F446595

General Info

Members Datasets Scaffolds Average Seq Length
450 238 450 155

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10384643|Ga0207671_103846432
Length 182
Sequence MTVEEFKIFLPTIPGQPGVYRFIDKREIPIYVGKAKDLRKRLTAAGHDIVDFGANRLEPGDDYPDFVTPLARAVAAGTLERGIAVCGSGVGASVCANKVPGVHAGLINDHFSARQGVEDDHMNVICLGGRVMGTMVAWDLVESFLAAEFSQEERHLRRLSKVAALETKAANEVGAEASTIPA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
154 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 1.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10106546 3300005293 Bacteria 2822
2 Ga0065715_10166791 3300005293 Bacteria 1570
3 Ga0065715_10632172 3300005293 Bacteria 682
4 Ga0065707_10015971 3300005295 Bacteria 2054
5 Ga0065707_10347906 3300005295 Bacteria 923
6 Ga0070676_10041866 3300005328 Bacteria 2657
7 Ga0070683_100039824 3300005329 Bacteria 4317
8 Ga0070690_100033878 3300005330 Bacteria 3199
9 Ga0068869_100006864 3300005334 Bacteria 7242
10 Ga0068869_100123206 3300005334 Bacteria 1985
11 Ga0070666_10001715 3300005335 Bacteria 13364
12 Ga0070666_10591432 3300005335 Unclassified 809
13 Ga0070680_100618153 3300005336 Unclassified 930
14 Ga0070682_100389553 3300005337 Unclassified 1051
15 Ga0068868_100008872 3300005338 Bacteria 7204
16 Ga0070660_100028197 3300005339 Bacteria 4199
17 Ga0070687_100170545 3300005343 Bacteria 1295
18 Ga0070668_100220091 3300005347 Unclassified 1565
19 Ga0070669_100023750 3300005353 Bacteria 4393
20 Ga0070669_101544751 3300005353 Unclassified 577
21 Ga0070675_100236178 3300005354 Unclassified 1596
22 Ga0070671_100003755 3300005355 Bacteria 11927
23 Ga0070674_100368152 3300005356 Bacteria 1166
24 Ga0070673_100245584 3300005364 Bacteria 1558
25 Ga0070673_100500486 3300005364 Unclassified 1099
26 Ga0070659_100113469 3300005366 Bacteria 2189
27 Ga0070667_100004703 3300005367 Bacteria 11448
28 Ga0070667_100539678 3300005367 Unclassified 1071
29 Ga0070709_10010814 3300005434 Bacteria 5065
30 Ga0070709_10021636 3300005434 Bacteria 3748
31 Ga0070709_10047885 3300005434 Bacteria 2665
32 Ga0070709_11206972 3300005434 Bacteria 608
33 Ga0070714_100161808 3300005435 Unclassified 2026
34 Ga0070714_100293323 3300005435 Bacteria 1514
35 Ga0070713_100001526 3300005436 Bacteria 14773
36 Ga0070713_100533146 3300005436 Bacteria 1110
37 Ga0070713_100550048 3300005436 Bacteria 1093
38 Ga0070713_100662443 3300005436 Bacteria 995
39 Ga0070710_11422605 3300005437 Bacteria 519
40 Ga0070701_10029136 3300005438 Bacteria 2720
41 Ga0070711_100027812 3300005439 Bacteria 3715
42 Ga0070711_100143925 3300005439 Unclassified 1791
43 Ga0070711_100165485 3300005439 Unclassified 1680
44 Ga0070711_100724290 3300005439 Bacteria 839
45 Ga0070711_101167462 3300005439 Unclassified 665
46 Ga0070705_100055548 3300005440 Unclassified 2328
47 Ga0070705_100307024 3300005440 Bacteria 1139
48 Ga0070700_100365841 3300005441 Bacteria 1074
49 Ga0070694_100000274 3300005444 Bacteria 27377
50 Ga0070708_100000460 3300005445 Bacteria 30625
51 Ga0070708_100011652 3300005445 Bacteria 7155
52 Ga0070678_100007607 3300005456 Bacteria 6437
53 Ga0070678_100106091 3300005456 Bacteria 2188
54 Ga0070662_100051507 3300005457 Bacteria 2973
55 Ga0070662_100962832 3300005457 Unclassified 730
56 Ga0070681_10037936 3300005458 Bacteria 4832
57 Ga0070681_10208626 3300005458 Bacteria 1870
58 Ga0068867_100011563 3300005459 Bacteria 6231
59 Ga0068867_100587487 3300005459 Bacteria 969
60 Ga0070706_100058150 3300005467 Bacteria 3568
61 Ga0070706_100067456 3300005467 Bacteria 3309
62 Ga0070706_100799857 3300005467 Bacteria 873
63 Ga0070707_100008282 3300005468 Bacteria 9648
64 Ga0070707_100021828 3300005468 Bacteria 6052
65 Ga0070707_100026419 3300005468 Bacteria 5512
66 Ga0070707_100206770 3300005468 Bacteria 1913
67 Ga0070698_100002476 3300005471 Bacteria 20366
68 Ga0070698_100475316 3300005471 Bacteria 1186
69 Ga0070699_100000738 3300005518 Bacteria 30317
70 Ga0070699_100028933 3300005518 Bacteria 4777
71 Ga0070699_100104232 3300005518 Bacteria 2488
72 Ga0070679_100032040 3300005530 Bacteria 5197
73 Ga0070684_100225020 3300005535 Bacteria 1712
74 Ga0070697_100081515 3300005536 Unclassified 2666
75 Ga0068853_100370865 3300005539 Bacteria 1335
76 Ga0068853_100954443 3300005539 Bacteria 825
77 Ga0070672_101280690 3300005543 Unclassified 654
78 Ga0070686_100060182 3300005544 Bacteria 2450
79 Ga0070686_100272257 3300005544 Bacteria 1245
80 Ga0070686_100916403 3300005544 Unclassified 714
81 Ga0070695_100055650 3300005545 Bacteria 2550
82 Ga0070695_100062695 3300005545 Bacteria 2415
83 Ga0070695_100067486 3300005545 Bacteria 2333
84 Ga0070695_100242445 3300005545 Unclassified 1308
85 Ga0070696_100179830 3300005546 Bacteria 1568
86 Ga0070693_100024503 3300005547 Bacteria 3237
87 Ga0070693_100592163 3300005547 Unclassified 799
88 Ga0070665_101521467 3300005548 Unclassified 677
