F446723

General Info

Members Datasets Scaffolds Average Seq Length
451 286 902 191

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100723645|Ga0068868_1007236451
Length 219
Sequence VTAPAMVLRVEWACAHGSGRVPTYVKGDELPTGVAMRDAREQLFDAAERVLLRDGPEALTSRAVTTEAGCAKGVLHKHFTDFDGFLAELVLDRIRRLDDQAQVLRNAVGQGTVVDNLTTMLTDLFGSVAVAIVSLTISRDGLRARLRDAVPTGVPILTDAGRIILDYLTAEQDLGRIRADADLNSLGLTLIGSAHLLFADRTGVRPTTDEVRAFVASVV

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
151 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
237 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
238 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
239 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
240 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
241 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
242 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
243 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
244 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
245 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 2517572101 Frankia sp. DC12 Isolate Nodule
251 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
252 2558860280 Kutzneria sp. 744 Isolate Unclassified
253 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
254 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
255 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
256 2619618881 Frankia sp. ACN1ag Isolate Unclassified
257 2619619003 Frankia sp. CpI1-P Isolate Nodule
258 2643221647 Streptomyces sp. Root369 Isolate Unclassified
259 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
260 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
261 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
262 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
263 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
264 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
265 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
266 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
267 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
268 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
269 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
270 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
271 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
272 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
273 2891562705 Microbispora tritici MT50 Isolate Unclassified
274 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
275 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
276 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
277 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
278 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
279 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
280 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
281 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
282 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
283 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
284 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
285 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
286 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.35
Metatranscriptomes 0.44
Isolates 8.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0.44
Rhizoplane 1.77
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100723645 3300005338 Bacteria 892
2 JGI24739J22299_10077996 3300001989 Bacteria 1021
3 JGI25160J50197_1005475 3300003354 Bacteria 5280
4 Ga0070658_10189949 3300005327 Bacteria 1731
5 Ga0070683_100160582 3300005329 Bacteria 2132
6 Ga0070683_100594090 3300005329 Bacteria 1059
7 Ga0070670_100212083 3300005331 Bacteria 1684
8 Ga0068869_100138319 3300005334 Bacteria 1878
9 Ga0068869_100441322 3300005334 Bacteria 1077
10 Ga0070680_100167575 3300005336 Bacteria 1847
11 Ga0070680_100781123 3300005336 Bacteria 823
12 Ga0070660_100038471 3300005339 Bacteria 3632
13 Ga0070689_100183869 3300005340 Bacteria 1699
14 Ga0070691_10044710 3300005341 Bacteria 2100
15 Ga0070661_100074281 3300005344 Bacteria 2503
16 Ga0070661_100107281 3300005344 Bacteria 2083
17 Ga0070668_101537904 3300005347 Bacteria 609
18 Ga0070675_100097995 3300005354 Bacteria 2466
19 Ga0070673_100081810 3300005364 Bacteria 2620
20 Ga0070659_100021669 3300005366 Bacteria 4898
21 Ga0070714_100000937 3300005435 Bacteria 20745
22 Ga0070714_100009244 3300005435 Bacteria 7743
23 Ga0070714_100019210 3300005435 Bacteria 5562
24 Ga0070714_100521074 3300005435 Bacteria 1135
25 Ga0070710_10206673 3300005437 Bacteria 1242
