 3175
235 Ga0207659_10065635 3300025926 Bacteria 2631
236 Ga0207687_10134524 3300025927 Bacteria 1868
237 Ga0207687_10419598 3300025927 Bacteria 1104
238 Ga0207664_10017655 3300025929 Bacteria 5236
239 Ga0207664_10027030 3300025929 Bacteria 4345
240 Ga0207644_10000646 3300025931 Bacteria 22034
241 Ga0207644_10012522 3300025931 Bacteria 5637
242 Ga0207644_10099966 3300025931 Bacteria 2177
243 Ga0207690_10000286 3300025932 Bacteria 35939
244 Ga0207690_10044205 3300025932 Bacteria 2935
245 Ga0207690_10135063 3300025932 Bacteria 1810
246 Ga0207690_10199142 3300025932 Bacteria 1520
247 Ga0207706_10000002 3300025933 Bacteria 360309
248 Ga0207706_10010334 3300025933 Bacteria 8531
249 Ga0207706_10216004 3300025933 Bacteria 1680
250 Ga0207709_10193540 3300025935 Bacteria 1447
251 Ga0207670_10030216 3300025936 Bacteria 3460
252 Ga0207669_10141311 3300025937 Bacteria 1671
253 Ga0207704_10075143 3300025938 Bacteria 2159
254 Ga0207691_10037224 3300025940 Bacteria 4507
255 Ga0207691_10048455 3300025940 Bacteria 3896
256 Ga0207691_10105672 3300025940 Bacteria 2508
257 Ga0207711_10001041 3300025941 Bacteria 26508
258 Ga0207711_10011289 3300025941 Bacteria 7420
259 Ga0207711_10097704 3300025941 Bacteria 2593
260 Ga0207689_10006353 3300025942 Bacteria 10464
261 Ga0207661_10108085 3300025944 Bacteria 2347
262 Ga0207661_10447956 3300025944 Bacteria 1176
263 Ga0207679_10006473 3300025945 Bacteria 7405
264 Ga0207679_10029990 3300025945 Bacteria 3793
265 Ga0207679_10116926 3300025945 Bacteria 2115
266 Ga0207679_10156518 3300025945 Bacteria 1861
267 Ga0207679_10308440 3300025945 Bacteria 1366
268 Ga0207667_10003835 3300025949 Bacteria 18478
269 Ga0207667_10004238 3300025949 Bacteria 17604
270 Ga0207667_10027041 3300025949 Bacteria 6255
271 Ga0207667_10047005 3300025949 Bacteria 4569
272 Ga0207667_10114121 3300025949 Bacteria 2785
273 Ga0207667_10506297 3300025949 Bacteria 1224
274 Ga0207667_10562939 3300025949 Bacteria 1152
275 Ga0207667_10709777 3300025949 Bacteria 1008
276 Ga0207651_10005314 3300025960 Bacteria 6598
277 Ga0207651_10006814 3300025960 Bacteria 6025
278 Ga0207651_10208977 3300025960 Bacteria 1570
279 Ga0207651_10465406 3300025960 Bacteria 1087
280 Ga0207668_10438945 3300025972 Bacteria 1111
281 Ga0207668_10440903 3300025972 Bacteria 1109
282 Ga0207640_10027725 3300025981 Bacteria 3454
283 Ga0207640_10056175 3300025981 Bacteria 2582
284 Ga0207640_10684618 3300025981 Bacteria 877
285 Ga0207658_10083182 3300025986 Bacteria 2459
286 Ga0207658_10101699 3300025986 Bacteria 2253
287 Ga0207677_10120388 3300026023 Bacteria 1973
288 Ga0207703_10000089 3300026035 Bacteria 105959
289 Ga0207703_10012794 3300026035 Bacteria 6542
290 Ga0207639_10020373 3300026041 Bacteria 4747
291 Ga0207639_10138581 3300026041 Bacteria 2024
292 Ga0207639_10193379 3300026041 Bacteria 1739
293 Ga0207639_10232948 3300026041 Bacteria 1597
294 Ga0207678_10002599 3300026067 Bacteria 16446
295 Ga0207678_10118206 3300026067 Bacteria 2262
296 Ga0207708_10004967 3300026075 Bacteria 9795
297 Ga0207702_10001927 3300026078 Bacteria 20279
298 Ga0207702_10047555 3300026078 Bacteria 3616
299 Ga0207702_10207864 3300026078 Bacteria 1818
300 Ga0207702_10620914 3300026078 Bacteria 1061
301 Ga0207641_10577652 3300026088 Bacteria 1098
302 Ga0207648_10015340 3300026089 Bacteria 7050
303 Ga0207648_10030561 3300026089 Bacteria 4768
304 Ga0207676_10113278 3300026095 Bacteria 2273
305 Ga0207674_10000237 3300026116 Bacteria 68721
306 Ga0207674_10009051 3300026116 Bacteria 11437
307 Ga0207674_10010316 3300026116 Bacteria 10597
308 Ga0207674_10084531 3300026116 Bacteria 3171
309 Ga0207674_10121050 3300026116 Bacteria 2585
310 Ga0207674_10275865 3300026116 Bacteria 1629
311 Ga0207674_10315807 3300026116 Bacteria 1512
312 Ga0207675_100000626 3300026118 Bacteria 34619
313 Ga0207675_100047665 3300026118 Bacteria 4000
314 Ga0207675_100058830 3300026118 Bacteria 3586
315 Ga0207683_10050890 3300026121 Bacteria 3629
316 Ga0207698_10022593 3300026142 Bacteria 4375
317 Ga0207698_10051469 3300026142 Bacteria 3149
318 Ga0209999_1008422 3300027543 Bacteria 1858
319 Ga0209982_1005689 3300027552 Bacteria 1802
320 Ga0209971_1004719 3300027682 Bacteria 3233
321 Ga0209974_10000775 3300027876 Bacteria 10872
322 Ga0209974_10007997 3300027876 Bacteria 3623
323 Ga0207428_10238290 3300027907 Bacteria 1360
324 Ga0268266_10408619 3300028379 Bacteria 1285
325 Ga0265326_10001833 3300028558 Bacteria 7298
326 Ga0265334_10003910 3300028573 Bacteria 6710
327 Ga0265334_10003957 3300028573 Bacteria 6667
328 Ga0265338_10009757 3300028800 Bacteria 11386
329 Ga0265338_10286307 3300028800 Bacteria 1202
330 Ga0307509_10103487 3300031507 Bacteria 2875
331 Ga0265314_10121576 3300031711 Bacteria 1643
332 Ga0307516_10027474 3300031730 Bacteria 5769
333 Ga0307405_10001108 3300031731 Bacteria 11023
334 Ga0307413_10000680 3300031824 Bacteria 11582
335 Ga0307410_10001273 3300031852 Bacteria 11210