89 Ga0070704_100046421 3300005549 Bacteria 3029
90 Ga0070704_100176924 3300005549 Bacteria 1703
91 Ga0068855_100321513 3300005563 Bacteria 1710
92 Ga0068855_100942747 3300005563 Bacteria 910
93 Ga0070664_100118891 3300005564 Bacteria 2312
94 Ga0070664_100228315 3300005564 Bacteria 1668
95 Ga0068857_100002970 3300005577 Bacteria 13970
96 Ga0068854_100212769 3300005578 Bacteria 1526
97 Ga0068856_100039123 3300005614 Bacteria 4656
98 Ga0068856_100440799 3300005614 Bacteria 1323
99 Ga0068856_102022221 3300005614 Unclassified 586
100 Ga0070702_100420185 3300005615 Unclassified 962
101 Ga0068859_100220624 3300005617 Bacteria 1984
102 Ga0068866_10002078 3300005718 Bacteria 8323
103 Ga0068861_100064426 3300005719 Bacteria 2820
104 Ga0068861_102437905 3300005719 Unclassified 526
105 Ga0068863_100209583 3300005841 Bacteria 1876
106 Ga0068863_100303054 3300005841 Bacteria 1550
107 Ga0068863_100595298 3300005841 Bacteria 1094
108 Ga0068858_100022629 3300005842 Bacteria 5861
109 Ga0068858_100050888 3300005842 Bacteria 3834
110 Ga0068858_100224168 3300005842 Bacteria 1781
111 Ga0068860_100018177 3300005843 Bacteria 6843
112 Ga0068860_100048112 3300005843 Bacteria 4065
113 Ga0068860_100098532 3300005843 Bacteria 2787
114 Ga0068862_100058468 3300005844 Bacteria 3307
115 Ga0068862_100367938 3300005844 Bacteria 1337
116 Ga0070717_11516831 3300006028 Unclassified 608
117 Ga0070715_10002149 3300006163 Bacteria 5973
118 Ga0070716_100001260 3300006173 Bacteria 11149
119 Ga0070716_100068889 3300006173 Bacteria 2072
120 Ga0070716_100155807 3300006173 Bacteria 1475
121 Ga0070716_100392254 3300006173 Bacteria 996
122 Ga0070712_100000101 3300006175 Bacteria 43677
123 Ga0070712_100629087 3300006175 Unclassified 910
124 Ga0070712_101245128 3300006175 Unclassified 648
125 Ga0097621_100093154 3300006237 Bacteria 2524
126 Ga0097621_100561100 3300006237 Bacteria 1040
127 Ga0097621_100734479 3300006237 Bacteria 911
128 Ga0097621_101656228 3300006237 Unclassified 609
129 Ga0068871_100011641 3300006358 Bacteria 6458
130 Ga0068871_100306238 3300006358 Bacteria 1396
131 Ga0068871_100407400 3300006358 Unclassified 1212
132 Ga0068871_100862836 3300006358 Unclassified 837
133 Ga0075428_100269570 3300006844 Bacteria 1832
134 Ga0075433_10002499 3300006852 Bacteria 13989
135 Ga0075433_10509491 3300006852 Bacteria 1059
136 Ga0075434_100001045 3300006871 Bacteria 22585
137 Ga0075434_100111228 3300006871 Bacteria 2750
138 Ga0075434_101177993 3300006871 Bacteria 779
139 Ga0075434_101228024 3300006871 Bacteria 761
140 Ga0075429_100055711 3300006880 Bacteria 3440
141 Ga0068865_100009086 3300006881 Bacteria 6150
142 Ga0068865_100092055 3300006881 Bacteria 2202
143 Ga0068865_101141826 3300006881 Unclassified 688
144 Ga0075436_100021131 3300006914 Bacteria 4466
145 Ga0075436_100255455 3300006914 Unclassified 1249
146 Ga0097620_100220627 3300006931 Bacteria 1984
147 Ga0075435_100002717 3300007076 Bacteria 11814
148 Ga0075435_100085392 3300007076 Bacteria 2598
149 Ga0075435_100346839 3300007076 Bacteria 1272
150 Ga0111539_10098845 3300009094 Bacteria 3427
151 Ga0105245_10056336 3300009098 Bacteria 3533
152 Ga0105245_10065624 3300009098 Bacteria 3283
153 Ga0105245_10242426 3300009098 Bacteria 1748
154 Ga0105245_10612523 3300009098 Bacteria 1116
155 Ga0114129_10038495 3300009147 Bacteria 6745
156 Ga0114129_10127678 3300009147 Bacteria 3495
157 Ga0114129_10428847 3300009147 Bacteria 1738
158 Ga0114129_10749899 3300009147 Bacteria 1250
159 Ga0114129_11622730 3300009147 Bacteria 791
160 Ga0105243_10033564 3300009148 Bacteria 3969
161 Ga0105243_10725843 3300009148 Bacteria 971
162 Ga0105241_10005346 3300009174 Bacteria 9487
163 Ga0105241_10128295 3300009174 Bacteria 2050
164 Ga0105241_10404595 3300009174 Bacteria 1198
165 Ga0105242_10062813 3300009176 Bacteria 3057
166 Ga0105242_10224326 3300009176 Bacteria 1681
167 Ga0105242_10235384 3300009176 Bacteria 1643
168 Ga0105242_10695564 3300009176 Unclassified 994
169 Ga0105248_10016667 3300009177 Bacteria 8087
170 Ga0105248_10036882 3300009177 Bacteria 5468
171 Ga0105248_10107503 3300009177 Unclassified 3146
172 Ga0105248_10357966 3300009177 Bacteria 1643
173 Ga0105248_11895006 3300009177 Unclassified 677
174 Ga0105237_11044359 3300009545 Unclassified 824
175 Ga0105238_10177380 3300009551 Bacteria 2107
176 Ga0105238_10653646 3300009551 Bacteria 1061
177 Ga0105249_10392952 3300009553 Bacteria 1415
178 Ga0105249_11606619 3300009553 Bacteria 723
179 Ga0105249_12153503 3300009553 Unclassified 630
180 Ga0099796_10035380 3300010159 Bacteria 1656
181 Ga0105239_10011627 3300010375 Bacteria 9821
182 Ga0105239_10085771 3300010375 Bacteria 3471
183 Ga0105239_11515349 3300010375 Unclassified 775
184 Ga0157371_10300641 3300013102 Unclassified 1162
185 Ga0157371_10693707 3300013102 Unclassified 762