26 Ga0070710_10284851 3300005437 Bacteria 1073
27 Ga0070710_10400353 3300005437 Bacteria 920
28 Ga0070701_10056902 3300005438 Bacteria 2048
29 Ga0070711_100344590 3300005439 Bacteria 1196
30 Ga0070711_100523260 3300005439 Bacteria 980
31 Ga0070711_101123960 3300005439 Bacteria 677
32 Ga0070705_100017185 3300005440 Bacteria 3772
33 Ga0070663_100252232 3300005455 Bacteria 1397
34 Ga0070678_100056940 3300005456 Bacteria 2861
35 Ga0070681_10146131 3300005458 Bacteria 2293
36 Ga0070681_10475995 3300005458 Bacteria 1161
37 Ga0070685_10010631 3300005466 Bacteria 4788
38 Ga0070685_10292771 3300005466 Bacteria 1094
39 Ga0070699_100973826 3300005518 Bacteria 778
40 Ga0070679_100004285 3300005530 Bacteria 13163
41 Ga0070679_100191742 3300005530 Bacteria 2012
42 Ga0070684_100191626 3300005535 Bacteria 1860
43 Ga0070684_100311047 3300005535 Bacteria 1446
44 Ga0070684_100884521 3300005535 Bacteria 837
45 Ga0068853_100143381 3300005539 Bacteria 2145
46 Ga0070672_100175490 3300005543 Bacteria 1784
47 Ga0070686_100035353 3300005544 Bacteria 3085
48 Ga0070695_100074659 3300005545 Bacteria 2228
49 Ga0070665_100213652 3300005548 Bacteria 1930
50 Ga0070665_100306409 3300005548 Bacteria 1592
51 Ga0070704_100059206 3300005549 Bacteria 2731
52 Ga0068855_100101384 3300005563 Bacteria 3314
53 Ga0070664_100159543 3300005564 Bacteria 1995
54 Ga0070664_100183637 3300005564 Bacteria 1860
55 Ga0068857_100214303 3300005577 Bacteria 1758
56 Ga0068854_100019309 3300005578 Bacteria 4591
57 Ga0068856_100138787 3300005614 Bacteria 2438
58 Ga0068856_100897499 3300005614 Bacteria 905
59 Ga0070702_100024447 3300005615 Bacteria 3223
60 Ga0068852_100040387 3300005616 Bacteria 3936
61 Ga0068852_100201531 3300005616 Bacteria 1883
62 Ga0068859_100275003 3300005617 Bacteria 1776
63 Ga0068864_100568300 3300005618 Bacteria 1098
64 Ga0068851_10123456 3300005834 Bacteria 1394
65 Ga0068870_10084968 3300005840 Bacteria 1758
66 Ga0068863_100023455 3300005841 Bacteria 5892
67 Ga0068858_100358014 3300005842 Bacteria 1398
68 Ga0068860_100236134 3300005843 Bacteria 1777
69 Ga0081455_10000169 3300005937 Bacteria 80959
70 Ga0081455_10438867 3300005937 Bacteria 895
71 Ga0081539_10000254 3300005985 Bacteria 123532
72 Ga0081539_10020244 3300005985 Bacteria 4506
73 Ga0070717_10339750 3300006028 Bacteria 1341
74 Ga0070715_10017956 3300006163 Bacteria 2687
75 Ga0070712_100200167 3300006175 Bacteria 1568
76 Ga0068871_100054436 3300006358 Bacteria 3246
77 Ga0097620_100274999 3300006931 Bacteria 1776
78 Ga0105251_10043703 3300009011 Bacteria 2168
79 Ga0105247_10000178 3300009101 Bacteria 61996
80 Ga0114129_10778061 3300009147 Bacteria 1223
81 Ga0105241_10002402 3300009174 Bacteria 14064
82 Ga0105241_10080908 3300009174 Bacteria 2544
83 Ga0105248_10007315 3300009177 Bacteria 12115
84 Ga0105248_10237638 3300009177 Bacteria 2051
85 Ga0105237_10067937 3300009545 Bacteria 3558
86 Ga0105238_10226632 3300009551 Bacteria 1845
87 Ga0105238_10361463 3300009551 Bacteria 1441
88 Ga0105249_10169267 3300009553 Bacteria 2117
89 Ga0105239_10253649 3300010375 Bacteria 1976
90 Ga0105239_11487004 3300010375 Bacteria 783
91 Ga0105246_10000307 3300011119 Bacteria 25935
92 Ga0157371_10084672 3300013102 Bacteria 2246
93 Ga0157370_10098415 3300013104 Bacteria 2743
94 Ga0157370_10449451 3300013104 Bacteria 1185
95 Ga0157369_10026725 3300013105 Bacteria 6402
96 Ga0157369_10152975 3300013105 Bacteria 2438
97 Ga0157374_10460232 3300013296 Bacteria 1274
98 Ga0163162_11367752 3300013306 Bacteria 805
99 Ga0157372_10675077 3300013307 Bacteria 1203
100 Ga0157372_10766714 3300013307 Bacteria 1121
101 Ga0157380_10345813 3300014326 Bacteria 1389
102 Ga0157380_11963453 3300014326 Bacteria 646
103 Ga0182008_10050614 3300014497 Bacteria 2062
104 Ga0182008_10058464 3300014497 Bacteria 1903
105 Ga0157379_10009932 3300014968 Bacteria 8287
106 Ga0157379_10730395 3300014968 Bacteria 931
107 Ga0182007_10060669 3300015262 Bacteria 1240
108 Ga0206353_11512624 3300020082 Bacteria 977
109 Ga0213875_10001983 3300021388 Bacteria 12658
110 Ga0207426_1001278 3300025302 Bacteria 21869
111 Ga0207710_10000109 3300025900 Bacteria 104351
112 Ga0207688_10018328 3300025901 Bacteria 3810
113 Ga0207647_10282796 3300025904 Bacteria 947
114 Ga0207685_10011169 3300025905 Bacteria 2687
115 Ga0207699_10023561 3300025906 Bacteria 3351
116 Ga0207705_10298886 3300025909 Bacteria 1234
117 Ga0207705_10436957 3300025909 Bacteria 1014
118 Ga0207654_10017190 3300025911 Bacteria 3778
119 Ga0207707_10099374 3300025912 Bacteria 2543
