F446692

General Info

Members Datasets Scaffolds Average Seq Length
450 228 900 118

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0225001|Ga0500616_0225001_296_715
Length 139
Sequence MARAATTADAFNAVAEPRRREILDVLAGGERPVNDLVELLGLAQPQVSKHLRVLREVGAVDVRDSGRQRLYRLNGHALKPIHDWVKGYERTWTERFDALDDVLEELKKEQDDARDERLRSPHPADGHRDPDGARVRRAT

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
115 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
116 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
117 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
137 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
138 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
146 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
147 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
148 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
226 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
227 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
228 2808606394 Promicromonospora sp. C35 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 3.78
Rhizosphere 92.89
Stem 0
Stem Tuber 0
Unclassified 3.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0225001 3300053153 Bacteria 816
2 rootH1_10031733 3300003316 Bacteria 1527
3 JGI25407J50210_10001786 3300003373 Bacteria 4950
4 JGI25407J50210_10005198 3300003373 Bacteria 3192
5 JGI25407J50210_10007179 3300003373 Bacteria 2789
6 JGI25407J50210_10008969 3300003373 Bacteria 2526
7 JGI25407J50210_10012016 3300003373 Bacteria 2218
8 JGI25407J50210_10013235 3300003373 Bacteria 2120
9 JGI25407J50210_10030346 3300003373 Bacteria 1401
10 JGI25407J50210_10060057 3300003373 Bacteria 956
11 Ga0070658_10624303 3300005327 Bacteria 935
12 Ga0070658_11291624 3300005327 Bacteria 634
13 Ga0070683_100113678 3300005329 Bacteria 2555
14 Ga0070683_100228034 3300005329 Bacteria 1771
15 Ga0070683_100402940 3300005329 Bacteria 1305
16 Ga0068869_100221516 3300005334 Bacteria 1500
17 Ga0068869_100518994 3300005334 Bacteria 997
18 Ga0068868_100512633 3300005338 Bacteria 1052
19 Ga0070660_100254383 3300005339 Bacteria 1433
20 Ga0070689_101486911 3300005340 Bacteria 613
21 Ga0070661_100743270 3300005344 Bacteria 802
22 Ga0070692_10089577 3300005345 Bacteria 1670
23 Ga0070692_10429513 3300005345 Bacteria 841
24 Ga0070668_100006900 3300005347 Bacteria 8417
25 Ga0070669_101016192 3300005353 Bacteria 712
26 Ga0070674_100384435 3300005356 Bacteria 1143
27 Ga0070674_100517904 3300005356 Bacteria 996
28 Ga0070674_100875741 3300005356 Bacteria 781
29 Ga0070688_100834049 3300005365 Bacteria 723
30 Ga0070659_100325385 3300005366 Bacteria 1286
31 Ga0070659_100887569 3300005366 Bacteria 779
32 Ga0070659_100948338 3300005366 Bacteria 754
33 Ga0070667_102226898 3300005367 Bacteria 516
34 Ga0070714_100141685 3300005435 Bacteria 2159
35 Ga0070714_100251266 3300005435 Bacteria 1635
36 Ga0070714_101064374 3300005435 Bacteria 788
37 Ga0070713_101626385 3300005436 Unclassified 627
38 Ga0070701_10395721 3300005438 Bacteria 874
39 Ga0070701_11397388 3300005438 Bacteria 503
40 Ga0070705_101880830 3300005440 Bacteria 509
41 Ga0070700_100362846 3300005441 Bacteria 1078
42 Ga0070700_101439322 3300005441 Bacteria 584
43 Ga0070708_100000013 3300005445 Bacteria 130790
44 Ga0070663_100476207 3300005455 Bacteria 1033
45 Ga0070662_100564290 3300005457 Bacteria 955
46 Ga0070681_11899163 3300005458 Unclassified 523
47 Ga0068867_100876785 3300005459 Bacteria 806
48 Ga0070685_10472625 3300005466 Bacteria 882
49 Ga0070706_100202527 3300005467 Bacteria 1854
50 Ga0070707_100313275 3300005468 Bacteria 1525
51 Ga0070707_101329792 3300005468 Bacteria 685
52 Ga0070707_101670737 3300005468 Unclassified 604
53 Ga0070698_100017945 3300005471 Bacteria 7452
54 Ga0070698_100148954 3300005471 Bacteria 2289
55 Ga0070679_100217036 3300005530 Bacteria 1875
56 Ga0070684_100086214 3300005535 Bacteria 2786
57 Ga0070684_100825450 3300005535 Bacteria 867
58 Ga0070684_101669362 3300005535 Bacteria 601
59 Ga0070665_101498898 3300005548 Bacteria 683
60 Ga0070704_100524126 3300005549 Bacteria 1032
61 Ga0070704_101430559 3300005549 Bacteria 635
62 Ga0070664_100307190 3300005564 Bacteria 1434
63 Ga0070664_100355361 3300005564 Bacteria 1334
64 Ga0068857_101845915 3300005577 Bacteria 592
65 Ga0070702_100021848 3300005615 Bacteria 3375