186 Ga0157374_10000377 3300013296 Bacteria 41023
187 Ga0157374_10016314 3300013296 Bacteria 6524
188 Ga0157374_10358781 3300013296 Bacteria 1449
189 Ga0157378_10095327 3300013297 Bacteria 2710
190 Ga0157378_10138070 3300013297 Bacteria 2262
191 Ga0157378_10252647 3300013297 Bacteria 1688
192 Ga0157378_11279824 3300013297 Unclassified 774
193 Ga0157378_11380959 3300013297 Bacteria 747
194 Ga0163162_10001545 3300013306 Bacteria 21498
195 Ga0163162_10010209 3300013306 Bacteria 9123
196 Ga0163162_10104064 3300013306 Bacteria 2933
197 Ga0163162_10663243 3300013306 Bacteria 1166
198 Ga0163162_10774869 3300013306 Unclassified 1078
199 Ga0163162_11887329 3300013306 Unclassified 684
200 Ga0157372_10346555 3300013307 Bacteria 1731
201 Ga0157375_10131042 3300013308 Bacteria 2627
202 Ga0157375_12750627 3300013308 Unclassified 588
203 Ga0163163_11459019 3300014325 Unclassified 746
204 Ga0157380_10534719 3300014326 Bacteria 1146
205 Ga0157380_12159399 3300014326 Unclassified 620
206 Ga0157379_10074022 3300014968 Bacteria 3049
207 Ga0157379_10109045 3300014968 Bacteria 2486
208 Ga0157379_10182568 3300014968 Bacteria 1895
209 Ga0157376_10067517 3300014969 Bacteria 3025
210 Ga0157376_10178178 3300014969 Bacteria 1941
211 Ga0163161_10003925 3300017792 Bacteria 10432
212 Ga0213872_10178444 3300021361 Unclassified 918
213 Ga0213872_10204747 3300021361 Bacteria 845
214 Ga0213875_10048613 3300021388 Bacteria 1990
215 Ga0224569_114424 3300022732 Bacteria 552
216 Ga0207642_10049755 3300025899 Bacteria 1886
217 Ga0207642_10281045 3300025899 Bacteria 957
218 Ga0207680_10001385 3300025903 Bacteria 11453
219 Ga0207680_10572327 3300025903 Unclassified 807
220 Ga0207647_10189229 3300025904 Bacteria 1193
221 Ga0207699_10047858 3300025906 Unclassified 2509
222 Ga0207699_10060568 3300025906 Bacteria 2274
223 Ga0207645_10013377 3300025907 Bacteria 5531
224 Ga0207645_10187976 3300025907 Bacteria 1356
225 Ga0207684_10001945 3300025910 Bacteria 21405
226 Ga0207684_10222588 3300025910 Unclassified 1628
227 Ga0207684_10900001 3300025910 Bacteria 744
228 Ga0207684_11547747 3300025910 Unclassified 538
229 Ga0207654_10223122 3300025911 Bacteria 1251
230 Ga0207654_10412841 3300025911 Bacteria 941
231 Ga0207707_10022584 3300025912 Bacteria 5499
232 Ga0207671_10257585 3300025914 Bacteria 1372
233 Ga0207671_10292854 3300025914 Bacteria 1285
234 Ga0207671_10384643 3300025914 Unclassified 1115
235 Ga0207693_10000124 3300025915 Bacteria 69213
236 Ga0207693_10079986 3300025915 Bacteria 2558
237 Ga0207693_10460575 3300025915 Bacteria 993
238 Ga0207663_10043595 3300025916 Bacteria 2748
239 Ga0207663_10055534 3300025916 Bacteria 2485
240 Ga0207663_10091224 3300025916 Unclassified 2022
241 Ga0207663_10296978 3300025916 Bacteria 1205
242 Ga0207662_10002895 3300025918 Bacteria 8701
243 Ga0207649_10165334 3300025920 Bacteria 1536
244 Ga0207652_11147405 3300025921 Unclassified 678
245 Ga0207646_10003115 3300025922 Bacteria 19043
246 Ga0207646_10009119 3300025922 Bacteria 9846
247 Ga0207646_10041964 3300025922 Bacteria 4110
248 Ga0207646_10253483 3300025922 Bacteria 1590
249 Ga0207681_10127345 3300025923 Bacteria 1877
250 Ga0207681_10186892 3300025923 Bacteria 1582
251 Ga0207681_10289088 3300025923 Bacteria 1293
252 Ga0207694_10188519 3300025924 Bacteria 1675
253 Ga0207687_10034284 3300025927 Bacteria 3446
254 Ga0207687_10122018 3300025927 Bacteria 1950
255 Ga0207700_10007287 3300025928 Bacteria 6749
256 Ga0207664_10411310 3300025929 Bacteria 1204
257 Ga0207644_10015295 3300025931 Bacteria 5147
258 Ga0207706_10002401 3300025933 Bacteria 18268
259 Ga0207706_10011251 3300025933 Bacteria 8159
260 Ga0207686_10599046 3300025934 Unclassified 867
261 Ga0207686_11060857 3300025934 Unclassified 659
262 Ga0207709_10124058 3300025935 Bacteria 1749
263 Ga0207669_10339957 3300025937 Unclassified 1156
264 Ga0207704_10080341 3300025938 Bacteria 2105
265 Ga0207704_10880733 3300025938 Unclassified 752
266 Ga0207665_10001677 3300025939 Bacteria 14902
267 Ga0207665_10006349 3300025939 Bacteria 7839
268 Ga0207665_10015541 3300025939 Bacteria 4996
269 Ga0207665_10042759 3300025939 Unclassified 3029
270 Ga0207665_10144972 3300025939 Bacteria 1696
271 Ga0207711_10682365 3300025941 Bacteria 958
272 Ga0207711_11149225 3300025941 Unclassified 717
273 Ga0207689_10001367 3300025942 Bacteria 23390
274 Ga0207689_10210681 3300025942 Bacteria 1606
275 Ga0207661_10012931 3300025944 Bacteria 6088
276 Ga0207679_10084189 3300025945 Bacteria 2440
277 Ga0207679_10172787 3300025945 Bacteria 1781
278 Ga0207667_10079596 3300025949 Bacteria 3396
279 Ga0207667_10134569 3300025949 Bacteria 2545
280 Ga0207712_10480551 3300025961 Unclassified 1059
281 Ga0207668_10688611 3300025972 Unclassified 897
282 Ga0207640_10175842 3300025981 Bacteria 1600
283 Ga0207658_11415222 3300025986 Unclassified 636