336 Ga0307412_10183640 3300031911 Bacteria 1575
337 Ga0307409_100002727 3300031995 Bacteria 9327
338 Ga0307415_100005995 3300032126 Bacteria 6513
339 Ga0373946_0147859 3300035171 Bacteria 1094
340 Ga0373931_0252699 3300035691 Bacteria 1072
341 Ga0373927_0138661 3300035695 Bacteria 1590
342 Ga0373947_0422955 3300035725 Bacteria 900
343 Ga0316584_0337873 3300036712 Unclassified 1083
344 Ga0395898_0221671 3300037466 Bacteria 1804
345 Ga0395905_0043353 3300037471 Bacteria 4221
346 Ga0395901_0064899 3300038443 Bacteria 3801
347 Ga0451853_1345624 3300041512 Bacteria 986
348 Ga0451577_0000121 3300042876 Bacteria 172135
349 Ga0451577_0005336 3300042876 Bacteria 13203
350 Ga0451577_0024334 3300042876 Bacteria 5510
351 Ga0453683_0012065 3300044673 Bacteria 5675
352 Ga0453683_0257381 3300044673 Bacteria 1113
353 Ga0466963_0190395 3300044694 Bacteria 1433
354 Ga0453684_0000227 3300044712 Bacteria 244655
355 Ga0453684_0010500 3300044712 Bacteria 15820
356 Ga0453684_0011206 3300044712 Bacteria 15095
357 Ga0453684_0030741 3300044712 Bacteria 7576
358 Ga0453684_0056209 3300044712 Bacteria 5106
359 Ga0453684_0283149 3300044712 Bacteria 1890
360 Ga0451576_0003888 3300045051 Bacteria 19997
361 Ga0451576_0224594 3300045051 Bacteria 1961
362 Ga0466967_0239918 3300045976 Bacteria 1729
363 Ga0495580_0170507 3300046472 Bacteria 1505
364 Ga0495598_0135829 3300046537 Bacteria 847
365 Ga0496101_0063504 3300048904 Unclassified 2688
366 Ga0496101_0387542 3300048904 Bacteria 1100
367 Ga0496104_0143938 3300048907 Bacteria 2289
368 Ga0496105_0012283 3300048908 Bacteria 6781
369 Ga0496106_0000779 3300048909 Bacteria 23016
370 Ga0496106_0053196 3300048909 Bacteria 3057
371 Ga0496107_0027118 3300048910 Bacteria 4067
372 Ga0496108_0008085 3300048911 Bacteria 8533
373 Ga0496109_0004103 3300048912 Bacteria 12173
374 Ga0496109_0409053 3300048912 Bacteria 1282
375 Ga0496110_0010969 3300048913 Bacteria 7393
376 Ga0496110_0192675 3300048913 Unclassified 1851
377 Ga0496114_0164085 3300048917 Bacteria 1933
378 Ga0496118_0043741 3300048921 Bacteria 3516
379 Ga0501031_0183522 3300049568 Bacteria 1366
380 Ga0501032_0007054 3300049569 Bacteria 8244
381 Ga0501032_0019576 3300049569 Bacteria 4733
382 Ga0501032_0169389 3300049569 Bacteria 1432
383 Ga0501033_0000253 3300049570 Bacteria 51648
384 Ga0501033_0012037 3300049570 Bacteria 6604
385 Ga0501034_0001222 3300049571 Bacteria 35142
386 Ga0501034_0014473 3300049571 Bacteria 8123
387 Ga0501034_0156346 3300049571 Bacteria 2253
388 Ga0501036_0001687 3300049572 Bacteria 17142
389 Ga0501036_0036253 3300049572 Bacteria 4173
390 Ga0501037_0003126 3300049573 Bacteria 12006
391 Ga0501037_0167685 3300049573 Bacteria 1562
392 Ga0501037_0295792 3300049573 Bacteria 1125
393 Ga0501038_0007353 3300049574 Bacteria 10161
394 Ga0501038_0047245 3300049574 Bacteria 3729
395 Ga0501039_0005731 3300049575 Bacteria 9408
396 Ga0501039_0047435 3300049575 Bacteria 3320
397 Ga0501040_0100961 3300049576 Bacteria 2012
398 Ga0501043_0045794 3300049579 Bacteria 3439
399 Ga0501043_0060821 3300049579 Bacteria 2965
400 Ga0501046_0026708 3300049580 Bacteria 4715
401 Ga0501046_0109597 3300049580 Bacteria 2110
402 Ga0501047_0000238 3300049581 Bacteria 65182
403 Ga0501047_0026549 3300049581 Bacteria 5572
404 Ga0501047_0046190 3300049581 Bacteria 4208
405 Ga0501067_0000055 3300049583 Bacteria 66700
406 Ga0501067_0006731 3300049583 Bacteria 6375
407 Ga0501068_0002026 3300049584 Bacteria 10787
408 Ga0501068_0002629 3300049584 Bacteria 9514
409 Ga0501069_0004152 3300049585 Bacteria 7482
410 Ga0501069_0004184 3300049585 Bacteria 7458
411 Ga0501070_0005863 3300049586 Bacteria 10473
412 Ga0501070_0053105 3300049586 Bacteria 3362
413 Ga0501070_0263679 3300049586 Bacteria 1408
414 Ga0501071_0004253 3300049587 Bacteria 9068
415 Ga0501072_0012242 3300049588 Bacteria 6555
416 Ga0501073_0000072 3300049589 Bacteria 62953
417 Ga0501073_0070075 3300049589 Bacteria 2443
418 Ga0501073_0108741 3300049589 Bacteria 1924
419 Ga0501073_0111153 3300049589 Bacteria 1900
420 Ga0501073_0220355 3300049589 Bacteria 1310
421 Ga0501074_0003782 3300049590 Bacteria 10752
422 Ga0501074_0007967 3300049590 Bacteria 7673
423 Ga0501074_0025965 3300049590 Bacteria 4248
424 Ga0501076_0070586 3300049592 Bacteria 2793
425 Ga0501077_0096100 3300049593 Bacteria 1878
426 Ga0501079_0013054 3300049741 Bacteria 6336
427 Ga0501079_0026009 3300049741 Bacteria 4488
428 Ga0501080_0000097 3300049742 Bacteria 59356
429 Ga0501080_0024614 3300049742 Bacteria 5582
430 Ga0501080_0028762 3300049742 Bacteria 5174
431 Ga0501080_0110707 3300049742 Bacteria 2545
432 Ga0501080_0283956 3300049742 Bacteria 1504
433 Ga0501081_0012136 3300049743 Bacteria 5650
434 Ga0501083_0000128 3300049744 Bacteria 51820
435 Ga0501035_0010585 3300049822 Bacteria 8542
436 Ga0501035_0123293 3300049822 Bacteria 2263
437 Ga0501044_0004361 3300049823 Bacteria 15845
438 Ga0501044_0005237 3300049823 Bacteria 14426