66 Ga0070702_100184519 3300005615 Bacteria 1368
67 Ga0070702_100866636 3300005615 Bacteria 704
68 Ga0068852_100397804 3300005616 Bacteria 1355
69 Ga0068852_100596345 3300005616 Bacteria 1109
70 Ga0068859_102538308 3300005617 Bacteria 564
71 Ga0068864_100173099 3300005618 Bacteria 1969
72 Ga0068861_100979654 3300005719 Bacteria 806
73 Ga0068851_10133817 3300005834 Bacteria 1343
74 Ga0068862_100356162 3300005844 Bacteria 1359
75 Ga0081455_10276142 3300005937 Bacteria 1216
76 Ga0081455_10628538 3300005937 Bacteria 695
77 Ga0081538_10000080 3300005981 Bacteria 92392
78 Ga0081538_10001298 3300005981 Bacteria 25847
79 Ga0081538_10002401 3300005981 Bacteria 18381
80 Ga0081538_10005393 3300005981 Bacteria 11494
81 Ga0081538_10006598 3300005981 Bacteria 10186
82 Ga0081538_10007484 3300005981 Bacteria 9437
83 Ga0081538_10012727 3300005981 Bacteria 6722
84 Ga0081538_10019294 3300005981 Bacteria 5077
85 Ga0081538_10031247 3300005981 Bacteria 3596
86 Ga0081538_10033686 3300005981 Bacteria 3404
87 Ga0081538_10068990 3300005981 Bacteria 1962
88 Ga0081538_10069277 3300005981 Bacteria 1955
89 Ga0081538_10119126 3300005981 Bacteria 1273
90 Ga0081538_10128283 3300005981 Bacteria 1199
91 Ga0081538_10216309 3300005981 Bacteria 766
92 Ga0081538_10243362 3300005981 Bacteria 692
93 Ga0081538_10274602 3300005981 Bacteria 629
94 Ga0081538_10387746 3300005981 Bacteria 503
95 Ga0081540_1144779 3300005983 Bacteria 948
96 Ga0070717_10862261 3300006028 Bacteria 824
97 Ga0070717_11779405 3300006028 Bacteria 557
98 Ga0075365_10028574 3300006038 Bacteria 3557
99 Ga0097621_100328933 3300006237 Bacteria 1355
100 Ga0075428_100190413 3300006844 Bacteria 2218
101 Ga0075428_100641040 3300006844 Bacteria 1133
102 Ga0075430_100180353 3300006846 Bacteria 1757
103 Ga0075431_100321009 3300006847 Bacteria 1562
104 Ga0075433_10678966 3300006852 Bacteria 903
105 Ga0068865_100057376 3300006881 Bacteria 2716
106 Ga0068865_100246452 3300006881 Bacteria 1408
107 Ga0097620_102538000 3300006931 Bacteria 564
108 Ga0111539_10137956 3300009094 Bacteria 2856
109 Ga0111539_10527282 3300009094 Bacteria 1376
110 Ga0111539_10725918 3300009094 Bacteria 1157
111 Ga0111539_11254965 3300009094 Bacteria 860
112 Ga0111539_11510676 3300009094 Bacteria 779
113 Ga0111539_12010441 3300009094 Bacteria 670
114 Ga0105245_10311336 3300009098 Bacteria 1548
115 Ga0105245_10643626 3300009098 Bacteria 1090
116 Ga0105245_11964918 3300009098 Bacteria 638
117 Ga0114129_10548211 3300009147 Bacteria 1504
118 Ga0114129_10575813 3300009147 Bacteria 1461
119 Ga0105243_10023251 3300009148 Bacteria 4718
120 Ga0105243_10458124 3300009148 Bacteria 1198
121 Ga0105243_10809380 3300009148 Bacteria 924
122 Ga0105243_10880975 3300009148 Bacteria 889
123 Ga0105242_12399275 3300009176 Bacteria 575
124 Ga0105248_10546276 3300009177 Bacteria 1307
125 Ga0105248_10702545 3300009177 Bacteria 1141
126 Ga0105237_11187933 3300009545 Bacteria 769
127 Ga0105238_12197567 3300009551 Unclassified 586
128 Ga0105249_10255158 3300009553 Bacteria 1740
129 Ga0105249_10372528 3300009553 Bacteria 1452
130 Ga0105246_10479438 3300011119 Bacteria 1052
131 Ga0157329_1024002 3300012491 Bacteria 592
132 Ga0157374_10973032 3300013296 Bacteria 867
133 Ga0157374_11704575 3300013296 Bacteria 655
134 Ga0157374_12133947 3300013296 Bacteria 587
135 Ga0163162_10630284 3300013306 Bacteria 1197
136 Ga0163162_11071616 3300013306 Bacteria 913
137 Ga0163162_11174088 3300013306 Bacteria 871
138 Ga0157372_10262832 3300013307 Bacteria 2004
139 Ga0157375_12492949 3300013308 Bacteria 618
140 Ga0157380_10597377 3300014326 Bacteria 1091
141 Ga0182008_10975309 3300014497 Bacteria 504
142 Ga0157377_10100895 3300014745 Bacteria 1720
143 Ga0157376_12418456 3300014969 Bacteria 565
144 Ga0163161_11002370 3300017792 Bacteria 713
145 Ga0213876_10504500 3300021384 Bacteria 644
146 Ga0207656_10086211 3300025321 Bacteria 1419
147 Ga0207688_10753175 3300025901 Bacteria 617
148 Ga0207647_10531967 3300025904 Bacteria 653
149 Ga0207685_10196299 3300025905 Bacteria 945
150 Ga0207705_10930028 3300025909 Bacteria 673
151 Ga0207684_11160906 3300025910 Bacteria 641
152 Ga0207657_10181517 3300025919 Bacteria 1701
153 Ga0207649_10421978 3300025920 Bacteria 1002
154 Ga0207646_10190259 3300025922 Bacteria 1853
155 Ga0207646_11049019 3300025922 Bacteria 719