284 Ga0207703_10030135 3300026035 Bacteria 4286
285 Ga0207703_10892257 3300026035 Unclassified 851
286 Ga0207639_10217944 3300026041 Bacteria 1647
287 Ga0207639_11360643 3300026041 Unclassified 666
288 Ga0207678_10088375 3300026067 Bacteria 2648
289 Ga0207708_10087432 3300026075 Bacteria 2400
290 Ga0207702_10280177 3300026078 Bacteria 1576
291 Ga0207702_10431438 3300026078 Bacteria 1276
292 Ga0207641_10080777 3300026088 Bacteria 2822
293 Ga0207641_10250859 3300026088 Bacteria 1653
294 Ga0207641_10447223 3300026088 Bacteria 1248
295 Ga0207641_10557045 3300026088 Bacteria 1118
296 Ga0207641_10700618 3300026088 Unclassified 997
297 Ga0207648_10013759 3300026089 Bacteria 7510
298 Ga0207648_10013933 3300026089 Bacteria 7455
299 Ga0207648_10057018 3300026089 Bacteria 3408
300 Ga0207674_10004517 3300026116 Bacteria 16711
301 Ga0207675_100016104 3300026118 Bacteria 6983
302 Ga0207675_100058993 3300026118 Bacteria 3582
303 Ga0207675_100293407 3300026118 Bacteria 1582
304 Ga0207675_100750929 3300026118 Unclassified 987
305 Ga0207675_102303598 3300026118 Unclassified 552
306 Ga0207683_10007606 3300026121 Bacteria 9281
307 Ga0207683_10116177 3300026121 Bacteria 2399
308 Ga0207428_10042309 3300027907 Bacteria 3684
309 Ga0207428_10450273 3300027907 Bacteria 939
310 Ga0268266_10001863 3300028379 Bacteria 23829
311 Ga0268265_10364961 3300028380 Unclassified 1323
312 Ga0268264_10109600 3300028381 Bacteria 2416
313 Ga0268264_10163536 3300028381 Bacteria 2007
314 Ga0268264_10656643 3300028381 Unclassified 1038
315 Ga0268264_10956037 3300028381 Bacteria 862
316 Ga0265337_1005118 3300028556 Bacteria 5276
317 Ga0265336_10173352 3300028666 Unclassified 641
318 Ga0265338_10481903 3300028800 Bacteria 875
319 Ga0265320_10000566 3300031240 Bacteria 28582
320 Ga0373938_0031388 3300034957 Bacteria 1139
321 Ga0373954_0169551 3300035118 Unclassified 1069
322 Ga0373931_0307888 3300035691 Bacteria 980
323 Ga0373927_0404176 3300035695 Bacteria 901
324 Ga0373927_0625606 3300035695 Bacteria 712
325 Ga0373947_0148624 3300035725 Bacteria 1508
326 Ga0373947_0203528 3300035725 Bacteria 1296
327 Ga0316582_0654955 3300036647 Bacteria 722
328 Ga0373925_0042100 3300037068 Bacteria 3388
329 Ga0373925_0217581 3300037068 Unclassified 1524
330 Ga0395900_0227648 3300037418 Bacteria 1877
331 Ga0395900_0888325 3300037418 Bacteria 815
332 Ga0395898_0702278 3300037466 Bacteria 953
333 Ga0395898_1165701 3300037466 Bacteria 702
334 Ga0395898_1471053 3300037466 Unclassified 608
335 Ga0395905_0038392 3300037471 Bacteria 4494
336 Ga0395905_0079656 3300037471 Bacteria 3071
337 Ga0395905_0147061 3300037471 Bacteria 2217
338 Ga0395905_0155463 3300037471 Bacteria 2151
339 Ga0395905_1035144 3300037471 Bacteria 724
340 Ga0436364_0897119 3300037853 Bacteria 4903
341 Ga0395901_1059919 3300038443 Unclassified 783
342 Ga0395901_1338498 3300038443 Unclassified 677
343 Ga0436365_0197260 3300039437 Bacteria 27939
344 Ga0436360_0142918 3300039438 Bacteria 2666
345 Ga0436361_0008440 3300039447 Bacteria 5180
346 Ga0436361_0205323 3300039447 Unclassified 1489
347 Ga0436361_0704747 3300039447 Unclassified 1387
348 Ga0436361_0890240 3300039447 Bacteria 1472
349 Ga0436363_0139442 3300039450 Bacteria 1319
350 Ga0436363_0333474 3300039450 Bacteria 1228
351 Ga0436363_0531043 3300039450 Unclassified 1021
352 Ga0436362_0774554 3300039453 Bacteria 989
353 Ga0439455_0094101 3300042012 Bacteria 824
354 Ga0439460_0082915 3300042461 Bacteria 1009
355 Ga0451577_0036129 3300042876 Bacteria 4449
356 Ga0451577_0138762 3300042876 Bacteria 2184
357 Ga0453683_0003011 3300044673 Bacteria 12616
358 Ga0453684_0034236 3300044712 Bacteria 7056
359 Ga0453684_0323151 3300044712 Bacteria 1747
360 Ga0451576_0019885 3300045051 Bacteria 7323
361 Ga0495629_0439701 3300046459 Bacteria 884
362 Ga0495653_0562202 3300046463 Bacteria 705
363 Ga0495580_0364433 3300046472 Bacteria 978
364 Ga0495608_0012034 3300046511 Bacteria 6016
365 Ga0495618_0003435 3300046514 Bacteria 9850
366 Ga0495628_0245463 3300046516 Unclassified 1338
367 Ga0495630_0021228 3300046517 Bacteria 4795
368 Ga0495652_0010360 3300046529 Bacteria 8447
369 Ga0495640_0185072 3300046533 Bacteria 1326
370 Ga0495586_0028430 3300046535 Bacteria 2992
371 Ga0495587_0053707 3300046536 Bacteria 2375
372 Ga0495587_0773909 3300046536 Unclassified 525
373 Ga0495645_0000454 3300046543 Bacteria 28172
374 Ga0495645_0576456 3300046543 Bacteria 695
375 Ga0495667_0149074 3300046559 Bacteria 1506
376 Ga0495634_0018033 3300046642 Bacteria 5030
377 Ga0495635_0056724 3300046663 Bacteria 2696
378 Ga0495599_0147259 3300046678 Unclassified 1459
379 Ga0495646_0022599 3300046680 Bacteria 3966
380 Ga0495647_0047342 3300046681 Bacteria 1659
381 Ga0495658_0409776 3300046683 Bacteria 864
382 Ga0495613_0010278 3300046689 Bacteria 6952
383 Ga0495624_0075577 3300046690 Bacteria 2092