120 Ga0207695_10002892 3300025913 Bacteria 24881
121 Ga0207671_10000482 3300025914 Bacteria 54151
122 Ga0207693_10065859 3300025915 Bacteria 2837
123 Ga0207693_10151801 3300025915 Bacteria 1822
124 Ga0207660_10269436 3300025917 Bacteria 1349
125 Ga0207662_10003307 3300025918 Bacteria 8273
126 Ga0207657_10002090 3300025919 Bacteria 21602
127 Ga0207657_10573236 3300025919 Bacteria 881
128 Ga0207649_10074093 3300025920 Bacteria 2184
129 Ga0207652_10106457 3300025921 Bacteria 2482
130 Ga0207694_10061936 3300025924 Bacteria 2912
131 Ga0207659_10310541 3300025926 Bacteria 1298
132 Ga0207700_10040512 3300025928 Bacteria 3401
133 Ga0207700_10612998 3300025928 Bacteria 969
134 Ga0207664_10001327 3300025929 Bacteria 16297
135 Ga0207664_10010955 3300025929 Bacteria 6423
136 Ga0207664_10088700 3300025929 Bacteria 2531
137 Ga0207664_10468141 3300025929 Bacteria 1126
138 Ga0207664_11068410 3300025929 Bacteria 722
139 Ga0207690_10299396 3300025932 Bacteria 1258
140 Ga0207690_10354600 3300025932 Bacteria 1161
141 Ga0207709_10076891 3300025935 Bacteria 2138
142 Ga0207670_10272025 3300025936 Bacteria 1317
143 Ga0207665_10008098 3300025939 Bacteria 6938
144 Ga0207665_10013078 3300025939 Bacteria 5454
145 Ga0207691_10055782 3300025940 Bacteria 3600
146 Ga0207711_10024940 3300025941 Bacteria 5015
147 Ga0207689_10005138 3300025942 Bacteria 11767
148 Ga0207689_10083951 3300025942 Bacteria 2618
149 Ga0207689_10330326 3300025942 Bacteria 1266
150 Ga0207661_10398270 3300025944 Bacteria 1248
151 Ga0207679_10122690 3300025945 Bacteria 2071
152 Ga0207667_10007907 3300025949 Bacteria 12697
153 Ga0207667_10230570 3300025949 Bacteria 1896
154 Ga0207667_11160281 3300025949 Bacteria 753
155 Ga0207640_10160605 3300025981 Bacteria 1662
156 Ga0207678_10074163 3300026067 Bacteria 2916
157 Ga0207678_10171848 3300026067 Bacteria 1850
158 Ga0207678_10273220 3300026067 Bacteria 1450
159 Ga0207702_10343572 3300026078 Bacteria 1426
160 Ga0207702_10628900 3300026078 Bacteria 1055
161 Ga0207674_10015717 3300026116 Bacteria 8304
162 Ga0207674_10180998 3300026116 Bacteria 2059
163 Ga0207674_10604361 3300026116 Bacteria 1059
164 Ga0207675_100069055 3300026118 Bacteria 3303
165 Ga0207683_10289309 3300026121 Bacteria 1498
166 Ga0207698_10153682 3300026142 Bacteria 2001
167 Ga0268266_10284183 3300028379 Bacteria 1539
168 Ga0268266_10383936 3300028379 Bacteria 1325
169 Ga0268264_11004433 3300028381 Bacteria 841
170 Ga0307515_10001813 3300028794 Bacteria 47671
171 Ga0307515_10010455 3300028794 Bacteria 17780
172 Ga0307515_10059413 3300028794 Bacteria 5478
173 Ga0307515_10206867 3300028794 Bacteria 1819
174 Ga0307515_10231556 3300028794 Bacteria 1639
175 Ga0307511_10000710 3300030521 Bacteria 35487
176 Ga0307512_10006038 3300030522 Bacteria 12407
177 Ga0307512_10011158 3300030522 Bacteria 8528
178 Ga0307512_10133985 3300030522 Bacteria 1542
179 Ga0307512_10248260 3300030522 Bacteria 890
180 Ga0307513_10003872 3300031456 Bacteria 20136
181 Ga0307513_10012835 3300031456 Bacteria 10315
182 Ga0307513_10418941 3300031456 Bacteria 1069
183 Ga0307509_10007679 3300031507 Bacteria 14014
184 Ga0307508_10005600 3300031616 Bacteria 11907
185 Ga0307516_10288027 3300031730 Bacteria 1322
186 Ga0307516_10509071 3300031730 Bacteria 858
187 Ga0307518_10000430 3300031838 Bacteria 32130
188 Ga0307518_10144654 3300031838 Bacteria 1653
189 Ga0307518_10365034 3300031838 Bacteria 830
190 Ga0307410_10141777 3300031852 Bacteria 1779
191 Ga0307406_10123453 3300031901 Bacteria 1805
192 Ga0307406_10606991 3300031901 Bacteria 903
193 Ga0307406_10700040 3300031901 Bacteria 846
194 Ga0307412_10735957 3300031911 Bacteria 850
195 Ga0307409_100182375 3300031995 Bacteria 1860
196 Ga0307409_100208022 3300031995 Bacteria 1756
197 Ga0307416_100076792 3300032002 Bacteria 2802
198 Ga0307416_100214331 3300032002 Bacteria 1840
199 Ga0307415_100128757 3300032126 Bacteria 1912
200 Ga0307415_100166933 3300032126 Bacteria 1712
201 Ga0307507_10012258 3300033179 Bacteria 10629
202 Ga0307507_10028693 3300033179 Bacteria 5922
203 Ga0307507_10145416 3300033179 Bacteria 1803
204 Ga0307510_10009085 3300033180 Bacteria 11833
205 Ga0373928_0023540 3300035084 Bacteria 1314
206 Ga0373949_0018640 3300035090 Bacteria 1575
207 Ga0373932_0004413 3300035112 Bacteria 3329
208 Ga0373939_0022049 3300035114 Bacteria 1751
209 Ga0373941_0013952 3300035115 Bacteria 2136
210 Ga0373960_0137633 3300035121 Bacteria 824
211 Ga0373942_0000213 3300035207 Bacteria 15160
212 Ga0373961_0128691 3300035241 Bacteria 846
213 Ga0372808_011489 3300036459 Bacteria 1253