156 Ga0207681_10159696 3300025923 Bacteria 1698
157 Ga0207700_11438807 3300025928 Unclassified 612
158 Ga0207664_10142550 3300025929 Bacteria 2029
159 Ga0207664_10513891 3300025929 Bacteria 1073
160 Ga0207664_11052524 3300025929 Bacteria 728
161 Ga0207690_10340844 3300025932 Bacteria 1183
162 Ga0207690_10729748 3300025932 Bacteria 816
163 Ga0207690_10732882 3300025932 Unclassified 814
164 Ga0207709_10135998 3300025935 Bacteria 1683
165 Ga0207709_10202272 3300025935 Bacteria 1419
166 Ga0207709_10285494 3300025935 Bacteria 1221
167 Ga0207709_10881827 3300025935 Bacteria 726
168 Ga0207669_10244049 3300025937 Bacteria 1333
169 Ga0207669_10770103 3300025937 Bacteria 796
170 Ga0207704_11725167 3300025938 Bacteria 538
171 Ga0207691_10169929 3300025940 Bacteria 1909
172 Ga0207689_10187902 3300025942 Bacteria 1704
173 Ga0207661_10029656 3300025944 Bacteria 4205
174 Ga0207661_10116773 3300025944 Bacteria 2266
175 Ga0207661_11464315 3300025944 Bacteria 626
176 Ga0207679_10129188 3300025945 Bacteria 2024
177 Ga0207679_10774771 3300025945 Bacteria 873
178 Ga0207679_10981662 3300025945 Bacteria 774
179 Ga0207712_11264443 3300025961 Bacteria 659
180 Ga0207712_11909331 3300025961 Bacteria 532
181 Ga0207668_10986130 3300025972 Bacteria 753
182 Ga0207640_10345423 3300025981 Bacteria 1194
183 Ga0207677_10487960 3300026023 Bacteria 1063
184 Ga0207678_10520749 3300026067 Bacteria 1038
185 Ga0207708_10716326 3300026075 Bacteria 856
186 Ga0207708_11117734 3300026075 Bacteria 687
187 Ga0207702_11825926 3300026078 Bacteria 600
188 Ga0207648_10090713 3300026089 Bacteria 2671
189 Ga0207676_10274084 3300026095 Bacteria 1529
190 Ga0207674_10718741 3300026116 Bacteria 964
191 Ga0207675_100586154 3300026118 Bacteria 1117
192 Ga0207683_10150569 3300026121 Bacteria 2100
193 Ga0207698_10190133 3300026142 Bacteria 1828
194 Ga0207698_10452657 3300026142 Bacteria 1239
195 Ga0207698_10773994 3300026142 Bacteria 960
196 Ga0207428_10099478 3300027907 Bacteria 2249
197 Ga0268266_10401445 3300028379 Bacteria 1296
198 Ga0268265_10298843 3300028380 Bacteria 1449
199 Ga0268265_11110348 3300028380 Bacteria 785
200 Ga0268265_11238489 3300028380 Bacteria 745
201 Ga0316177_1085566 3300030731 Bacteria 1725
202 Ga0316176_1155188 3300030732 Bacteria 1115
203 Ga0314311_1165958 3300030733 Bacteria 3060
204 Ga0316179_1092911 3300030734 Bacteria 963
205 Ga0307408_100843391 3300031548 Bacteria 835
206 Ga0307516_10012491 3300031730 Bacteria 9147
207 Ga0307516_10049323 3300031730 Bacteria 4138
208 Ga0307405_10579226 3300031731 Bacteria 913
209 Ga0307405_11400926 3300031731 Bacteria 611
210 Ga0307405_11423215 3300031731 Bacteria 607
211 Ga0307405_11864430 3300031731 Bacteria 536
212 Ga0307405_12098398 3300031731 Bacteria 507
213 Ga0307413_10810617 3300031824 Bacteria 788
214 Ga0307413_11202648 3300031824 Bacteria 659
215 Ga0307410_10692759 3300031852 Bacteria 858
216 Ga0307410_11756096 3300031852 Unclassified 550
217 Ga0307406_10015882 3300031901 Bacteria 4366
218 Ga0307406_10039620 3300031901 Bacteria 2925
219 Ga0307407_10075800 3300031903 Bacteria 2018
220 Ga0307407_10268826 3300031903 Bacteria 1176
221 Ga0307407_11681854 3300031903 Bacteria 505
222 Ga0307409_100648555 3300031995 Bacteria 1049
223 Ga0307409_101869391 3300031995 Bacteria 630
224 Ga0307416_100662357 3300032002 Bacteria 1130
225 Ga0307416_100932144 3300032002 Bacteria 970
226 Ga0307416_101119523 3300032002 Bacteria 892
227 Ga0307416_102023718 3300032002 Bacteria 678
228 Ga0307414_10768283 3300032004 Bacteria 877
229 Ga0307411_10374292 3300032005 Bacteria 1169
230 Ga0307411_11282901 3300032005 Bacteria 667
231 Ga0307415_100098404 3300032126 Bacteria 2138
232 Ga0307415_100145152 3300032126 Bacteria 1818
233 Ga0307415_100241041 3300032126 Bacteria 1463
234 Ga0307415_101373075 3300032126 Bacteria 672
235 Ga0307415_101586497 3300032126 Bacteria 628
236 Ga0395900_0019124 3300037418 Bacteria 6985
237 Ga0395900_0089491 3300037418 Bacteria 3164
238 Ga0395900_0478768 3300037418 Bacteria 1198
239 Ga0395900_0791201 3300037418 Bacteria 877
240 Ga0395898_0025889 3300037466 Bacteria 5906
241 Ga0395898_0197168 3300037466 Bacteria 1923
242 Ga0395898_0209885 3300037466 Bacteria 1857
243 Ga0395898_0951862 3300037466 Bacteria 796
244 Ga0395905_0086946 3300037471 Bacteria 2930