384 Ga0495670_0038933 3300046691 Bacteria 2371
385 Ga0495600_0221116 3300046809 Bacteria 1211
386 Ga0495581_0459844 3300047315 Unclassified 741
387 Ga0495674_0038443 3300047319 Bacteria 4295
388 Ga0495674_0310015 3300047319 Bacteria 1288
389 Ga0495676_0931995 3300047321 Unclassified 556
390 Ga0495680_0024622 3300047322 Bacteria 4992
391 Ga0495680_0797620 3300047322 Bacteria 617
392 Ga0495675_0012257 3300047444 Bacteria 5395
393 Ga0495675_0176061 3300047444 Unclassified 1312
394 Ga0495684_0000635 3300047471 Bacteria 28267
395 Ga0495602_0013807 3300048088 Bacteria 8236
396 Ga0495602_0376094 3300048088 Bacteria 1019
397 Ga0496100_0093366 3300048903 Unclassified 2059
398 Ga0496101_0436426 3300048904 Bacteria 1033
399 Ga0496102_0004151 3300048905 Bacteria 12273
400 Ga0496102_0629925 3300048905 Bacteria 996
401 Ga0496103_0060343 3300048906 Bacteria 2357
402 Ga0496103_0306357 3300048906 Bacteria 1022
403 Ga0496104_0028538 3300048907 Bacteria 5172
404 Ga0496104_0124897 3300048907 Bacteria 2471
405 Ga0496106_0737840 3300048909 Unclassified 783
406 Ga0496107_0082071 3300048910 Bacteria 2351
407 Ga0496107_0241292 3300048910 Bacteria 1345
408 Ga0496107_0296836 3300048910 Bacteria 1203
409 Ga0496112_0055928 3300048915 Bacteria 3882
410 Ga0496112_0125100 3300048915 Bacteria 2542
411 Ga0496112_0290841 3300048915 Unclassified 1580
412 Ga0496112_0342648 3300048915 Bacteria 1438
413 Ga0496113_0125774 3300048916 Bacteria 2008
414 Ga0496113_1371378 3300048916 Unclassified 548
415 Ga0501034_0244960 3300049571 Bacteria 1738
416 Ga0501037_0022688 3300049573 Bacteria 4640
417 Ga0501040_0131418 3300049576 Bacteria 1761
418 Ga0501041_0043065 3300049577 Bacteria 2744
419 Ga0501041_0174857 3300049577 Bacteria 1344
420 Ga0501042_0249548 3300049578 Bacteria 1280
421 Ga0501043_0137630 3300049579 Bacteria 1913
422 Ga0501072_0363772 3300049588 Unclassified 1148
423 Ga0501073_0140096 3300049589 Bacteria 1676
424 Ga0501075_0574354 3300049591 Bacteria 860
425 Ga0501076_0256988 3300049592 Bacteria 1430
426 Ga0501079_0237568 3300049741 Bacteria 1424
427 Ga0501079_0282117 3300049741 Bacteria 1299
428 Ga0501035_0064996 3300049822 Bacteria 3241
429 Ga0501035_0677470 3300049822 Bacteria 834
430 Ga0501045_0080697 3300049824 Bacteria 2399
431 nmdc:mga05p37_1168375_c1 3300050507 Unclassified 799
432 nmdc:mga05p37_450266_c1 3300050507 Bacteria 1490
433 nmdc:mga05p37_5636_c1 3300050507 Bacteria 14719
434 nmdc:mga05p37_702169_c1 3300050507 Unclassified 1123
435 nmdc:mga08y16_402394_c1 3300050511 Bacteria 1401
436 nmdc:mga0n895_101298_c1 3300050512 Bacteria 2890
437 nmdc:mga0n895_1083_c1 3300050512 Bacteria 19897
438 nmdc:mga0n895_112759_c1 3300050512 Bacteria 2736
439 nmdc:mga0n895_1445519_c1 3300050512 Bacteria 655
440 nmdc:mga0n895_21782_c1 3300050512 Bacteria 5999
441 nmdc:mga0rr50_19936_c1 3300050513 Bacteria 4540
442 nmdc:mga0rr50_23174_c1 3300050513 Bacteria 4275
443 nmdc:mga0rr50_464870_c1 3300050513 Bacteria 1073
444 nmdc:mga08x19_17553_c1 3300050514 Bacteria 4380
445 nmdc:mga08x19_28278_c1 3300050514 Bacteria 3511
446 nmdc:mga08x19_484309_c1 3300050514 Bacteria 872
447 nmdc:mga0a205_1094376_c1 3300050515 Unclassified 644
448 nmdc:mga0a205_18702_c1 3300050515 Bacteria 6520
449 nmdc:mga0a205_6176_c1 3300050515 Bacteria 10809
450 Ga0501082_1307218 3300060353 Unclassified 633

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10358781 Ga0157374_103587812 139
2 3300006173 Ga0070716_100392254 Ga0070716_1003922542 143
3 3300013308 Ga0157375_12750627 Ga0157375_127506272 146
4 3300005336 Ga0070680_100618153 Ga0070680_1006181532 147
5 3300005367 Ga0070667_100539678 Ga0070667_1005396782 147
6 3300005439 Ga0070711_100143925 Ga0070711_1001439252 147
7 3300005458 Ga0070681_10037936 Ga0070681_100379363 147
8 3300005530 Ga0070679_100032040 Ga0070679_1000320403 147
9 3300005539 Ga0068853_100370865 Ga0068853_1003708652 147
10 3300005563 Ga0068855_100321513 Ga0068855_1003215132 147
11 3300005564 Ga0070664_100118891 Ga0070664_1001188913 147
12 3300005577 Ga0068857_100002970 Ga0068857_10000297010 147
13 3300005614 Ga0068856_100039123 Ga0068856_1000391233 147
14 3300005841 Ga0068863_100303054 Ga0068863_1003030542 147
15 3300006237 Ga0097621_100734479 Ga0097621_1007344791 147
16 3300006237 Ga0097621_101656228 Ga0097621_1016562281 147
17 3300006358 Ga0068871_100407400 Ga0068871_1004074001 147
18 3300009098 Ga0105245_10612523 Ga0105245_106125231 147
19 3300009148 Ga0105243_10033564 Ga0105243_100335643 147
20 3300009174 Ga0105241_10005346 Ga0105241_100053464 147
21 3300009176 Ga0105242_10235384 Ga0105242_102353841 147
22 3300009177 Ga0105248_10107503 Ga0105248_101075033 147
23 3300009551 Ga0105238_10177380 Ga0105238_101773802 147
24 3300010375 Ga0105239_10011627 Ga0105239_100116274 147
25 3300013297 Ga0157378_10252647 Ga0157378_102526472 147