439 Ga0501044_0005861 3300049823 Bacteria 13610
440 Ga0501044_0017680 3300049823 Bacteria 7647
441 Ga0501044_0090744 3300049823 Bacteria 3082
442 Ga0501044_0091891 3300049823 Bacteria 3061
443 Ga0501045_0006433 3300049824 Bacteria 8136
444 nmdc:mga08y16_55101_c1 3300050511 Bacteria 4156
445 nmdc:mga0n895_167712_c1 3300050512 Bacteria 2227
446 nmdc:mga0n895_923825_c1 3300050512 Bacteria 857
447 Ga0501084_0034902 3300054114 Bacteria 4206
448 Ga0501082_0066481 3300060353 Bacteria 3105
449 Ga0530510_0014611 3300061734 Bacteria 5541
450 Ga0530510_0205312 3300061734 Bacteria 1464

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028573 Ga0265334_10003957 Ga0265334_100039574 225
2 3300009093 Ga0105240_10365809 Ga0105240_103658093 227
3 3300025913 Ga0207695_10682970 Ga0207695_106829702 227
4 3300025914 Ga0207671_10065182 Ga0207671_100651822 227
5 3300031507 Ga0307509_10103487 Ga0307509_101034874 232
6 3300028573 Ga0265334_10003910 Ga0265334_100039104 233
7 3300028800 Ga0265338_10009757 Ga0265338_100097575 233
8 3300005354 Ga0070675_100452752 Ga0070675_1004527521 236
9 3300005295 Ga0065707_10106015 Ga0065707_101060154 237
10 3300005842 Ga0068858_100000081 Ga0068858_10000008194 237
11 3300009177 Ga0105248_10000889 Ga0105248_1000088932 237
12 3300014325 Ga0163163_10148613 Ga0163163_101486133 237
13 3300014968 Ga0157379_10000042 Ga0157379_100000423 237
14 3300025941 Ga0207711_10001041 Ga0207711_1000104125 237
15 3300026035 Ga0207703_10000089 Ga0207703_1000008934 237
16 3300044673 Ga0453683_0012065 Ga0453683_0012065_4141_4884 237
17 3300045051 Ga0451576_0003888 Ga0451576_0003888_3388_4131 237
18 3300028800 Ga0265338_10286307 Ga0265338_102863072 238
19 3300037471 Ga0395905_0043353 Ga0395905_0043353_1485_2240 238
20 iso_pu_bacteria 2574179768 2574431601 239
21 3300048921 Ga0496118_0043741 Ga0496118_0043741_2229_2993 240
22 3300025918 Ga0207662_10298344 Ga0207662_102983442 241
23 3300025921 Ga0207652_10246632 Ga0207652_102466322 241
24 3300003322 rootL2_10103520 rootL2_101035202 242
25 3300003323 rootH1_10036757 rootH1_100367575 242
26 3300005344 Ga0070661_100033659 Ga0070661_1000336596 243
27 3300009093 Ga0105240_10599778 Ga0105240_105997782 243
28 3300025924 Ga0207694_10060709 Ga0207694_100607091 243
29 3300036712 Ga0316584_0337873 Ga0316584_0337873_194_982 243
30 3300042876 Ga0451577_0005336 Ga0451577_0005336_7750_8514 243
31 3300044712 Ga0453684_0056209 Ga0453684_0056209_1322_2086 243
32 3300049742 Ga0501080_0024614 Ga0501080_0024614_1807_2577 243
33 3300006914 Ga0075436_100052207 Ga0075436_1000522072 244
34 3300025916 Ga0207663_10035131 Ga0207663_100351312 244
35 3300005435 Ga0070714_100175902 Ga0070714_1001759022 245
36 3300005458 Ga0070681_10032422 Ga0070681_100324223 245
37 3300005614 Ga0068856_100685631 Ga0068856_1006856311 245
38 3300013104 Ga0157370_10003304 Ga0157370_1000330415 245
39 3300013104 Ga0157370_10332731 Ga0157370_103327312 245
40 3300025917 Ga0207660_10269098 Ga0207660_102690981 245
41 3300025949 Ga0207667_10047005 Ga0207667_100470053 245
42 3300025981 Ga0207640_10684618 Ga0207640_106846182 245
43 3300026078 Ga0207702_10620914 Ga0207702_106209142 245
44 3300028558 Ga0265326_10001833 Ga0265326_100018331 245
45 3300031711 Ga0265314_10121576 Ga0265314_101215761 245
46 3300050512 nmdc:mga0n895_923825_c1 nmdc:mga0n895_923825_c1_59_826 245
47 3300042876 Ga0451577_0024334 Ga0451577_0024334_3684_4454 246
48 3300044712 Ga0453684_0030741 Ga0453684_0030741_6416_7186 246
49 3300044712 Ga0453684_0283149 Ga0453684_0283149_382_1152 246
50 3300061734 Ga0530510_0014611 Ga0530510_0014611_1635_2375 246
51 3300009176 Ga0105242_10042180 Ga0105242_100421805 249
52 3300013297 Ga0157378_10079193 Ga0157378_100791933 249
53 3300044712 Ga0453684_0011206 Ga0453684_0011206_3969_4748 249
54 3300005344 Ga0070661_100066162 Ga0070661_1000661622 250
55 3300005344 Ga0070661_100373026 Ga0070661_1003730262 250
56 3300005434 Ga0070709_10049545 Ga0070709_100495453 250
57 3300005439 Ga0070711_100013374 Ga0070711_1000133744 250
58 3300005458 Ga0070681_10035460 Ga0070681_100354602 250
59 3300005530 Ga0070679_100047639 Ga0070679_1000476392 250
60 3300005539 Ga0068853_100199527 Ga0068853_1001995273 250
61 3300005563 Ga0068855_100307480 Ga0068855_1003074802 250
62 3300005577 Ga0068857_100057290 Ga0068857_1000572902 250
63 3300005614 Ga0068856_100243516 Ga0068856_1002435162 250
64 3300005616 Ga0068852_100375639 Ga0068852_1003756392 250
65 3300005618 Ga0068864_100448583 Ga0068864_1004485831 250
66 3300005841 Ga0068863_100438649 Ga0068863_1004386492 250
67 3300006358 Ga0068871_100017712 Ga0068871_1000177123 250
68 3300006871 Ga0075434_100404051 Ga0075434_1004040511 250
69 3300006881 Ga0068865_100019854 Ga0068865_1000198543 250
70 3300009098 Ga0105245_10054255 Ga0105245_100542553 250
71 3300013105 Ga0157369_10167262 Ga0157369_101672623 250
72 3300013296 Ga0157374_10362714 Ga0157374_103627142 250