214 Ga0373925_0000041 3300037068 Bacteria 137281
215 Ga0373925_0348826 3300037068 Bacteria 1202
216 Ga0395900_0677483 3300037418 Bacteria 966
217 Ga0395898_0056736 3300037466 Bacteria 3817
218 Ga0436364_0833426 3300037853 Bacteria 26251
219 Ga0395901_0140547 3300038443 Bacteria 2538
220 Ga0436363_0976586 3300039450 Bacteria 4406
221 Ga0436363_1393301 3300039450 Bacteria 3516
222 Ga0439432_043698 3300042006 Bacteria 1413
223 Ga0450922_001681 3300042124 Bacteria 2163
224 Ga0466969_0006210 3300044656 Bacteria 6358
225 Ga0466969_0014584 3300044656 Bacteria 4131
226 Ga0466969_0016434 3300044656 Bacteria 3872
227 Ga0466969_0019173 3300044656 Bacteria 3560
228 Ga0466969_0175080 3300044656 Bacteria 983
229 Ga0466969_0179833 3300044656 Bacteria 968
230 Ga0466966_0001650 3300044684 Bacteria 14382
231 Ga0466966_0065112 3300044684 Bacteria 2293
232 Ga0466961_0002927 3300044693 Bacteria 10598
233 Ga0466961_0004580 3300044693 Bacteria 8681
234 Ga0466961_0061046 3300044693 Bacteria 2396
235 Ga0466971_0058439 3300044719 Bacteria 1741
236 Ga0466968_0121883 3300044735 Bacteria 1180
237 Ga0466970_0009630 3300044765 Bacteria 4888
238 Ga0466970_0022685 3300044765 Bacteria 3275
239 Ga0466970_0189176 3300044765 Bacteria 1143
240 Ga0466957_1019841 3300044842 Bacteria 595
241 Ga0466959_0004568 3300045049 Bacteria 9290
242 Ga0466959_0018312 3300045049 Bacteria 5142
243 Ga0466959_0101539 3300045049 Bacteria 2059
244 Ga0466958_0021194 3300045836 Bacteria 3795
245 Ga0466967_0039874 3300045976 Bacteria 4041
246 Ga0466967_0083167 3300045976 Bacteria 2894
247 Ga0466967_0155951 3300045976 Bacteria 2139
248 Ga0495627_045715 3300046453 Bacteria 1333
249 Ga0495592_0087529 3300046454 Bacteria 2240
250 Ga0495651_0000128 3300046462 Bacteria 56236
251 Ga0495651_0000447 3300046462 Bacteria 31798
252 Ga0495651_0001329 3300046462 Bacteria 19158
253 Ga0495664_0011320 3300046477 Bacteria 5027
254 Ga0495628_0056207 3300046516 Bacteria 3099
255 Ga0495628_0086726 3300046516 Bacteria 2427
256 Ga0495630_0031795 3300046517 Bacteria 3931
257 Ga0495632_0047266 3300046519 Bacteria 2135
258 Ga0495652_0000312 3300046529 Bacteria 57814
259 Ga0495652_0029827 3300046529 Bacteria 4788
260 Ga0495652_0220161 3300046529 Bacteria 1427
261 Ga0495587_0031886 3300046536 Bacteria 3188
262 Ga0495597_0038802 3300046542 Bacteria 2134
263 Ga0495645_0010190 3300046543 Bacteria 6585
264 Ga0495645_0152586 3300046543 Bacteria 1603
265 Ga0495622_0016392 3300046557 Bacteria 3450
266 Ga0495634_0352756 3300046642 Bacteria 880
267 Ga0495625_0085860 3300046660 Bacteria 2184
268 Ga0495625_0366403 3300046660 Bacteria 907
269 Ga0495625_0404451 3300046660 Bacteria 852
270 Ga0495588_0304873 3300046674 Bacteria 838
271 Ga0495657_0000667 3300046675 Bacteria 31053
272 Ga0495623_0125721 3300046679 Bacteria 1540
273 Ga0495646_0051756 3300046680 Bacteria 2484
274 Ga0495613_0007778 3300046689 Bacteria 7975
275 Ga0495600_0015708 3300046809 Bacteria 4792
276 Ga0495600_0035319 3300046809 Bacteria 3245
277 Ga0495581_0006855 3300047315 Bacteria 6606
278 Ga0495581_0178380 3300047315 Bacteria 1242
279 Ga0495604_0001193 3300047317 Bacteria 21440
280 Ga0495604_0012191 3300047317 Bacteria 6833
281 Ga0495636_0023624 3300047318 Bacteria 2489
282 Ga0495674_0094241 3300047319 Bacteria 2554
283 Ga0495676_0003550 3300047321 Bacteria 14137
284 Ga0495687_007573 3300047443 Bacteria 6368
285 Ga0495687_011469 3300047443 Bacteria 4763
286 Ga0495675_0097849 3300047444 Bacteria 1838
287 Ga0495685_002059 3300047447 Bacteria 6255
288 Ga0495681_0001237 3300047470 Bacteria 19403
289 Ga0495684_0183443 3300047471 Bacteria 1550
290 Ga0495593_0004839 3300047673 Bacteria 7985
291 Ga0495602_0104276 3300048088 Bacteria 2320
292 Ga0495602_0503142 3300048088 Bacteria 847
293 Ga0495614_0027071 3300048089 Bacteria 2472
294 Ga0496103_0054414 3300048906 Bacteria 2480
295 Ga0496105_0017074 3300048908 Bacteria 5810
296 Ga0496106_0558861 3300048909 Bacteria 918
297 Ga0496107_0488380 3300048910 Bacteria 913
298 Ga0496110_0041973 3300048913 Bacteria 3992
299 Ga0496110_0413755 3300048913 Bacteria 1229
300 Ga0496111_0190292 3300048914 Bacteria 1525
301 Ga0496115_0335070 3300048918 Bacteria 1235
302 Ga0496119_0001634 3300048922 Bacteria 26464
303 Ga0496119_0004397 3300048922 Bacteria 14061
304 Ga0496120_0000203 3300048923 Bacteria 101935
305 Ga0496126_0156797 3300048929 Bacteria 1948
306 Ga0496126_0287768 3300048929 Bacteria 1360
307 Ga0496126_0521939 3300048929 Bacteria 946
308 Ga0501031_0009727 3300049568 Bacteria 6260
309 Ga0501031_0300213 3300049568 Bacteria 1041