26 3300013306 Ga0163162_10001545 Ga0163162_100015456 147
27 3300025906 Ga0207699_10047858 Ga0207699_100478582 147
28 3300025907 Ga0207645_10187976 Ga0207645_101879761 147
29 3300025911 Ga0207654_10223122 Ga0207654_102231222 147
30 3300025911 Ga0207654_10412841 Ga0207654_104128412 147
31 3300025912 Ga0207707_10022584 Ga0207707_100225844 147
32 3300025914 Ga0207671_10257585 Ga0207671_102575852 147
33 3300025916 Ga0207663_10091224 Ga0207663_100912243 147
34 3300025921 Ga0207652_11147405 Ga0207652_111474052 147
35 3300025933 Ga0207706_10011251 Ga0207706_100112513 147
36 3300025937 Ga0207669_10339957 Ga0207669_103399572 147
37 3300025939 Ga0207665_10042759 Ga0207665_100427592 147
38 3300025945 Ga0207679_10084189 Ga0207679_100841893 147
39 3300025949 Ga0207667_10079596 Ga0207667_100795964 147
40 3300025986 Ga0207658_11415222 Ga0207658_114152221 147
41 3300026041 Ga0207639_10217944 Ga0207639_102179442 147
42 3300026078 Ga0207702_10280177 Ga0207702_102801773 147
43 3300026088 Ga0207641_10250859 Ga0207641_102508592 147
44 3300026116 Ga0207674_10004517 Ga0207674_1000451710 147
45 3300046536 Ga0495587_0773909 Ga0495587_0773909_19_462 147
46 3300047444 Ga0495675_0176061 Ga0495675_0176061_156_599 147
47 3300048088 Ga0495602_0376094 Ga0495602_0376094_556_999 147
48 3300048903 Ga0496100_0093366 Ga0496100_0093366_1268_1711 147
49 3300048910 Ga0496107_0241292 Ga0496107_0241292_226_669 147
50 3300048915 Ga0496112_0342648 Ga0496112_0342648_941_1384 147
51 3300005293 Ga0065715_10632172 Ga0065715_106321722 148
52 3300005295 Ga0065707_10015971 Ga0065707_100159712 148
53 3300005343 Ga0070687_100170545 Ga0070687_1001705452 148
54 3300005356 Ga0070674_100368152 Ga0070674_1003681522 148
55 3300005439 Ga0070711_100165485 Ga0070711_1001654853 148
56 3300005440 Ga0070705_100307024 Ga0070705_1003070242 148
57 3300005441 Ga0070700_100365841 Ga0070700_1003658411 148
58 3300005456 Ga0070678_100106091 Ga0070678_1001060912 148
59 3300005459 Ga0068867_100587487 Ga0068867_1005874872 148
60 3300005518 Ga0070699_100028933 Ga0070699_1000289334 148
61 3300005545 Ga0070695_100055650 Ga0070695_1000556502 148
62 3300005547 Ga0070693_100024503 Ga0070693_1000245032 148
63 3300005549 Ga0070704_100176924 Ga0070704_1001769242 148
64 3300005617 Ga0068859_100220624 Ga0068859_1002206242 148
65 3300006931 Ga0097620_100220627 Ga0097620_1002206272 148
66 3300009098 Ga0105245_10242426 Ga0105245_102424262 148
67 3300009148 Ga0105243_10725843 Ga0105243_107258432 148
68 3300009174 Ga0105241_10128295 Ga0105241_101282952 148
69 3300009176 Ga0105242_10062813 Ga0105242_100628132 148
70 3300025910 Ga0207684_10900001 Ga0207684_109000012 148
71 3300025923 Ga0207681_10186892 Ga0207681_101868922 148
72 3300025935 Ga0207709_10124058 Ga0207709_101240583 148
73 3300026088 Ga0207641_10447223 Ga0207641_104472232 148
74 3300026089 Ga0207648_10013933 Ga0207648_100139331 148
75 3300026118 Ga0207675_100293407 Ga0207675_1002934073 148
76 3300026121 Ga0207683_10116177 Ga0207683_101161773 148
77 3300034957 Ga0373938_0031388 Ga0373938_0031388_336_782 148
78 3300035691 Ga0373931_0307888 Ga0373931_0307888_313_759 148
79 3300037466 Ga0395898_1471053 Ga0395898_1471053_68_550 148
80 3300037471 Ga0395905_0147061 Ga0395905_0147061_416_904 148
81 3300037471 Ga0395905_0155463 Ga0395905_0155463_352_834 148
82 3300046511 Ga0495608_0012034 Ga0495608_0012034_3444_3890 148
83 3300046514 Ga0495618_0003435 Ga0495618_0003435_292_738 148
84 3300046516 Ga0495628_0245463 Ga0495628_0245463_589_1035 148
85 3300046517 Ga0495630_0021228 Ga0495630_0021228_4103_4549 148
86 3300046529 Ga0495652_0010360 Ga0495652_0010360_4553_4999 148
87 3300046533 Ga0495640_0185072 Ga0495640_0185072_502_948 148
88 3300046535 Ga0495586_0028430 Ga0495586_0028430_121_567 148
89 3300046536 Ga0495587_0053707 Ga0495587_0053707_887_1333 148
90 3300046559 Ga0495667_0149074 Ga0495667_0149074_750_1196 148
91 3300046642 Ga0495634_0018033 Ga0495634_0018033_871_1317 148
92 3300046663 Ga0495635_0056724 Ga0495635_0056724_473_919 148
93 3300046678 Ga0495599_0147259 Ga0495599_0147259_893_1339 148
94 3300046680 Ga0495646_0022599 Ga0495646_0022599_3032_3478 148
95 3300046689 Ga0495613_0010278 Ga0495613_0010278_3171_3617 148
96 3300046690 Ga0495624_0075577 Ga0495624_0075577_869_1315 148
97 3300046809 Ga0495600_0221116 Ga0495600_0221116_118_564 148
98 3300047315 Ga0495581_0459844 Ga0495581_0459844_42_488 148
99 3300047319 Ga0495674_0038443 Ga0495674_0038443_589_1035 148
100 3300047321 Ga0495676_0931995 Ga0495676_0931995_100_546 148
101 3300047322 Ga0495680_0024622 Ga0495680_0024622_992_1438 148
102 3300047444 Ga0495675_0012257 Ga0495675_0012257_1544_1990 148
103 3300047471 Ga0495684_0000635 Ga0495684_0000635_22530_22976 148
104 3300048088 Ga0495602_0013807 Ga0495602_0013807_4500_4946 148
105 3300048905 Ga0496102_0629925 Ga0496102_0629925_29_475 148