245 Ga0395905_0313125 3300037471 Bacteria 1458
246 Ga0395905_0558344 3300037471 Bacteria 1046
247 Ga0395905_1546594 3300037471 Unclassified 568
248 Ga0436364_0210409 3300037853 Bacteria 4714
249 Ga0436364_0382546 3300037853 Bacteria 2748
250 Ga0395901_0015018 3300038443 Bacteria 7873
251 Ga0395901_0053851 3300038443 Bacteria 4181
252 Ga0395901_0263992 3300038443 Bacteria 1791
253 Ga0395901_0285204 3300038443 Bacteria 1715
254 Ga0395901_1630081 3300038443 Bacteria 598
255 Ga0395901_1671385 3300038443 Bacteria 589
256 Ga0436365_0547332 3300039437 Bacteria 3518
257 Ga0436365_1558885 3300039437 Bacteria 1011
258 Ga0436363_1075404 3300039450 Bacteria 2099
259 Ga0439438_021921 3300041405 Bacteria 1777
260 Ga0439461_0034410 3300041410 Bacteria 1070
261 Ga0451793_0639572 3300041452 Bacteria 1346
262 Ga0451797_0604650 3300041453 Bacteria 524
263 Ga0451795_0957216 3300041456 Bacteria 631
264 Ga0451807_1001638 3300041486 Unclassified 538
265 Ga0439443_047852 3300042003 Bacteria 743
266 Ga0439452_066480 3300042010 Bacteria 800
267 Ga0439454_011119 3300042011 Bacteria 1198
268 Ga0439455_0037017 3300042012 Bacteria 1236
269 Ga0450915_009564 3300042119 Bacteria 665
270 Ga0450910_073153 3300042147 Unclassified 592
271 Ga0439434_0014120 3300042435 Bacteria 2376
272 Ga0439435_0078217 3300042436 Bacteria 989
273 Ga0439460_0135134 3300042461 Bacteria 815
274 Ga0439460_0351152 3300042461 Bacteria 520
275 Ga0439440_0063912 3300042993 Bacteria 945
276 Ga0466963_0280766 3300044694 Bacteria 1170
277 Ga0466964_0071603 3300044706 Unclassified 1467
278 Ga0466968_0406330 3300044735 Bacteria 668
279 Ga0466968_0413903 3300044735 Bacteria 662
280 Ga0466960_0208594 3300044901 Bacteria 1070
281 Ga0466967_0213264 3300045976 Unclassified 1832
282 Ga0466967_0559832 3300045976 Bacteria 1126
283 Ga0495627_061437 3300046453 Bacteria 1111
284 Ga0495653_0712439 3300046463 Bacteria 609
285 Ga0495605_0121158 3300046474 Bacteria 1186
286 Ga0495584_0190652 3300046491 Bacteria 1042
287 Ga0495596_0207099 3300046500 Bacteria 762
288 Ga0495596_0325805 3300046500 Bacteria 598
289 Ga0495616_0429622 3300046513 Bacteria 538
290 Ga0495637_0307185 3300046520 Bacteria 562
291 Ga0495642_0102039 3300046528 Bacteria 1222
292 Ga0495656_0035888 3300046615 Bacteria 2039
293 Ga0495611_0109948 3300046648 Bacteria 1283
294 Ga0495670_0144955 3300046691 Bacteria 1244
295 Ga0495589_0240563 3300046794 Bacteria 847
296 Ga0495589_0528743 3300046794 Bacteria 538
297 Ga0495683_0332081 3300047323 Bacteria 646
298 Ga0496101_0521229 3300048904 Unclassified 939
299 Ga0496102_0985092 3300048905 Bacteria 764
300 Ga0496102_1251928 3300048905 Bacteria 661
301 Ga0496105_0855572 3300048908 Unclassified 688
302 Ga0496106_0054691 3300048909 Bacteria 3016
303 Ga0496106_0594576 3300048909 Bacteria 886
304 Ga0496107_1259926 3300048910 Bacteria 530
305 Ga0496107_1328939 3300048910 Unclassified 514
306 Ga0496108_0538444 3300048911 Bacteria 1019
307 Ga0496108_0564901 3300048911 Bacteria 992
308 Ga0496109_1171609 3300048912 Bacteria 705
309 Ga0496112_0584007 3300048915 Bacteria 1050
310 Ga0496113_1299374 3300048916 Bacteria 566
311 Ga0501031_0001046 3300049568 Bacteria 16796
312 Ga0501031_0002949 3300049568 Bacteria 10889
313 Ga0501031_0036009 3300049568 Bacteria 3227
314 Ga0501031_0945915 3300049568 Bacteria 551
315 Ga0501032_0012381 3300049569 Bacteria 6098
316 Ga0501032_0058280 3300049569 Bacteria 2593
317 Ga0501033_0012494 3300049570 Bacteria 6479
318 Ga0501033_0150904 3300049570 Bacteria 1676
319 Ga0501033_0964249 3300049570 Bacteria 571
320 Ga0501034_0003348 3300049571 Bacteria 18285
321 Ga0501034_0118785 3300049571 Bacteria 2631
322 Ga0501036_0002160 3300049572 Bacteria 15353
323 Ga0501036_0003245 3300049572 Bacteria 12965
324 Ga0501036_0077229 3300049572 Bacteria 2817
325 Ga0501036_0969139 3300049572 Bacteria 697
326 Ga0501036_1017300 3300049572 Bacteria 678
327 Ga0501037_0004037 3300049573 Bacteria 10645
328 Ga0501037_0031155 3300049573 Bacteria 3938
329 Ga0501038_0003497 3300049574 Bacteria 14626
330 Ga0501038_0011446 3300049574 Bacteria 8094
331 Ga0501038_0088285 3300049574 Bacteria 2603
332 Ga0501039_0009571 3300049575 Bacteria 7386
333 Ga0501039_0049849 3300049575 Bacteria 3238
334 Ga0501039_0089150 3300049575 Bacteria 2403
335 Ga0501040_0005869 3300049576 Bacteria 7948