310 Ga0501032_0013981 3300049569 Bacteria 5694
311 Ga0501032_0022920 3300049569 Bacteria 4322
312 Ga0501033_0103037 3300049570 Bacteria 2081
313 Ga0501033_0143823 3300049570 Bacteria 1723
314 Ga0501034_0061791 3300049571 Bacteria 3761
315 Ga0501034_0143771 3300049571 Bacteria 2363
316 Ga0501034_0313125 3300049571 Bacteria 1504
317 Ga0501034_0319608 3300049571 Bacteria 1485
318 Ga0501034_0344384 3300049571 Bacteria 1420
319 Ga0501034_0501771 3300049571 Bacteria 1127
320 Ga0501036_0044180 3300049572 Bacteria 3774
321 Ga0501036_0089643 3300049572 Bacteria 2598
322 Ga0501036_0091149 3300049572 Bacteria 2575
323 Ga0501036_0143973 3300049572 Bacteria 2010
324 Ga0501036_0570912 3300049572 Bacteria 939
325 Ga0501037_0006129 3300049573 Bacteria 8782
326 Ga0501037_0031105 3300049573 Bacteria 3941
327 Ga0501037_0035144 3300049573 Bacteria 3697
328 Ga0501037_0100906 3300049573 Bacteria 2084
329 Ga0501038_0002431 3300049574 Bacteria 17340
330 Ga0501038_0021453 3300049574 Bacteria 5796
331 Ga0501038_0034000 3300049574 Bacteria 4485
332 Ga0501038_0144197 3300049574 Bacteria 1946
333 Ga0501038_0186876 3300049574 Bacteria 1669
334 Ga0501038_0212342 3300049574 Bacteria 1547
335 Ga0501038_0229389 3300049574 Bacteria 1478
336 Ga0501039_0011365 3300049575 Bacteria 6778
337 Ga0501039_0018370 3300049575 Bacteria 5366
338 Ga0501040_0046380 3300049576 Bacteria 2966
339 Ga0501041_0092398 3300049577 Bacteria 1868
340 Ga0501042_0309956 3300049578 Bacteria 1140
341 Ga0501043_0011175 3300049579 Bacteria 7030
342 Ga0501043_0014466 3300049579 Bacteria 6177
343 Ga0501043_0732244 3300049579 Bacteria 720
344 Ga0501046_0022449 3300049580 Bacteria 5199
345 Ga0501046_0113378 3300049580 Bacteria 2069
346 Ga0501047_0018206 3300049581 Bacteria 6731
347 Ga0501047_0036215 3300049581 Bacteria 4768
348 Ga0501047_0046622 3300049581 Bacteria 4188
349 Ga0501047_0053247 3300049581 Bacteria 3912
350 Ga0501047_0060732 3300049581 Bacteria 3647
351 Ga0501047_0244495 3300049581 Bacteria 1644
352 Ga0501047_0317270 3300049581 Bacteria 1399
353 Ga0501047_0342894 3300049581 Bacteria 1331
354 Ga0501047_0557724 3300049581 Bacteria 969
355 Ga0501047_0563471 3300049581 Bacteria 963
356 Ga0501048_0022527 3300049582 Bacteria 4606
357 Ga0501048_0099232 3300049582 Bacteria 2054
358 Ga0501067_0015432 3300049583 Bacteria 4229
359 Ga0501067_0044097 3300049583 Bacteria 2478
360 Ga0501067_0152655 3300049583 Bacteria 1287
361 Ga0501069_0001969 3300049585 Bacteria 10265
362 Ga0501069_0281814 3300049585 Bacteria 973
363 Ga0501070_0004774 3300049586 Bacteria 11602
364 Ga0501070_0015528 3300049586 Bacteria 6405
365 Ga0501071_0071274 3300049587 Bacteria 2533
366 Ga0501072_0010894 3300049588 Bacteria 6935
367 Ga0501072_0295680 3300049588 Bacteria 1287
368 Ga0501073_0058395 3300049589 Bacteria 2696
369 Ga0501073_0158063 3300049589 Bacteria 1570
370 Ga0501073_0433731 3300049589 Bacteria 908
371 Ga0501074_0023246 3300049590 Bacteria 4508
372 Ga0501074_0116631 3300049590 Bacteria 1910
373 Ga0501076_0246551 3300049592 Bacteria 1461
374 Ga0501080_0034021 3300049742 Bacteria 4758
375 Ga0501080_0269424 3300049742 Bacteria 1550
376 Ga0501080_0371118 3300049742 Bacteria 1290
377 Ga0501083_0035047 3300049744 Bacteria 3430
378 Ga0501083_0035735 3300049744 Bacteria 3393
379 Ga0501035_0002053 3300049822 Bacteria 20069
380 Ga0501035_0037410 3300049822 Bacteria 4395
381 Ga0501035_0037560 3300049822 Bacteria 4385
382 Ga0501035_0349447 3300049822 Bacteria 1237
383 Ga0501035_0518200 3300049822 Bacteria 980
384 Ga0501035_0531253 3300049822 Bacteria 965
385 Ga0501044_0038838 3300049823 Bacteria 4971
386 Ga0501044_0061525 3300049823 Bacteria 3840
387 Ga0501044_0061582 3300049823 Bacteria 3839
388 Ga0501044_0070815 3300049823 Bacteria 3546
389 Ga0501044_0197983 3300049823 Bacteria 1968
390 Ga0501044_0250624 3300049823 Bacteria 1712
391 Ga0501044_0634812 3300049823 Bacteria 958
392 Ga0501044_0965006 3300049823 Bacteria 725
393 Ga0501045_0129389 3300049824 Bacteria 1876
394 Ga0501045_0465267 3300049824 Bacteria 940
395 nmdc:mga05p37_488743_c1 3300050507 Bacteria 1416
396 nmdc:mga0n895_244267_c1 3300050512 Bacteria 1822
397 Ga0500610_0220630 3300053079 Bacteria 898
398 Ga0495619_0201596 3300053085 Bacteria 1377
399 Ga0495619_0461651 3300053085 Bacteria 875
400 Ga0500583_0067779 3300053092 Bacteria 1701
401 Ga0500651_0026287 3300053093 Bacteria 3657
402 Ga0500640_086506 3300053095 Bacteria 1320
403 Ga0500553_037943 3300053101 Bacteria 2377
404 Ga0500556_0160777 3300053104 Bacteria 886