73 3300013306 Ga0163162_10162782 Ga0163162_101627825 250
74 3300013308 Ga0157375_10023845 Ga0157375_100238459 250
75 3300014969 Ga0157376_10176576 Ga0157376_101765762 250
76 3300025321 Ga0207656_10160204 Ga0207656_101602041 250
77 3300025912 Ga0207707_10213565 Ga0207707_102135652 250
78 3300025916 Ga0207663_10088651 Ga0207663_100886512 250
79 3300025920 Ga0207649_10044707 Ga0207649_100447072 250
80 3300025920 Ga0207649_10174008 Ga0207649_101740082 250
81 3300025921 Ga0207652_10181358 Ga0207652_101813582 250
82 3300025944 Ga0207661_10447956 Ga0207661_104479562 250
83 3300026023 Ga0207677_10120388 Ga0207677_101203882 250
84 3300026041 Ga0207639_10193379 Ga0207639_101933792 250
85 3300026088 Ga0207641_10577652 Ga0207641_105776522 250
86 3300026089 Ga0207648_10015340 Ga0207648_100153403 250
87 3300026116 Ga0207674_10121050 Ga0207674_101210502 250
88 3300049569 Ga0501032_0169389 Ga0501032_0169389_211_993 250
89 3300049571 Ga0501034_0001222 Ga0501034_0001222_5007_5789 250
90 3300049573 Ga0501037_0295792 Ga0501037_0295792_262_1044 250
91 3300049574 Ga0501038_0047245 Ga0501038_0047245_770_1552 250
92 3300049581 Ga0501047_0000238 Ga0501047_0000238_28017_28799 250
93 3300049583 Ga0501067_0000055 Ga0501067_0000055_36169_36951 250
94 3300049584 Ga0501068_0002629 Ga0501068_0002629_2669_3451 250
95 3300049585 Ga0501069_0004152 Ga0501069_0004152_61_843 250
96 3300049586 Ga0501070_0005863 Ga0501070_0005863_8967_9749 250
97 3300049588 Ga0501072_0012242 Ga0501072_0012242_3447_4229 250
98 3300049589 Ga0501073_0000072 Ga0501073_0000072_49578_50360 250
99 3300049589 Ga0501073_0108741 Ga0501073_0108741_12_803 250
100 3300049590 Ga0501074_0025965 Ga0501074_0025965_437_1219 250
101 3300049741 Ga0501079_0026009 Ga0501079_0026009_3216_3998 250
102 3300049742 Ga0501080_0000097 Ga0501080_0000097_45307_46089 250
103 3300049742 Ga0501080_0110707 Ga0501080_0110707_135_926 250
104 3300049744 Ga0501083_0000128 Ga0501083_0000128_42315_43097 250
105 3300049823 Ga0501044_0005861 Ga0501044_0005861_10206_10988 250
106 3300049823 Ga0501044_0090744 Ga0501044_0090744_1608_2399 250
107 3300050512 nmdc:mga0n895_167712_c1 nmdc:mga0n895_167712_c1_785_1567 250
108 3300005340 Ga0070689_100027011 Ga0070689_1000270113 251
109 3300005354 Ga0070675_100035179 Ga0070675_1000351793 251
110 3300005364 Ga0070673_100100648 Ga0070673_1001006483 251
111 3300005365 Ga0070688_100001676 Ga0070688_10000167612 251
112 3300005543 Ga0070672_100159074 Ga0070672_1001590742 251
113 3300005719 Ga0068861_100158453 Ga0068861_1001584532 251
114 3300005719 Ga0068861_100387849 Ga0068861_1003878492 251
115 3300005842 Ga0068858_100097726 Ga0068858_1000977263 251
116 3300009098 Ga0105245_10329147 Ga0105245_103291472 251
117 3300013308 Ga0157375_10096465 Ga0157375_100964652 251
118 3300014745 Ga0157377_10119323 Ga0157377_101193232 251
119 3300025901 Ga0207688_10071054 Ga0207688_100710543 251
120 3300025908 Ga0207643_10010555 Ga0207643_100105553 251
121 3300025923 Ga0207681_10150447 Ga0207681_101504472 251
122 3300025926 Ga0207659_10015085 Ga0207659_100150852 251
123 3300025927 Ga0207687_10419598 Ga0207687_104195982 251
124 3300025936 Ga0207670_10030216 Ga0207670_100302166 251
125 3300025940 Ga0207691_10048455 Ga0207691_100484552 251
126 3300025945 Ga0207679_10308440 Ga0207679_103084402 251
127 3300025960 Ga0207651_10208977 Ga0207651_102089772 251
128 3300026035 Ga0207703_10012794 Ga0207703_100127947 251
129 3300026116 Ga0207674_10010316 Ga0207674_100103164 251
130 3300026118 Ga0207675_100058830 Ga0207675_1000588306 251
131 3300031730 Ga0307516_10027474 Ga0307516_100274742 251
132 3300049568 Ga0501031_0183522 Ga0501031_0183522_197_994 251
133 3300049569 Ga0501032_0007054 Ga0501032_0007054_5508_6305 251
134 3300049569 Ga0501032_0019576 Ga0501032_0019576_3452_4249 251
135 3300049570 Ga0501033_0000253 Ga0501033_0000253_37883_38680 251
136 3300049570 Ga0501033_0012037 Ga0501033_0012037_291_1088 251
137 3300049571 Ga0501034_0014473 Ga0501034_0014473_4016_4813 251
138 3300049571 Ga0501034_0156346 Ga0501034_0156346_267_1064 251
139 3300049572 Ga0501036_0001687 Ga0501036_0001687_8915_9712 251
140 3300049572 Ga0501036_0036253 Ga0501036_0036253_2867_3664 251
141 3300049573 Ga0501037_0003126 Ga0501037_0003126_4284_5081 251
142 3300049573 Ga0501037_0167685 Ga0501037_0167685_256_1053 251
143 3300049574 Ga0501038_0007353 Ga0501038_0007353_976_1773 251
144 3300049575 Ga0501039_0005731 Ga0501039_0005731_2288_3085 251
145 3300049575 Ga0501039_0047435 Ga0501039_0047435_2189_2986 251
146 3300049576 Ga0501040_0100961 Ga0501040_0100961_372_1169 251
147 3300049579 Ga0501043_0045794 Ga0501043_0045794_1190_1987 251
148 3300049579 Ga0501043_0060821 Ga0501043_0060821_1706_2503 251
149 3300049580 Ga0501046_0026708 Ga0501046_0026708_2392_3189 251
150 3300049580 Ga0501046_0109597 Ga0501046_0109597_91_888 251
151 3300049581 Ga0501047_0026549 Ga0501047_0026549_4115_4912 251