336 Ga0501040_0016175 3300049576 Bacteria 4933
337 Ga0501040_0033388 3300049576 Bacteria 3486
338 Ga0501040_0237513 3300049576 Bacteria 1298
339 Ga0501040_0501401 3300049576 Bacteria 875
340 Ga0501041_0000319 3300049577 Bacteria 23508
341 Ga0501041_0023616 3300049577 Bacteria 3687
342 Ga0501041_0032934 3300049577 Bacteria 3132
343 Ga0501041_0468562 3300049577 Bacteria 800
344 Ga0501042_0014292 3300049578 Bacteria 5417
345 Ga0501042_0034794 3300049578 Bacteria 3573
346 Ga0501042_0052494 3300049578 Bacteria 2907
347 Ga0501042_0062909 3300049578 Bacteria 2652
348 Ga0501043_0025120 3300049579 Bacteria 4674
349 Ga0501043_0073741 3300049579 Bacteria 2680
350 Ga0501043_0170511 3300049579 Bacteria 1698
351 Ga0501046_0003469 3300049580 Bacteria 14475
352 Ga0501046_0004494 3300049580 Bacteria 12643
353 Ga0501047_0005665 3300049581 Bacteria 11758
354 Ga0501048_0002790 3300049582 Bacteria 13342
355 Ga0501048_0027593 3300049582 Bacteria 4124
356 Ga0501048_0876282 3300049582 Bacteria 645
357 Ga0501048_1318918 3300049582 Bacteria 519
358 Ga0501067_0058158 3300049583 Bacteria 2141
359 Ga0501068_0040300 3300049584 Bacteria 2803
360 Ga0501068_0235584 3300049584 Bacteria 1164
361 Ga0501069_0040943 3300049585 Bacteria 2560
362 Ga0501069_0112912 3300049585 Bacteria 1548
363 Ga0501069_0155065 3300049585 Bacteria 1317
364 Ga0501070_0057283 3300049586 Bacteria 3230
365 Ga0501070_0164988 3300049586 Bacteria 1825
366 Ga0501071_0047060 3300049587 Bacteria 3098
367 Ga0501071_0048503 3300049587 Bacteria 3054
368 Ga0501071_0183160 3300049587 Bacteria 1570
369 Ga0501071_0187968 3300049587 Bacteria 1548
370 Ga0501071_0614401 3300049587 Bacteria 836
371 Ga0501072_0000892 3300049588 Bacteria 21902
372 Ga0501072_0102088 3300049588 Bacteria 2279
373 Ga0501072_0930377 3300049588 Bacteria 679
374 Ga0501073_0010977 3300049589 Bacteria 6626
375 Ga0501073_0040982 3300049589 Bacteria 3273
376 Ga0501074_0006569 3300049590 Bacteria 8406
377 Ga0501074_0007043 3300049590 Bacteria 8121
378 Ga0501074_0012433 3300049590 Bacteria 6187
379 Ga0501074_0204559 3300049590 Bacteria 1407
380 Ga0501075_0003818 3300049591 Bacteria 10142
381 Ga0501075_0039591 3300049591 Bacteria 3527
382 Ga0501076_0000940 3300049592 Bacteria 18997
383 Ga0501076_0010175 3300049592 Bacteria 6969
384 Ga0501076_0045201 3300049592 Bacteria 3476
385 Ga0501076_0416250 3300049592 Bacteria 1105
386 Ga0501076_0882234 3300049592 Bacteria 738
387 Ga0501076_0990860 3300049592 Bacteria 692
388 Ga0501077_0001852 3300049593 Bacteria 12782
389 Ga0501077_0042906 3300049593 Bacteria 2874
390 Ga0501077_0347193 3300049593 Bacteria 947
391 Ga0501253_074985 3300049683 Bacteria 754
392 Ga0501079_0000086 3300049741 Bacteria 44783
393 Ga0501079_0007181 3300049741 Bacteria 8408
394 Ga0501079_0090070 3300049741 Bacteria 2376
395 Ga0501079_0106369 3300049741 Bacteria 2177
396 Ga0501079_0303002 3300049741 Bacteria 1250
397 Ga0501079_0809055 3300049741 Bacteria 738
398 Ga0501079_1059158 3300049741 Bacteria 639
399 Ga0501079_1236210 3300049741 Bacteria 588
400 Ga0501080_0022159 3300049742 Bacteria 5884
401 Ga0501080_0041824 3300049742 Bacteria 4268
402 Ga0501081_0000235 3300049743 Bacteria 28089
403 Ga0501081_0083618 3300049743 Bacteria 2237
404 Ga0501083_0033758 3300049744 Bacteria 3501
405 Ga0501083_0049152 3300049744 Bacteria 2845
406 Ga0501083_0051026 3300049744 Bacteria 2782
407 Ga0501035_0004658 3300049822 Bacteria 13017
408 Ga0501035_0004918 3300049822 Bacteria 12674
409 Ga0501035_0343413 3300049822 Bacteria 1250
410 Ga0501035_0680150 3300049822 Bacteria 832
411 Ga0501044_0017424 3300049823 Bacteria 7706
412 Ga0501044_0296001 3300049823 Bacteria 1548
413 Ga0501045_0001187 3300049824 Bacteria 17323
414 Ga0501045_0012847 3300049824 Bacteria 5902
415 Ga0501045_0033170 3300049824 Bacteria 3744
416 Ga0501045_0033299 3300049824 Bacteria 3736
417 nmdc:mga0yw44_46678_c1 3300050492 Bacteria 2602
418 nmdc:mga05p37_378227_c1 3300050507 Bacteria 1660
419 nmdc:mga05p37_587260_c1 3300050507 Bacteria 1260
420 nmdc:mga09592_812095_c1 3300050508 Bacteria 790
421 nmdc:mga0qj67_349852_c1 3300050509 Bacteria 1195
422 nmdc:mga0qj67_415593_c1 3300050509 Bacteria 1085
423 nmdc:mga06r32_121285_c1 3300050510 Bacteria 2579
424 nmdc:mga06r32_270066_c1 3300050510 Bacteria 1688
425 nmdc:mga08y16_173949_c1 3300050511 Bacteria 2236