405 Ga0500572_040608 3300053111 Bacteria 1347
406 Ga0500572_127609 3300053111 Bacteria 825
407 Ga0500655_026571 3300053133 Bacteria 1102
408 Ga0500573_0251775 3300053140 Bacteria 910
409 Ga0500577_0002037 3300053142 Bacteria 5168
410 Ga0500600_0074637 3300053149 Bacteria 1850
411 Ga0500616_0000240 3300053153 Bacteria 86336
412 Ga0501084_0045751 3300054114 Bacteria 3663
413 Ga0501082_0255189 3300060353 Bacteria 1525
414 Ga0466962_0132070 3300061719 Bacteria 1207
415 2517764653 2517572101 Bacteria 6884336
416 2558907798 2558860112 Bacteria 9931328
417 2559431294 2558860280 Bacteria 11429938
418 2579857272 2579778521 Bacteria 7624758
419 2585306022 2582581313 Bacteria 10042643
420 2586060967 2585427649 Bacteria 9053857
421 2619856755 2619618881 Bacteria 7521104
422 2620353133 2619619003 Bacteria 7619552
423 2644265112 2643221647 Bacteria 10741251
424 2768642715 2767802112 Bacteria 6465194
425 2774399680 2773857763 Bacteria 4180068
426 2785366212 2784746768 Bacteria 10036182
427 2791912744 2791354901 Bacteria 8322202
428 2808921479 2808606375 Bacteria 9466072
429 2809590014 2808606522 Bacteria 9488490
430 2816503774 2816332139 Bacteria 9138787
431 2856748054 2856741275 Bacteria 8096094
432 2862285906 2862281513 Bacteria 9621493
433 2862293671 2862290372 Bacteria 7471434
434 2873158963 2873151551 Bacteria 8625867
435 2873320430 2873314349 Bacteria 8512634
436 2891399006 2891395885 Bacteria 9251614
437 2891560191 2891554331 Bacteria 8812224
438 2891569377 2891562705 Bacteria 8039471
439 2915770487 2915768154 Bacteria 8424322
440 2954389641 2954380949 Bacteria 10050426
441 2954700481 2954691527 Bacteria 10720516
442 2954701747 2954701450 Bacteria 10834262
443 2954719154 2954711539 Bacteria 10867210
444 2954729125 2954721474 Bacteria 10456478
445 2954732685 2954731030 Bacteria 10243860
446 2954748025 2954740390 Bacteria 10229294
447 2954751564 2954749733 Bacteria 10366972
448 2954767150 2954759201 Bacteria 9358192
449 2997452239 2997451912 Bacteria 8492419
450 3003009003 3002998708 Bacteria 11715108
451 8056454293 8056447290 Bacteria 7680491
452 Ga0068868_100723645
453 JGI24739J22299_10077996
454 JGI25160J50197_1005475
455 Ga0070658_10189949
456 Ga0070683_100160582
457 Ga0070683_100594090
458 Ga0070670_100212083
459 Ga0068869_100138319
460 Ga0068869_100441322
461 Ga0070680_100167575
462 Ga0070680_100781123
463 Ga0070660_100038471
464 Ga0070689_100183869
465 Ga0070691_10044710
466 Ga0070661_100074281
467 Ga0070661_100107281
468 Ga0070668_101537904
469 Ga0070675_100097995
470 Ga0070673_100081810
471 Ga0070659_100021669
472 Ga0070714_100000937
473 Ga0070714_100009244
474 Ga0070714_100019210
475 Ga0070714_100521074
476 Ga0070710_10206673
477 Ga0070710_10284851
478 Ga0070710_10400353
479 Ga0070701_10056902
480 Ga0070711_100344590
481 Ga0070711_100523260
482 Ga0070711_101123960
483 Ga0070705_100017185
484 Ga0070663_100252232
485 Ga0070678_100056940
486 Ga0070681_10146131
487 Ga0070681_10475995
488 Ga0070685_10010631
489 Ga0070685_10292771
490 Ga0070699_100973826
491 Ga0070679_100004285
492 Ga0070679_100191742
493 Ga0070684_100191626
494 Ga0070684_100311047
495 Ga0070684_100884521
496 Ga0068853_100143381
497 Ga0070672_100175490
498 Ga0070686_100035353
499 Ga0070695_100074659
500 Ga0070665_100213652
501 Ga0070665_100306409
502 Ga0070704_100059206
503 Ga0068855_100101384
504 Ga0070664_100159543
505 Ga0070664_100183637
506 Ga0068857_100214303
507 Ga0068854_100019309
508 Ga0068856_100138787
509 Ga0068856_100897499
510 Ga0070702_100024447
511 Ga0068852_100040387
512 Ga0068852_100201531
513 Ga0068859_100275003
514 Ga0068864_100568300
515 Ga0068851_10123456
516 Ga0068870_10084968
517 Ga0068863_100023455
518 Ga0068858_100358014
519 Ga0068860_100236134
520 Ga0081455_10000169
521 Ga0081455_10438867
522 Ga0081539_10000254
523 Ga0081539_10020244
524 Ga0070717_10339750
525 Ga0070715_10017956
526 Ga0070712_100200167
527 Ga0068871_100054436
528 Ga0097620_100274999
529 Ga0105251_10043703
530 Ga0105247_10000178
531 Ga0114129_10778061
532 Ga0105241_10002402
533 Ga0105241_10080908
534 Ga0105248_10007315
535 Ga0105248_10237638
536 Ga0105237_10067937
537 Ga0105238_10226632
538 Ga0105238_10361463
539 Ga0105249_10169267
540 Ga0105239_10253649
541 Ga0105239_11487004
542 Ga0105246_10000307
543 Ga0157371_10084672
544 Ga0157370_10098415
545 Ga0157370_10449451
546 Ga0157369_10026725
547 Ga0157369_10152975
548 Ga0157374_10460232
549 Ga0163162_11367752
550 Ga0157372_10675077
551 Ga0157372_10766714
552 Ga0157380_10345813
553 Ga0157380_11963453
554 Ga0182008_10050614
555 Ga0182008_10058464