106 3300048906 Ga0496103_0306357 Ga0496103_0306357_301_747 148
107 3300048910 Ga0496107_0296836 Ga0496107_0296836_299_745 148
108 3300049577 Ga0501041_0174857 Ga0501041_0174857_213_659 148
109 3300049588 Ga0501072_0363772 Ga0501072_0363772_108_554 148
110 3300049591 Ga0501075_0574354 Ga0501075_0574354_353_799 148
111 3300049741 Ga0501079_0237568 Ga0501079_0237568_545_991 148
112 3300049822 Ga0501035_0677470 Ga0501035_0677470_132_578 148
113 3300013297 Ga0157378_11380959 Ga0157378_113809591 149
114 3300046459 Ga0495629_0439701 Ga0495629_0439701_295_744 149
115 3300046463 Ga0495653_0562202 Ga0495653_0562202_52_501 149
116 3300046681 Ga0495647_0047342 Ga0495647_0047342_532_981 149
117 3300046683 Ga0495658_0409776 Ga0495658_0409776_272_721 149
118 3300047319 Ga0495674_0310015 Ga0495674_0310015_210_659 149
119 3300047322 Ga0495680_0797620 Ga0495680_0797620_88_537 149
120 3300049571 Ga0501034_0244960 Ga0501034_0244960_11_460 149
121 3300049573 Ga0501037_0022688 Ga0501037_0022688_646_1095 149
122 3300049576 Ga0501040_0131418 Ga0501040_0131418_371_820 149
123 3300049577 Ga0501041_0043065 Ga0501041_0043065_973_1422 149
124 3300049578 Ga0501042_0249548 Ga0501042_0249548_341_790 149
125 3300049579 Ga0501043_0137630 Ga0501043_0137630_935_1384 149
126 3300049589 Ga0501073_0140096 Ga0501073_0140096_465_914 149
127 3300049592 Ga0501076_0256988 Ga0501076_0256988_825_1274 149
128 3300049741 Ga0501079_0282117 Ga0501079_0282117_632_1081 149
129 3300049822 Ga0501035_0064996 Ga0501035_0064996_631_1080 149
130 3300049824 Ga0501045_0080697 Ga0501045_0080697_517_966 149
131 3300050511 nmdc:mga08y16_402394_c1 nmdc:mga08y16_402394_c1_620_1069 149
132 3300050512 nmdc:mga0n895_112759_c1 nmdc:mga0n895_112759_c1_2266_2715 149
133 3300050514 nmdc:mga08x19_28278_c1 nmdc:mga08x19_28278_c1_2785_3234 149
134 3300060353 Ga0501082_1307218 Ga0501082_1307218_172_621 149
135 3300005293 Ga0065715_10106546 Ga0065715_101065462 150
136 3300005293 Ga0065715_10166791 Ga0065715_101667912 150
137 3300005295 Ga0065707_10347906 Ga0065707_103479062 150
138 3300005328 Ga0070676_10041866 Ga0070676_100418663 150
139 3300005329 Ga0070683_100039824 Ga0070683_1000398242 150
140 3300005330 Ga0070690_100033878 Ga0070690_1000338783 150
141 3300005334 Ga0068869_100006864 Ga0068869_1000068647 150
142 3300005334 Ga0068869_100123206 Ga0068869_1001232062 150
143 3300005335 Ga0070666_10001715 Ga0070666_100017153 150
144 3300005335 Ga0070666_10591432 Ga0070666_105914321 150
145 3300005337 Ga0070682_100389553 Ga0070682_1003895532 150
146 3300005338 Ga0068868_100008872 Ga0068868_1000088727 150
147 3300005339 Ga0070660_100028197 Ga0070660_1000281972 150
148 3300005347 Ga0070668_100220091 Ga0070668_1002200913 150
149 3300005353 Ga0070669_100023750 Ga0070669_1000237503 150
150 3300005353 Ga0070669_101544751 Ga0070669_1015447511 150
151 3300005354 Ga0070675_100236178 Ga0070675_1002361782 150
152 3300005355 Ga0070671_100003755 Ga0070671_1000037552 150
153 3300005364 Ga0070673_100245584 Ga0070673_1002455842 150
154 3300005364 Ga0070673_100500486 Ga0070673_1005004862 150
155 3300005366 Ga0070659_100113469 Ga0070659_1001134691 150
156 3300005367 Ga0070667_100004703 Ga0070667_10000470311 150
157 3300005434 Ga0070709_10010814 Ga0070709_100108144 150
158 3300005434 Ga0070709_10021636 Ga0070709_100216363 150
159 3300005434 Ga0070709_10047885 Ga0070709_100478851 150
160 3300005434 Ga0070709_11206972 Ga0070709_112069721 150
161 3300005435 Ga0070714_100161808 Ga0070714_1001618082 150
162 3300005435 Ga0070714_100293323 Ga0070714_1002933232 150
163 3300005436 Ga0070713_100001526 Ga0070713_10000152612 150
164 3300005436 Ga0070713_100533146 Ga0070713_1005331462 150
165 3300005436 Ga0070713_100550048 Ga0070713_1005500482 150
166 3300005436 Ga0070713_100662443 Ga0070713_1006624432 150
167 3300005437 Ga0070710_11422605 Ga0070710_114226051 150
168 3300005438 Ga0070701_10029136 Ga0070701_100291362 150
169 3300005439 Ga0070711_100027812 Ga0070711_1000278122 150
170 3300005439 Ga0070711_100724290 Ga0070711_1007242902 150
171 3300005439 Ga0070711_101167462 Ga0070711_1011674622 150
172 3300005440 Ga0070705_100055548 Ga0070705_1000555483 150
173 3300005444 Ga0070694_100000274 Ga0070694_1000002744 150
174 3300005445 Ga0070708_100000460 Ga0070708_1000004605 150
175 3300005445 Ga0070708_100011652 Ga0070708_1000116525 150
176 3300005456 Ga0070678_100007607 Ga0070678_1000076076 150
177 3300005457 Ga0070662_100051507 Ga0070662_1000515071 150
178 3300005457 Ga0070662_100962832 Ga0070662_1009628322 150
179 3300005458 Ga0070681_10208626 Ga0070681_102086262 150
180 3300005459 Ga0068867_100011563 Ga0068867_1000115632 150
181 3300005467 Ga0070706_100058150 Ga0070706_1000581503 150
182 3300005467 Ga0070706_100067456 Ga0070706_1000674562 150
183 3300005467 Ga0070706_100799857 Ga0070706_1007998572 150