426 nmdc:mga08y16_1775978_c1 3300050511 Bacteria 570
427 nmdc:mga08y16_508011_c1 3300050511 Bacteria 1224
428 nmdc:mga08y16_671752_c1 3300050511 Bacteria 1038
429 nmdc:mga08y16_837068_c1 3300050511 Bacteria 910
430 nmdc:mga0n895_863885_c1 3300050512 Bacteria 892
431 nmdc:mga0a205_1366600_c1 3300050515 Bacteria 556
432 nmdc:mga0a205_665192_c1 3300050515 Bacteria 892
433 Ga0501084_0001163 3300054114 Bacteria 20525
434 Ga0501084_0014311 3300054114 Bacteria 6572
435 Ga0501084_0690334 3300054114 Bacteria 861
436 Ga0501084_0771914 3300054114 Bacteria 810
437 Ga0590074_003839 3300059423 Bacteria 2490
438 Ga0501082_0000584 3300060353 Bacteria 32310
439 Ga0501082_0029653 3300060353 Bacteria 4713
440 Ga0501082_0226125 3300060353 Bacteria 1628
441 Ga0501082_1155496 3300060353 Bacteria 677
442 Ga0501082_1774699 3300060353 Bacteria 538
443 Ga0530510_0014393 3300061734 Bacteria 5578
444 Ga0530510_0021940 3300061734 Bacteria 4545
445 Ga0530510_0022684 3300061734 Bacteria 4472
446 Ga0530510_0087182 3300061734 Bacteria 2275
447 Ga0530510_0240170 3300061734 Bacteria 1348
448 2738698212 2738541272 Bacteria 6848551
449 2739326528 2738543027 Bacteria 6409078
450 2809027773 2808606394 Bacteria 6248540
451 Ga0500616_0225001
452 rootH1_10031733
453 JGI25407J50210_10001786
454 JGI25407J50210_10005198
455 JGI25407J50210_10007179
456 JGI25407J50210_10008969
457 JGI25407J50210_10012016
458 JGI25407J50210_10013235
459 JGI25407J50210_10030346
460 JGI25407J50210_10060057
461 Ga0070658_10624303
462 Ga0070658_11291624
463 Ga0070683_100113678
464 Ga0070683_100228034
465 Ga0070683_100402940
466 Ga0068869_100221516
467 Ga0068869_100518994
468 Ga0068868_100512633
469 Ga0070660_100254383
470 Ga0070689_101486911
471 Ga0070661_100743270
472 Ga0070692_10089577
473 Ga0070692_10429513
474 Ga0070668_100006900
475 Ga0070669_101016192
476 Ga0070674_100384435
477 Ga0070674_100517904
478 Ga0070674_100875741
479 Ga0070688_100834049
480 Ga0070659_100325385
481 Ga0070659_100887569
482 Ga0070659_100948338
483 Ga0070667_102226898
484 Ga0070714_100141685
485 Ga0070714_100251266
486 Ga0070714_101064374
487 Ga0070713_101626385
488 Ga0070701_10395721
489 Ga0070701_11397388
490 Ga0070705_101880830
491 Ga0070700_100362846
492 Ga0070700_101439322
493 Ga0070708_100000013
494 Ga0070663_100476207
495 Ga0070662_100564290
496 Ga0070681_11899163
497 Ga0068867_100876785
498 Ga0070685_10472625
499 Ga0070706_100202527
500 Ga0070707_100313275
501 Ga0070707_101329792
502 Ga0070707_101670737
503 Ga0070698_100017945
504 Ga0070698_100148954
505 Ga0070679_100217036
506 Ga0070684_100086214
507 Ga0070684_100825450
508 Ga0070684_101669362
509 Ga0070665_101498898
510 Ga0070704_100524126
511 Ga0070704_101430559
512 Ga0070664_100307190
513 Ga0070664_100355361
514 Ga0068857_101845915
515 Ga0070702_100021848
516 Ga0070702_100184519
517 Ga0070702_100866636
518 Ga0068852_100397804
519 Ga0068852_100596345
520 Ga0068859_102538308
521 Ga0068864_100173099
522 Ga0068861_100979654
523 Ga0068851_10133817
524 Ga0068862_100356162
525 Ga0081455_10276142
526 Ga0081455_10628538
527 Ga0081538_10000080
528 Ga0081538_10001298
529 Ga0081538_10002401
530 Ga0081538_10005393
531 Ga0081538_10006598
532 Ga0081538_10007484
533 Ga0081538_10012727
534 Ga0081538_10019294
535 Ga0081538_10031247
536 Ga0081538_10033686
537 Ga0081538_10068990
538 Ga0081538_10069277
539 Ga0081538_10119126
540 Ga0081538_10128283
541 Ga0081538_10216309
542 Ga0081538_10243362
543 Ga0081538_10274602
544 Ga0081538_10387746
545 Ga0081540_1144779
546 Ga0070717_10862261
547 Ga0070717_11779405
548 Ga0075365_10028574
549 Ga0097621_100328933
550 Ga0075428_100190413
551 Ga0075428_100641040
552 Ga0075430_100180353
553 Ga0075431_100321009
554 Ga0075433_10678966
555 Ga0068865_100057376
556 Ga0068865_100246452
557 Ga0097620_102538000
558 Ga0111539_10137956
559 Ga0111539_10527282
560 Ga0111539_10725918
561 Ga0111539_11254965
562 Ga0111539_11510676
563 Ga0111539_12010441
564 Ga0105245_10311336
565 Ga0105245_10643626
566 Ga0105245_11964918
567 Ga0114129_10548211
568 Ga0114129_10575813
569 Ga0105243_10023251
570 Ga0105243_10458124
571 Ga0105243_10809380
572 Ga0105243_10880975
573 Ga0105242_12399275
574 Ga0105248_10546276
575 Ga0105248_10702545
576 Ga0105237_11187933
577 Ga0105238_12197567
578 Ga0105249_10255158
579 Ga0105249_10372528