152 3300049581 Ga0501047_0046190 Ga0501047_0046190_545_1342 251
153 3300049583 Ga0501067_0006731 Ga0501067_0006731_525_1322 251
154 3300049584 Ga0501068_0002026 Ga0501068_0002026_3771_4568 251
155 3300049585 Ga0501069_0004184 Ga0501069_0004184_6022_6819 251
156 3300049586 Ga0501070_0053105 Ga0501070_0053105_2189_2986 251
157 3300049586 Ga0501070_0263679 Ga0501070_0263679_591_1388 251
158 3300049587 Ga0501071_0004253 Ga0501071_0004253_6716_7513 251
159 3300049589 Ga0501073_0070075 Ga0501073_0070075_1390_2187 251
160 3300049589 Ga0501073_0111153 Ga0501073_0111153_976_1773 251
161 3300049589 Ga0501073_0220355 Ga0501073_0220355_179_976 251
162 3300049590 Ga0501074_0003782 Ga0501074_0003782_9411_10208 251
163 3300049590 Ga0501074_0007967 Ga0501074_0007967_1321_2118 251
164 3300049592 Ga0501076_0070586 Ga0501076_0070586_668_1465 251
165 3300049593 Ga0501077_0096100 Ga0501077_0096100_844_1641 251
166 3300049741 Ga0501079_0013054 Ga0501079_0013054_163_960 251
167 3300049742 Ga0501080_0028762 Ga0501080_0028762_163_960 251
168 3300049742 Ga0501080_0283956 Ga0501080_0283956_198_995 251
169 3300049743 Ga0501081_0012136 Ga0501081_0012136_4350_5147 251
170 3300049822 Ga0501035_0010585 Ga0501035_0010585_7031_7828 251
171 3300049822 Ga0501035_0123293 Ga0501035_0123293_976_1773 251
172 3300049823 Ga0501044_0004361 Ga0501044_0004361_13091_13888 251
173 3300049823 Ga0501044_0005237 Ga0501044_0005237_4337_5134 251
174 3300049823 Ga0501044_0017680 Ga0501044_0017680_1340_2137 251
175 3300049823 Ga0501044_0091891 Ga0501044_0091891_1033_1830 251
176 3300049824 Ga0501045_0006433 Ga0501045_0006433_5684_6481 251
177 3300054114 Ga0501084_0034902 Ga0501084_0034902_1802_2599 251
178 3300060353 Ga0501082_0066481 Ga0501082_0066481_462_1259 251
179 3300061734 Ga0530510_0205312 Ga0530510_0205312_112_909 251
180 3300005339 Ga0070660_100519421 Ga0070660_1005194211 252
181 3300005366 Ga0070659_100135699 Ga0070659_1001356991 252
182 3300005366 Ga0070659_100160246 Ga0070659_1001602462 252
183 3300005458 Ga0070681_10011292 Ga0070681_100112921 252
184 3300005458 Ga0070681_10133685 Ga0070681_101336852 252
185 3300005530 Ga0070679_100034494 Ga0070679_1000344945 252
186 3300005530 Ga0070679_100270465 Ga0070679_1002704652 252
187 3300005563 Ga0068855_100044903 Ga0068855_1000449033 252
188 3300005563 Ga0068855_100238306 Ga0068855_1002383062 252
189 3300005563 Ga0068855_100662948 Ga0068855_1006629482 252
190 3300005563 Ga0068855_100791462 Ga0068855_1007914621 252
191 3300005564 Ga0070664_100027305 Ga0070664_1000273054 252
192 3300005578 Ga0068854_100166885 Ga0068854_1001668852 252
193 3300005614 Ga0068856_100002579 Ga0068856_1000025793 252
194 3300009098 Ga0105245_10057297 Ga0105245_100572974 252
195 3300013104 Ga0157370_10043567 Ga0157370_100435674 252
196 3300013104 Ga0157370_10089956 Ga0157370_100899562 252
197 3300013307 Ga0157372_10009633 Ga0157372_100096336 252
198 3300013307 Ga0157372_10033848 Ga0157372_100338484 252
199 3300013307 Ga0157372_10117129 Ga0157372_101171294 252
200 3300013307 Ga0157372_10217748 Ga0157372_102177482 252
201 3300025912 Ga0207707_10070719 Ga0207707_100707193 252
202 3300025912 Ga0207707_10118350 Ga0207707_101183503 252
203 3300025913 Ga0207695_10719110 Ga0207695_107191101 252
204 3300025919 Ga0207657_10011363 Ga0207657_100113637 252
205 3300025919 Ga0207657_10153853 Ga0207657_101538533 252
206 3300025920 Ga0207649_10151475 Ga0207649_101514752 252
207 3300025921 Ga0207652_10030415 Ga0207652_100304152 252
208 3300025921 Ga0207652_10754346 Ga0207652_107543461 252
209 3300025927 Ga0207687_10134524 Ga0207687_101345243 252
210 3300025929 Ga0207664_10027030 Ga0207664_100270305 252
211 3300025932 Ga0207690_10044205 Ga0207690_100442052 252
212 3300025932 Ga0207690_10199142 Ga0207690_101991422 252
213 3300025949 Ga0207667_10027041 Ga0207667_100270411 252
214 3300025949 Ga0207667_10506297 Ga0207667_105062972 252
215 3300025949 Ga0207667_10562939 Ga0207667_105629391 252
216 3300025949 Ga0207667_10709777 Ga0207667_107097771 252
217 3300026078 Ga0207702_10047555 Ga0207702_100475553 252
218 3300038443 Ga0395901_0064899 Ga0395901_0064899_405_1193 252
219 3300042876 Ga0451577_0000121 Ga0451577_0000121_34615_35403 252
220 3300044694 Ga0466963_0190395 Ga0466963_0190395_603_1391 252
221 3300044712 Ga0453684_0000227 Ga0453684_0000227_75600_76388 252
222 3300045976 Ga0466967_0239918 Ga0466967_0239918_96_884 252
223 3300005367 Ga0070667_100059119 Ga0070667_1000591192 253
224 3300005468 Ga0070707_100355490 Ga0070707_1003554902 253
225 3300005536 Ga0070697_100119943 Ga0070697_1001199431 253
226 3300005545 Ga0070695_100100000 Ga0070695_1001000002 253
227 3300005548 Ga0070665_100748084 Ga0070665_1007480842 253
228 3300005549 Ga0070704_100005373 Ga0070704_1000053733 253
229 3300006852 Ga0075433_10182227 Ga0075433_101822273 253
230 3300014497 Ga0182008_10044508 Ga0182008_100445083 253
231 3300025960 Ga0207651_10465406 Ga0207651_104654062 253