556 Ga0157379_10009932
557 Ga0157379_10730395
558 Ga0182007_10060669
559 Ga0206353_11512624
560 Ga0213875_10001983
561 Ga0207426_1001278
562 Ga0207710_10000109
563 Ga0207688_10018328
564 Ga0207647_10282796
565 Ga0207685_10011169
566 Ga0207699_10023561
567 Ga0207705_10298886
568 Ga0207705_10436957
569 Ga0207654_10017190
570 Ga0207707_10099374
571 Ga0207695_10002892
572 Ga0207671_10000482
573 Ga0207693_10065859
574 Ga0207693_10151801
575 Ga0207660_10269436
576 Ga0207662_10003307
577 Ga0207657_10002090
578 Ga0207657_10573236
579 Ga0207649_10074093
580 Ga0207652_10106457
581 Ga0207694_10061936
582 Ga0207659_10310541
583 Ga0207700_10040512
584 Ga0207700_10612998
585 Ga0207664_10001327
586 Ga0207664_10010955
587 Ga0207664_10088700
588 Ga0207664_10468141
589 Ga0207664_11068410
590 Ga0207690_10299396
591 Ga0207690_10354600
592 Ga0207709_10076891
593 Ga0207670_10272025
594 Ga0207665_10008098
595 Ga0207665_10013078
596 Ga0207691_10055782
597 Ga0207711_10024940
598 Ga0207689_10005138
599 Ga0207689_10083951
600 Ga0207689_10330326
601 Ga0207661_10398270
602 Ga0207679_10122690
603 Ga0207667_10007907
604 Ga0207667_10230570
605 Ga0207667_11160281
606 Ga0207640_10160605
607 Ga0207678_10074163
608 Ga0207678_10171848
609 Ga0207678_10273220
610 Ga0207702_10343572
611 Ga0207702_10628900
612 Ga0207674_10015717
613 Ga0207674_10180998
614 Ga0207674_10604361
615 Ga0207675_100069055
616 Ga0207683_10289309
617 Ga0207698_10153682
618 Ga0268266_10284183
619 Ga0268266_10383936
620 Ga0268264_11004433
621 Ga0307515_10001813
622 Ga0307515_10010455
623 Ga0307515_10059413
624 Ga0307515_10206867
625 Ga0307515_10231556
626 Ga0307511_10000710
627 Ga0307512_10006038
628 Ga0307512_10011158
629 Ga0307512_10133985
630 Ga0307512_10248260
631 Ga0307513_10003872
632 Ga0307513_10012835
633 Ga0307513_10418941
634 Ga0307509_10007679
635 Ga0307508_10005600
636 Ga0307516_10288027
637 Ga0307516_10509071
638 Ga0307518_10000430
639 Ga0307518_10144654
640 Ga0307518_10365034
641 Ga0307410_10141777
642 Ga0307406_10123453
643 Ga0307406_10606991
644 Ga0307406_10700040
645 Ga0307412_10735957
646 Ga0307409_100182375
647 Ga0307409_100208022
648 Ga0307416_100076792
649 Ga0307416_100214331
650 Ga0307415_100128757
651 Ga0307415_100166933
652 Ga0307507_10012258
653 Ga0307507_10028693
654 Ga0307507_10145416
655 Ga0307510_10009085
656 Ga0373928_0023540
657 Ga0373949_0018640
658 Ga0373932_0004413
659 Ga0373939_0022049
660 Ga0373941_0013952
661 Ga0373960_0137633
662 Ga0373942_0000213
663 Ga0373961_0128691
664 Ga0372808_011489
665 Ga0373925_0000041
666 Ga0373925_0348826
667 Ga0395900_0677483
668 Ga0395898_0056736
669 Ga0436364_0833426
670 Ga0395901_0140547
671 Ga0436363_0976586
672 Ga0436363_1393301
673 Ga0439432_043698
674 Ga0450922_001681
675 Ga0466969_0006210
676 Ga0466969_0014584
677 Ga0466969_0016434
678 Ga0466969_0019173
679 Ga0466969_0175080
680 Ga0466969_0179833
681 Ga0466966_0001650
682 Ga0466966_0065112
683 Ga0466961_0002927
684 Ga0466961_0004580
685 Ga0466961_0061046
686 Ga0466971_0058439
687 Ga0466968_0121883
688 Ga0466970_0009630
689 Ga0466970_0022685
690 Ga0466970_0189176
691 Ga0466957_1019841
692 Ga0466959_0004568
693 Ga0466959_0018312
694 Ga0466959_0101539
695 Ga0466958_0021194
696 Ga0466967_0039874
697 Ga0466967_0083167
698 Ga0466967_0155951
699 Ga0495627_045715
700 Ga0495592_0087529
701 Ga0495651_0000128
702 Ga0495651_0000447
703 Ga0495651_0001329
704 Ga0495664_0011320
705 Ga0495628_0056207
706 Ga0495628_0086726
707 Ga0495630_0031795
708 Ga0495632_0047266
709 Ga0495652_0000312
710 Ga0495652_0029827
711 Ga0495652_0220161
712 Ga0495587_0031886
713 Ga0495597_0038802
714 Ga0495645_0010190
715 Ga0495645_0152586
716 Ga0495622_0016392
717 Ga0495634_0352756
718 Ga0495625_0085860
719 Ga0495625_0366403
720 Ga0495625_0404451
721 Ga0495588_0304873
722 Ga0495657_0000667
723 Ga0495623_0125721
724 Ga0495646_0051756
725 Ga0495613_0007778
726 Ga0495600_0015708
727 Ga0495600_0035319
728 Ga0495581_0006855
729 Ga0495581_0178380
730 Ga0495604_0001193
731 Ga0495604_0012191
732 Ga0495636_0023624
733 Ga0495674_0094241
734 Ga0495676_0003550
735 Ga0495687_007573
736 Ga0495687_011469
737 Ga0495675_0097849
738 Ga0495685_002059
739 Ga0495681_0001237
740 Ga0495684_0183443
741 Ga0495593_0004839
742 Ga0495602_0104276
743 Ga0495602_0503142
744 Ga0495614_0027071
745 Ga0496103_0054414
746 Ga0496105_0017074
747 Ga0496106_0558861
748 Ga0496107_0488380
749 Ga0496110_0041973
750 Ga0496110_0413755
751 Ga0496111_0190292
752 Ga0496115_0335070
753 Ga0496119_0001634
754 Ga0496119_0004397
755 Ga0496120_0000203