580 Ga0105246_10479438
581 Ga0157329_1024002
582 Ga0157374_10973032
583 Ga0157374_11704575
584 Ga0157374_12133947
585 Ga0163162_10630284
586 Ga0163162_11071616
587 Ga0163162_11174088
588 Ga0157372_10262832
589 Ga0157375_12492949
590 Ga0157380_10597377
591 Ga0182008_10975309
592 Ga0157377_10100895
593 Ga0157376_12418456
594 Ga0163161_11002370
595 Ga0213876_10504500
596 Ga0207656_10086211
597 Ga0207688_10753175
598 Ga0207647_10531967
599 Ga0207685_10196299
600 Ga0207705_10930028
601 Ga0207684_11160906
602 Ga0207657_10181517
603 Ga0207649_10421978
604 Ga0207646_10190259
605 Ga0207646_11049019
606 Ga0207681_10159696
607 Ga0207700_11438807
608 Ga0207664_10142550
609 Ga0207664_10513891
610 Ga0207664_11052524
611 Ga0207690_10340844
612 Ga0207690_10729748
613 Ga0207690_10732882
614 Ga0207709_10135998
615 Ga0207709_10202272
616 Ga0207709_10285494
617 Ga0207709_10881827
618 Ga0207669_10244049
619 Ga0207669_10770103
620 Ga0207704_11725167
621 Ga0207691_10169929
622 Ga0207689_10187902
623 Ga0207661_10029656
624 Ga0207661_10116773
625 Ga0207661_11464315
626 Ga0207679_10129188
627 Ga0207679_10774771
628 Ga0207679_10981662
629 Ga0207712_11264443
630 Ga0207712_11909331
631 Ga0207668_10986130
632 Ga0207640_10345423
633 Ga0207677_10487960
634 Ga0207678_10520749
635 Ga0207708_10716326
636 Ga0207708_11117734
637 Ga0207702_11825926
638 Ga0207648_10090713
639 Ga0207676_10274084
640 Ga0207674_10718741
641 Ga0207675_100586154
642 Ga0207683_10150569
643 Ga0207698_10190133
644 Ga0207698_10452657
645 Ga0207698_10773994
646 Ga0207428_10099478
647 Ga0268266_10401445
648 Ga0268265_10298843
649 Ga0268265_11110348
650 Ga0268265_11238489
651 Ga0316177_1085566
652 Ga0316176_1155188
653 Ga0314311_1165958
654 Ga0316179_1092911
655 Ga0307408_100843391
656 Ga0307516_10012491
657 Ga0307516_10049323
658 Ga0307405_10579226
659 Ga0307405_11400926
660 Ga0307405_11423215
661 Ga0307405_11864430
662 Ga0307405_12098398
663 Ga0307413_10810617
664 Ga0307413_11202648
665 Ga0307410_10692759
666 Ga0307410_11756096
667 Ga0307406_10015882
668 Ga0307406_10039620
669 Ga0307407_10075800
670 Ga0307407_10268826
671 Ga0307407_11681854
672 Ga0307409_100648555
673 Ga0307409_101869391
674 Ga0307416_100662357
675 Ga0307416_100932144
676 Ga0307416_101119523
677 Ga0307416_102023718
678 Ga0307414_10768283
679 Ga0307411_10374292
680 Ga0307411_11282901
681 Ga0307415_100098404
682 Ga0307415_100145152
683 Ga0307415_100241041
684 Ga0307415_101373075
685 Ga0307415_101586497
686 Ga0395900_0019124
687 Ga0395900_0089491
688 Ga0395900_0478768
689 Ga0395900_0791201
690 Ga0395898_0025889
691 Ga0395898_0197168
692 Ga0395898_0209885
693 Ga0395898_0951862
694 Ga0395905_0086946
695 Ga0395905_0313125
696 Ga0395905_0558344
697 Ga0395905_1546594
698 Ga0436364_0210409
699 Ga0436364_0382546
700 Ga0395901_0015018
701 Ga0395901_0053851
702 Ga0395901_0263992
703 Ga0395901_0285204
704 Ga0395901_1630081
705 Ga0395901_1671385
706 Ga0436365_0547332
707 Ga0436365_1558885
708 Ga0436363_1075404
709 Ga0439438_021921
710 Ga0439461_0034410
711 Ga0451793_0639572
712 Ga0451797_0604650
713 Ga0451795_0957216
714 Ga0451807_1001638
715 Ga0439443_047852
716 Ga0439452_066480
717 Ga0439454_011119
718 Ga0439455_0037017
719 Ga0450915_009564
720 Ga0450910_073153
721 Ga0439434_0014120
722 Ga0439435_0078217
723 Ga0439460_0135134
724 Ga0439460_0351152
725 Ga0439440_0063912
726 Ga0466963_0280766
727 Ga0466964_0071603
728 Ga0466968_0406330
729 Ga0466968_0413903
730 Ga0466960_0208594
731 Ga0466967_0213264
732 Ga0466967_0559832
733 Ga0495627_061437
734 Ga0495653_0712439
735 Ga0495605_0121158
736 Ga0495584_0190652
737 Ga0495596_0207099
738 Ga0495596_0325805
739 Ga0495616_0429622
740 Ga0495637_0307185
741 Ga0495642_0102039
742 Ga0495656_0035888
743 Ga0495611_0109948
744 Ga0495670_0144955
745 Ga0495589_0240563
746 Ga0495589_0528743
747 Ga0495683_0332081
748 Ga0496101_0521229
749 Ga0496102_0985092
750 Ga0496102_1251928
751 Ga0496105_0855572
752 Ga0496106_0054691
753 Ga0496106_0594576
754 Ga0496107_1259926
755 Ga0496107_1328939
756 Ga0496108_0538444
757 Ga0496108_0564901
758 Ga0496109_1171609
759 Ga0496112_0584007
760 Ga0496113_1299374
761 Ga0501031_0001046
762 Ga0501031_0002949
763 Ga0501031_0036009
764 Ga0501031_0945915
765 Ga0501032_0012381
766 Ga0501032_0058280
767 Ga0501033_0012494
768 Ga0501033_0150904