232 3300025972 Ga0207668_10440903 Ga0207668_104409032 253
233 3300025986 Ga0207658_10101699 Ga0207658_101016992 253
234 3300027543 Ga0209999_1008422 Ga0209999_10084222 253
235 3300027552 Ga0209982_1005689 Ga0209982_10056891 253
236 3300027682 Ga0209971_1004719 Ga0209971_10047193 253
237 3300027876 Ga0209974_10000775 Ga0209974_100007752 253
238 3300005290 Ga0065712_10148464 Ga0065712_101484642 254
239 3300005329 Ga0070683_100005520 Ga0070683_1000055204 254
240 3300005339 Ga0070660_100000483 Ga0070660_1000004833 254
241 3300005344 Ga0070661_100018125 Ga0070661_1000181253 254
242 3300005344 Ga0070661_100059967 Ga0070661_1000599672 254
243 3300005345 Ga0070692_10031581 Ga0070692_100315814 254
244 3300005354 Ga0070675_100090951 Ga0070675_1000909512 254
245 3300005355 Ga0070671_100001539 Ga0070671_10000153924 254
246 3300005355 Ga0070671_100047697 Ga0070671_1000476972 254
247 3300005364 Ga0070673_100009292 Ga0070673_1000092927 254
248 3300005366 Ga0070659_100005159 Ga0070659_1000051594 254
249 3300005366 Ga0070659_100022296 Ga0070659_1000222964 254
250 3300005366 Ga0070659_100255171 Ga0070659_1002551712 254
251 3300005367 Ga0070667_100312218 Ga0070667_1003122181 254
252 3300005457 Ga0070662_100000180 Ga0070662_10000018030 254
253 3300005457 Ga0070662_100359988 Ga0070662_1003599882 254
254 3300005535 Ga0070684_100000955 Ga0070684_10000095515 254
255 3300005539 Ga0068853_100009357 Ga0068853_10000935711 254
256 3300005543 Ga0070672_100024146 Ga0070672_1000241464 254
257 3300005563 Ga0068855_100010749 Ga0068855_10001074912 254
258 3300005563 Ga0068855_100053791 Ga0068855_1000537914 254
259 3300005564 Ga0070664_100089212 Ga0070664_1000892123 254
260 3300005564 Ga0070664_100132036 Ga0070664_1001320363 254
261 3300005577 Ga0068857_100078371 Ga0068857_1000783712 254
262 3300005578 Ga0068854_100000368 Ga0068854_10000036817 254
263 3300005614 Ga0068856_100002139 Ga0068856_10000213911 254
264 3300005616 Ga0068852_100014731 Ga0068852_1000147316 254
265 3300005834 Ga0068851_10182189 Ga0068851_101821892 254
266 3300007076 Ga0075435_100642289 Ga0075435_1006422891 254
267 3300009093 Ga0105240_10383128 Ga0105240_103831282 254
268 3300009174 Ga0105241_10005804 Ga0105241_100058043 254
269 3300009545 Ga0105237_10087781 Ga0105237_100877814 254
270 3300009551 Ga0105238_10163490 Ga0105238_101634902 254
271 3300010375 Ga0105239_10058466 Ga0105239_100584664 254
272 3300013100 Ga0157373_10012903 Ga0157373_100129037 254
273 3300013102 Ga0157371_10000194 Ga0157371_1000019445 254
274 3300013104 Ga0157370_10316506 Ga0157370_103165062 254
275 3300013105 Ga0157369_10201779 Ga0157369_102017792 254
276 3300013307 Ga0157372_10002446 Ga0157372_1000244617 254
277 3300013307 Ga0157372_10101505 Ga0157372_101015053 254
278 3300020070 Ga0206356_10503798 Ga0206356_105037983 254
279 3300025321 Ga0207656_10045152 Ga0207656_100451522 254
280 3300025321 Ga0207656_10133424 Ga0207656_101334241 254
281 3300025906 Ga0207699_10064085 Ga0207699_100640852 254
282 3300025909 Ga0207705_10032632 Ga0207705_100326325 254
283 3300025911 Ga0207654_10040820 Ga0207654_100408202 254
284 3300025912 Ga0207707_10056659 Ga0207707_100566593 254
285 3300025913 Ga0207695_10054905 Ga0207695_100549054 254
286 3300025914 Ga0207671_10067865 Ga0207671_100678653 254
287 3300025914 Ga0207671_10070521 Ga0207671_100705212 254
288 3300025916 Ga0207663_10086276 Ga0207663_100862761 254
289 3300025917 Ga0207660_10007544 Ga0207660_100075444 254
290 3300025919 Ga0207657_10002677 Ga0207657_1000267720 254
291 3300025919 Ga0207657_10018193 Ga0207657_100181933 254
292 3300025920 Ga0207649_10040789 Ga0207649_100407892 254
293 3300025920 Ga0207649_10044402 Ga0207649_100444022 254
294 3300025920 Ga0207649_10065172 Ga0207649_100651722 254
295 3300025921 Ga0207652_10036611 Ga0207652_100366114 254
296 3300025923 Ga0207681_10057028 Ga0207681_100570282 254
297 3300025924 Ga0207694_10078485 Ga0207694_100784853 254
298 3300025926 Ga0207659_10035630 Ga0207659_100356304 254
299 3300025926 Ga0207659_10065635 Ga0207659_100656352 254
300 3300025929 Ga0207664_10017655 Ga0207664_100176552 254
301 3300025931 Ga0207644_10000646 Ga0207644_1000064620 254
302 3300025932 Ga0207690_10000286 Ga0207690_1000028628 254
303 3300025932 Ga0207690_10135063 Ga0207690_101350632 254
304 3300025933 Ga0207706_10000002 Ga0207706_10000002256 254
305 3300025944 Ga0207661_10108085 Ga0207661_101080853 254
306 3300025945 Ga0207679_10006473 Ga0207679_100064737 254
307 3300025945 Ga0207679_10116926 Ga0207679_101169262 254
308 3300025945 Ga0207679_10156518 Ga0207679_101565182 254
309 3300025949 Ga0207667_10003835 Ga0207667_100038357 254
310 3300025949 Ga0207667_10004238 Ga0207667_1000423816 254
311 3300025949 Ga0207667_10114121 Ga0207667_101141212 254
312 3300025960 Ga0207651_10005314 Ga0207651_100053144 254
313 3300025981 Ga0207640_10027725 Ga0207640_100277254 254
314 3300026041 Ga0207639_10020373 Ga0207639_100203733 254