756 Ga0496126_0156797
757 Ga0496126_0287768
758 Ga0496126_0521939
759 Ga0501031_0009727
760 Ga0501031_0300213
761 Ga0501032_0013981
762 Ga0501032_0022920
763 Ga0501033_0103037
764 Ga0501033_0143823
765 Ga0501034_0061791
766 Ga0501034_0143771
767 Ga0501034_0313125
768 Ga0501034_0319608
769 Ga0501034_0344384
770 Ga0501034_0501771
771 Ga0501036_0044180
772 Ga0501036_0089643
773 Ga0501036_0091149
774 Ga0501036_0143973
775 Ga0501036_0570912
776 Ga0501037_0006129
777 Ga0501037_0031105
778 Ga0501037_0035144
779 Ga0501037_0100906
780 Ga0501038_0002431
781 Ga0501038_0021453
782 Ga0501038_0034000
783 Ga0501038_0144197
784 Ga0501038_0186876
785 Ga0501038_0212342
786 Ga0501038_0229389
787 Ga0501039_0011365
788 Ga0501039_0018370
789 Ga0501040_0046380
790 Ga0501041_0092398
791 Ga0501042_0309956
792 Ga0501043_0011175
793 Ga0501043_0014466
794 Ga0501043_0732244
795 Ga0501046_0022449
796 Ga0501046_0113378
797 Ga0501047_0018206
798 Ga0501047_0036215
799 Ga0501047_0046622
800 Ga0501047_0053247
801 Ga0501047_0060732
802 Ga0501047_0244495
803 Ga0501047_0317270
804 Ga0501047_0342894
805 Ga0501047_0557724
806 Ga0501047_0563471
807 Ga0501048_0022527
808 Ga0501048_0099232
809 Ga0501067_0015432
810 Ga0501067_0044097
811 Ga0501067_0152655
812 Ga0501069_0001969
813 Ga0501069_0281814
814 Ga0501070_0004774
815 Ga0501070_0015528
816 Ga0501071_0071274
817 Ga0501072_0010894
818 Ga0501072_0295680
819 Ga0501073_0058395
820 Ga0501073_0158063
821 Ga0501073_0433731
822 Ga0501074_0023246
823 Ga0501074_0116631
824 Ga0501076_0246551
825 Ga0501080_0034021
826 Ga0501080_0269424
827 Ga0501080_0371118
828 Ga0501083_0035047
829 Ga0501083_0035735
830 Ga0501035_0002053
831 Ga0501035_0037410
832 Ga0501035_0037560
833 Ga0501035_0349447
834 Ga0501035_0518200
835 Ga0501035_0531253
836 Ga0501044_0038838
837 Ga0501044_0061525
838 Ga0501044_0061582
839 Ga0501044_0070815
840 Ga0501044_0197983
841 Ga0501044_0250624
842 Ga0501044_0634812
843 Ga0501044_0965006
844 Ga0501045_0129389
845 Ga0501045_0465267
846 nmdc:mga05p37_488743_c1
847 nmdc:mga0n895_244267_c1
848 Ga0500610_0220630
849 Ga0495619_0201596
850 Ga0495619_0461651
851 Ga0500583_0067779
852 Ga0500651_0026287
853 Ga0500640_086506
854 Ga0500553_037943
855 Ga0500556_0160777
856 Ga0500572_040608
857 Ga0500572_127609
858 Ga0500655_026571
859 Ga0500573_0251775
860 Ga0500577_0002037
861 Ga0500600_0074637
862 Ga0500616_0000240
863 Ga0501084_0045751
864 Ga0501082_0255189
865 Ga0466962_0132070
866 2517764653
867 2558907798
868 2559431294
869 2579857272
870 2585306022
871 2586060967
872 2619856755
873 2620353133
874 2644265112
875 2768642715
876 2774399680
877 2785366212
878 2791912744
879 2808921479
880 2809590014
881 2816503774
882 2856748054
883 2862285906
884 2862293671
885 2873158963
886 2873320430
887 2891399006
888 2891560191
889 2891569377
890 2915770487
891 2954389641
892 2954700481
893 2954701747
894 2954719154
895 2954729125
896 2954732685
897 2954748025
898 2954751564
899 2954767150
900 2997452239
901 3003009003
902 8056454293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

43

89

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gpa-assembly1.cif.gz_A structural analysis of fatty acid degradation regulator fadr from bacillus halodurans 0.778 11 189
1jt0-assembly1.cif.gz_A crystal structure of a cooperative qacr-dna complex 0.7769 9 195
2eh3-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7737 9 191
1jt0-assembly1.cif.gz_A crystal structure of a cooperative qacr-dna complex 0.7697 9 195
3bti-assembly2.cif.gz_E crystal structure of qacr(e58q) bound to berberine 0.7596 9 193
ID Description Score Start End Superfamily
5gpcD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9119 9 52 1.10.10.60
5gpcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9098 10 52 1.10.10.60
5gpcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.908 10 52 1.10.10.60
5gpcA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9013 10 52 1.10.10.60
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8982 10 50 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A0A8EZJ3-F1-model_v4 TetR family transcriptional regulator 0.9761 5 195 GO:0000976
GO:0003700
AF-A0A0M9XNB5-F1-model_v4 TetR family transcriptional regulator 0.9742 23 195 GO:0003677
GO:0006355
AF-A0A0B8N1X3-F1-model_v4 Transcriptional regulator 0.9734 1 195 GO:0000976
GO:0003700
AF-A0A7G1PHW6-F1-model_v4 TetR family transcriptional regulator 0.9727 46 195
AF-A0A6B2SX10-F1-model_v4 TetR family transcriptional regulator 0.972 1 110 GO:0000976
GO:0003700

Map