769 Ga0501033_0964249
770 Ga0501034_0003348
771 Ga0501034_0118785
772 Ga0501036_0002160
773 Ga0501036_0003245
774 Ga0501036_0077229
775 Ga0501036_0969139
776 Ga0501036_1017300
777 Ga0501037_0004037
778 Ga0501037_0031155
779 Ga0501038_0003497
780 Ga0501038_0011446
781 Ga0501038_0088285
782 Ga0501039_0009571
783 Ga0501039_0049849
784 Ga0501039_0089150
785 Ga0501040_0005869
786 Ga0501040_0016175
787 Ga0501040_0033388
788 Ga0501040_0237513
789 Ga0501040_0501401
790 Ga0501041_0000319
791 Ga0501041_0023616
792 Ga0501041_0032934
793 Ga0501041_0468562
794 Ga0501042_0014292
795 Ga0501042_0034794
796 Ga0501042_0052494
797 Ga0501042_0062909
798 Ga0501043_0025120
799 Ga0501043_0073741
800 Ga0501043_0170511
801 Ga0501046_0003469
802 Ga0501046_0004494
803 Ga0501047_0005665
804 Ga0501048_0002790
805 Ga0501048_0027593
806 Ga0501048_0876282
807 Ga0501048_1318918
808 Ga0501067_0058158
809 Ga0501068_0040300
810 Ga0501068_0235584
811 Ga0501069_0040943
812 Ga0501069_0112912
813 Ga0501069_0155065
814 Ga0501070_0057283
815 Ga0501070_0164988
816 Ga0501071_0047060
817 Ga0501071_0048503
818 Ga0501071_0183160
819 Ga0501071_0187968
820 Ga0501071_0614401
821 Ga0501072_0000892
822 Ga0501072_0102088
823 Ga0501072_0930377
824 Ga0501073_0010977
825 Ga0501073_0040982
826 Ga0501074_0006569
827 Ga0501074_0007043
828 Ga0501074_0012433
829 Ga0501074_0204559
830 Ga0501075_0003818
831 Ga0501075_0039591
832 Ga0501076_0000940
833 Ga0501076_0010175
834 Ga0501076_0045201
835 Ga0501076_0416250
836 Ga0501076_0882234
837 Ga0501076_0990860
838 Ga0501077_0001852
839 Ga0501077_0042906
840 Ga0501077_0347193
841 Ga0501253_074985
842 Ga0501079_0000086
843 Ga0501079_0007181
844 Ga0501079_0090070
845 Ga0501079_0106369
846 Ga0501079_0303002
847 Ga0501079_0809055
848 Ga0501079_1059158
849 Ga0501079_1236210
850 Ga0501080_0022159
851 Ga0501080_0041824
852 Ga0501081_0000235
853 Ga0501081_0083618
854 Ga0501083_0033758
855 Ga0501083_0049152
856 Ga0501083_0051026
857 Ga0501035_0004658
858 Ga0501035_0004918
859 Ga0501035_0343413
860 Ga0501035_0680150
861 Ga0501044_0017424
862 Ga0501044_0296001
863 Ga0501045_0001187
864 Ga0501045_0012847
865 Ga0501045_0033170
866 Ga0501045_0033299
867 nmdc:mga0yw44_46678_c1
868 nmdc:mga05p37_378227_c1
869 nmdc:mga05p37_587260_c1
870 nmdc:mga09592_812095_c1
871 nmdc:mga0qj67_349852_c1
872 nmdc:mga0qj67_415593_c1
873 nmdc:mga06r32_121285_c1
874 nmdc:mga06r32_270066_c1
875 nmdc:mga08y16_173949_c1
876 nmdc:mga08y16_1775978_c1
877 nmdc:mga08y16_508011_c1
878 nmdc:mga08y16_671752_c1
879 nmdc:mga08y16_837068_c1
880 nmdc:mga0n895_863885_c1
881 nmdc:mga0a205_1366600_c1
882 nmdc:mga0a205_665192_c1
883 Ga0501084_0001163
884 Ga0501084_0014311
885 Ga0501084_0690334
886 Ga0501084_0771914
887 Ga0590074_003839
888 Ga0501082_0000584
889 Ga0501082_0029653
890 Ga0501082_0226125
891 Ga0501082_1155496
892 Ga0501082_1774699
893 Ga0530510_0014393
894 Ga0530510_0021940
895 Ga0530510_0022684
896 Ga0530510_0087182
897 Ga0530510_0240170
898 2738698212
899 2739326528
900 2809027773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

14

63

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

16

62

0.96

PF09339

HTH_IclR

IclR helix-turn-helix domain

20

64

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9633 18 74
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9524 18 73
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9523 7 78
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9523 18 73
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9411 8 82
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9678 16 72 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9633 18 74 1.10.10.10
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9574 7 80 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9546 19 73 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9524 18 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7H2BEU7-F1-model_v4 Metalloregulator ArsR/SmtB family transcription factor 0.9773 11 93 GO:0003700
AF-A0A841HZ84-F1-model_v4 HTH arsR-type domain-containing protein 0.9741 7 80 GO:0003700
AF-A0A378H3B4-F1-model_v4 deleted 0.9734 9 91
AF-A0A511MYI0-F1-model_v4 HTH arsR-type domain-containing protein 0.9732 7 79 GO:0003700
AF-A0A399Z9V9-F1-model_v4 Transcriptional regulator 0.971 6 78 GO:0003700

Map