315 3300026041 Ga0207639_10138581 Ga0207639_101385812 254
316 3300026067 Ga0207678_10118206 Ga0207678_101182063 254
317 3300026078 Ga0207702_10001927 Ga0207702_1000192716 254
318 3300026078 Ga0207702_10207864 Ga0207702_102078642 254
319 3300026116 Ga0207674_10000237 Ga0207674_1000023760 254
320 3300026116 Ga0207674_10084531 Ga0207674_100845313 254
321 3300026116 Ga0207674_10275865 Ga0207674_102758651 254
322 3300026142 Ga0207698_10022593 Ga0207698_100225934 254
323 3300027876 Ga0209974_10007997 Ga0209974_100079974 254
324 3300031731 Ga0307405_10001108 Ga0307405_1000110812 254
325 3300031824 Ga0307413_10000680 Ga0307413_100006809 254
326 3300031852 Ga0307410_10001273 Ga0307410_100012737 254
327 3300031911 Ga0307412_10183640 Ga0307412_101836402 254
328 3300031995 Ga0307409_100002727 Ga0307409_1000027272 254
329 3300032126 Ga0307415_100005995 Ga0307415_1000059957 254
330 3300035691 Ga0373931_0252699 Ga0373931_0252699_195_989 254
331 3300035695 Ga0373927_0138661 Ga0373927_0138661_250_1047 254
332 3300035725 Ga0373947_0422955 Ga0373947_0422955_22_786 254
333 3300037466 Ga0395898_0221671 Ga0395898_0221671_447_1250 254
334 3300041512 Ga0451853_1345624 Ga0451853_1345624_23_817 254
335 3300044673 Ga0453683_0257381 Ga0453683_0257381_164_961 254
336 3300044712 Ga0453684_0010500 Ga0453684_0010500_14867_15664 254
337 3300045051 Ga0451576_0224594 Ga0451576_0224594_995_1792 254
338 3300046472 Ga0495580_0170507 Ga0495580_0170507_79_876 254
339 3300048904 Ga0496101_0063504 Ga0496101_0063504_1300_2094 254
340 3300048904 Ga0496101_0387542 Ga0496101_0387542_106_900 254
341 3300048909 Ga0496106_0000779 Ga0496106_0000779_14193_14987 254
342 3300048913 Ga0496110_0192675 Ga0496110_0192675_30_824 254
343 3300001991 JGI24743J22301_10007484 JGI24743J22301_100074842 255
344 3300005293 Ga0065715_10349467 Ga0065715_103494671 255
345 3300005328 Ga0070676_10049627 Ga0070676_100496271 255
346 3300005329 Ga0070683_100021430 Ga0070683_1000214302 255
347 3300005330 Ga0070690_100021250 Ga0070690_1000212503 255
348 3300005331 Ga0070670_100077568 Ga0070670_1000775682 255
349 3300005333 Ga0070677_10033650 Ga0070677_100336502 255
350 3300005334 Ga0068869_100016466 Ga0068869_1000164662 255
351 3300005335 Ga0070666_10025432 Ga0070666_100254322 255
352 3300005335 Ga0070666_10050618 Ga0070666_100506182 255
353 3300005338 Ga0068868_100097728 Ga0068868_1000977282 255
354 3300005339 Ga0070660_100120612 Ga0070660_1001206122 255
355 3300005340 Ga0070689_100011771 Ga0070689_1000117712 255
356 3300005343 Ga0070687_100014609 Ga0070687_1000146092 255
357 3300005345 Ga0070692_10054275 Ga0070692_100542752 255
358 3300005353 Ga0070669_100129175 Ga0070669_1001291752 255
359 3300005354 Ga0070675_100332901 Ga0070675_1003329012 255
360 3300005355 Ga0070671_100006349 Ga0070671_1000063492 255
361 3300005355 Ga0070671_100296473 Ga0070671_1002964731 255
362 3300005356 Ga0070674_100286207 Ga0070674_1002862071 255
363 3300005364 Ga0070673_100011373 Ga0070673_1000113735 255
364 3300005365 Ga0070688_100007052 Ga0070688_1000070523 255
365 3300005366 Ga0070659_100019023 Ga0070659_1000190232 255
366 3300005455 Ga0070663_100251615 Ga0070663_1002516152 255
367 3300005456 Ga0070678_100487723 Ga0070678_1004877231 255
368 3300005457 Ga0070662_100294075 Ga0070662_1002940752 255
369 3300005466 Ga0070685_10003791 Ga0070685_100037912 255
370 3300005543 Ga0070672_100024480 Ga0070672_1000244802 255
371 3300005543 Ga0070672_100107041 Ga0070672_1001070412 255
372 3300005544 Ga0070686_100014903 Ga0070686_1000149031 255
373 3300005547 Ga0070693_100084634 Ga0070693_1000846342 255
374 3300005548 Ga0070665_100020075 Ga0070665_1000200753 255
375 3300005564 Ga0070664_100016201 Ga0070664_1000162013 255
376 3300005564 Ga0070664_100073520 Ga0070664_1000735202 255
377 3300005577 Ga0068857_100030320 Ga0068857_1000303202 255
378 3300005578 Ga0068854_100175420 Ga0068854_1001754201 255
379 3300005614 Ga0068856_100120764 Ga0068856_1001207642 255
380 3300005616 Ga0068852_100014358 Ga0068852_1000143583 255
381 3300005617 Ga0068859_100071432 Ga0068859_1000714322 255
382 3300005718 Ga0068866_10011808 Ga0068866_100118082 255
383 3300005719 Ga0068861_100023515 Ga0068861_1000235153 255
384 3300005840 Ga0068870_10018782 Ga0068870_100187822 255
385 3300005841 Ga0068863_100028841 Ga0068863_1000288412 255
386 3300005843 Ga0068860_100436507 Ga0068860_1004365072 255
387 3300005844 Ga0068862_100022663 Ga0068862_1000226631 255
388 3300006881 Ga0068865_100039315 Ga0068865_1000393152 255
389 3300006931 Ga0097620_100071428 Ga0097620_1000714282 255
390 3300009148 Ga0105243_10292589 Ga0105243_102925892 255
391 3300009176 Ga0105242_10029842 Ga0105242_100298423 255
392 3300009177 Ga0105248_10004349 Ga0105248_1000434910 255
393 3300009553 Ga0105249_10046062 Ga0105249_100460622 255
394 3300011119 Ga0105246_10066307 Ga0105246_100663072 255
395 3300013297 Ga0157378_10041256 Ga0157378_100412563 255
396 3300013306 Ga0163162_10161405 Ga0163162_101614052 255
397 3300013307 Ga0157372_10071325 Ga0157372_100713253 255
398 3300014325 Ga0163163_10108464 Ga0163163_101084642 255
399 3300014745 Ga0157377_10008087 Ga0157377_100080872 255
400 3300025315 Ga0207697_10001106 Ga0207697_1000110616 255
401 3300025893 Ga0207682_10001444 Ga0207682_100014443 255
402 3300025899 Ga0207642_10007438 Ga0207642_100074382 255
403 3300025903 Ga0207680_10051579 Ga0207680_100515791 255
404 3300025907 Ga0207645_10010172 Ga0207645_100101726 255
405 3300025908 Ga0207643_10002281 Ga0207643_1000228111 255
406 3300025918 Ga0207662_10003933 Ga0207662_100039339 255
407 3300025919 Ga0207657_10027365 Ga0207657_100273653 255
408 3300025925 Ga0207650_10015479 Ga0207650_100154792 255
409 3300025926 Ga0207659_10042852 Ga0207659_100428522 255
410 3300025931 Ga0207644_10012522 Ga0207644_100125224 255
411 3300025931 Ga0207644_10099966 Ga0207644_100999662 255
412 3300025933 Ga0207706_10010334 Ga0207706_1001033411 255
413 3300025933 Ga0207706_10216004 Ga0207706_102160042 255
414 3300025935 Ga0207709_10193540 Ga0207709_101935402 255
415 3300025937 Ga0207669_10141311 Ga0207669_101413112 255
416 3300025938 Ga0207704_10075143 Ga0207704_100751432 255
417 3300025940 Ga0207691_10037224 Ga0207691_100372244 255
418 3300025940 Ga0207691_10105672 Ga0207691_101056722 255
419 3300025941 Ga0207711_10011289 Ga0207711_100112899 255
420 3300025941 Ga0207711_10097704 Ga0207711_100977042 255
421 3300025942 Ga0207689_10006353 Ga0207689_100063533 255
422 3300025945 Ga0207679_10029990 Ga0207679_100299902 255
423 3300025960 Ga0207651_10006814 Ga0207651_100068142 255
424 3300025972 Ga0207668_10438945 Ga0207668_104389452 255
425 3300025981 Ga0207640_10056175 Ga0207640_100561752 255
426 3300025986 Ga0207658_10083182 Ga0207658_100831822 255
427 3300026041 Ga0207639_10232948 Ga0207639_102329482 255
428 3300026067 Ga0207678_10002599 Ga0207678_100025993 255
429 3300026075 Ga0207708_10004967 Ga0207708_100049679 255
430 3300026089 Ga0207648_10030561 Ga0207648_100305614 255
431 3300026095 Ga0207676_10113278 Ga0207676_101132781 255
432 3300026116 Ga0207674_10009051 Ga0207674_100090514 255
433 3300026116 Ga0207674_10315807 Ga0207674_103158072 255
434 3300026118 Ga0207675_100000626 Ga0207675_1000006262 255
435 3300026118 Ga0207675_100047665 Ga0207675_1000476652 255
436 3300026121 Ga0207683_10050890 Ga0207683_100508903 255
437 3300026142 Ga0207698_10051469 Ga0207698_100514693 255
438 3300027907 Ga0207428_10238290 Ga0207428_102382902 255
439 3300028379 Ga0268266_10408619 Ga0268266_104086192 255
440 3300035171 Ga0373946_0147859 Ga0373946_0147859_97_894 255
441 3300046537 Ga0495598_0135829 Ga0495598_0135829_65_832 255
442 3300048907 Ga0496104_0143938 Ga0496104_0143938_873_1670 255
443 3300048908 Ga0496105_0012283 Ga0496105_0012283_5055_5852 255
444 3300048909 Ga0496106_0053196 Ga0496106_0053196_58_855 255
445 3300048910 Ga0496107_0027118 Ga0496107_0027118_1684_2481 255
446 3300048911 Ga0496108_0008085 Ga0496108_0008085_2468_3265 255
447 3300048912 Ga0496109_0004103 Ga0496109_0004103_6326_7123 255
448 3300048912 Ga0496109_0409053 Ga0496109_0409053_247_1047 255
449 3300048913 Ga0496110_0010969 Ga0496110_0010969_2167_2964 255
450 3300048917 Ga0496114_0164085 Ga0496114_0164085_598_1395 255
451 3300050511 nmdc:mga08y16_55101_c1 nmdc:mga08y16_55101_c1_2708_3505 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

38

200

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e26-assembly1.cif.gz_A-2 crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase 0.752 2 230
7pe4-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose 0.7485 2 230
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.7478 2 230
5jud-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with uridine-diphosphate (udp) - gpgs*udp 0.7435 2 230
7pho-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.1 in complex with 4-hydroxybenzaldehyde 0.7421 2 230
ID Description Score Start End Superfamily
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8851 2 227 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8674 2 217 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8566 2 220 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.853 2 214 3.90.550.10
af_Q8WSL9_63_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8354 2 221 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A383DKP0-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9906 1 199 GO:0016757
AF-A0A2E5G6E6-F1-model_v4 Glycosyl transferase family 2 0.989 2 245 GO:0016757
AF-A0A2V8M3K3-F1-model_v4 Glycosyl transferase family 2 0.989 39 244 GO:0016740
AF-A0A3P0X608-F1-model_v4 Glycosyltransferase family 2 protein 0.9877 2 247 GO:0016757
AF-A0A6N7EZJ0-F1-model_v4 Glycosyltransferase 0.9869 1 234 GO:0016740

Feature Viewer

pLDDT pTM Quality
90.58 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map