184 3300005468 Ga0070707_100008282 Ga0070707_1000082824 150
185 3300005468 Ga0070707_100021828 Ga0070707_1000218282 150
186 3300005468 Ga0070707_100026419 Ga0070707_1000264192 150
187 3300005468 Ga0070707_100206770 Ga0070707_1002067702 150
188 3300005471 Ga0070698_100002476 Ga0070698_10000247619 150
189 3300005471 Ga0070698_100475316 Ga0070698_1004753162 150
190 3300005518 Ga0070699_100000738 Ga0070699_10000073821 150
191 3300005518 Ga0070699_100104232 Ga0070699_1001042322 150
192 3300005535 Ga0070684_100225020 Ga0070684_1002250202 150
193 3300005536 Ga0070697_100081515 Ga0070697_1000815151 150
194 3300005539 Ga0068853_100954443 Ga0068853_1009544432 150
195 3300005543 Ga0070672_101280690 Ga0070672_1012806902 150
196 3300005544 Ga0070686_100060182 Ga0070686_1000601822 150
197 3300005544 Ga0070686_100272257 Ga0070686_1002722572 150
198 3300005544 Ga0070686_100916403 Ga0070686_1009164031 150
199 3300005545 Ga0070695_100062695 Ga0070695_1000626952 150
200 3300005545 Ga0070695_100067486 Ga0070695_1000674863 150
201 3300005545 Ga0070695_100242445 Ga0070695_1002424452 150
202 3300005546 Ga0070696_100179830 Ga0070696_1001798302 150
203 3300005547 Ga0070693_100592163 Ga0070693_1005921631 150
204 3300005548 Ga0070665_101521467 Ga0070665_1015214672 150
205 3300005549 Ga0070704_100046421 Ga0070704_1000464212 150
206 3300005563 Ga0068855_100942747 Ga0068855_1009427472 150
207 3300005564 Ga0070664_100228315 Ga0070664_1002283152 150
208 3300005578 Ga0068854_100212769 Ga0068854_1002127692 150
209 3300005614 Ga0068856_100440799 Ga0068856_1004407992 150
210 3300005614 Ga0068856_102022221 Ga0068856_1020222211 150
211 3300005615 Ga0070702_100420185 Ga0070702_1004201852 150
212 3300005718 Ga0068866_10002078 Ga0068866_100020787 150
213 3300005719 Ga0068861_100064426 Ga0068861_1000644262 150
214 3300005719 Ga0068861_102437905 Ga0068861_1024379051 150
215 3300005841 Ga0068863_100209583 Ga0068863_1002095832 150
216 3300005841 Ga0068863_100595298 Ga0068863_1005952982 150
217 3300005842 Ga0068858_100022629 Ga0068858_1000226294 150
218 3300005842 Ga0068858_100050888 Ga0068858_1000508882 150
219 3300005842 Ga0068858_100224168 Ga0068858_1002241682 150
220 3300005843 Ga0068860_100018177 Ga0068860_1000181773 150
221 3300005843 Ga0068860_100048112 Ga0068860_1000481123 150
222 3300005843 Ga0068860_100098532 Ga0068860_1000985322 150
223 3300005844 Ga0068862_100058468 Ga0068862_1000584684 150
224 3300005844 Ga0068862_100367938 Ga0068862_1003679382 150
225 3300006028 Ga0070717_11516831 Ga0070717_115168311 150
226 3300006163 Ga0070715_10002149 Ga0070715_100021493 150
227 3300006173 Ga0070716_100001260 Ga0070716_1000012604 150
228 3300006173 Ga0070716_100068889 Ga0070716_1000688892 150
229 3300006173 Ga0070716_100155807 Ga0070716_1001558072 150
230 3300006175 Ga0070712_100000101 Ga0070712_10000010112 150
231 3300006175 Ga0070712_100629087 Ga0070712_1006290872 150
232 3300006175 Ga0070712_101245128 Ga0070712_1012451281 150
233 3300006237 Ga0097621_100093154 Ga0097621_1000931541 150
234 3300006237 Ga0097621_100561100 Ga0097621_1005611002 150
235 3300006358 Ga0068871_100011641 Ga0068871_1000116412 150
236 3300006358 Ga0068871_100306238 Ga0068871_1003062382 150
237 3300006358 Ga0068871_100862836 Ga0068871_1008628362 150
238 3300006844 Ga0075428_100269570 Ga0075428_1002695702 150
239 3300006852 Ga0075433_10002499 Ga0075433_100024995 150
240 3300006852 Ga0075433_10509491 Ga0075433_105094912 150
241 3300006871 Ga0075434_100001045 Ga0075434_1000010456 150
242 3300006871 Ga0075434_100111228 Ga0075434_1001112282 150
243 3300006871 Ga0075434_101177993 Ga0075434_1011779932 150
244 3300006871 Ga0075434_101228024 Ga0075434_1012280242 150
245 3300006880 Ga0075429_100055711 Ga0075429_1000557113 150
246 3300006881 Ga0068865_100009086 Ga0068865_1000090862 150
247 3300006881 Ga0068865_100092055 Ga0068865_1000920552 150
248 3300006881 Ga0068865_101141826 Ga0068865_1011418262 150
249 3300006914 Ga0075436_100021131 Ga0075436_1000211312 150
250 3300006914 Ga0075436_100255455 Ga0075436_1002554552 150
251 3300007076 Ga0075435_100002717 Ga0075435_1000027178 150
252 3300007076 Ga0075435_100085392 Ga0075435_1000853923 150
253 3300007076 Ga0075435_100346839 Ga0075435_1003468392 150
254 3300009094 Ga0111539_10098845 Ga0111539_100988453 150
255 3300009098 Ga0105245_10056336 Ga0105245_100563364 150
256 3300009098 Ga0105245_10065624 Ga0105245_100656242 150
257 3300009147 Ga0114129_10038495 Ga0114129_100384957 150
258 3300009147 Ga0114129_10127678 Ga0114129_101276783 150
259 3300009147 Ga0114129_10428847 Ga0114129_104288472 150
260 3300009147 Ga0114129_10749899 Ga0114129_107498992 150
261 3300009147 Ga0114129_11622730 Ga0114129_116227302 150
262 3300009174 Ga0105241_10404595 Ga0105241_104045952 150
263 3300009176 Ga0105242_10224326 Ga0105242_102243262 150
264 3300009176 Ga0105242_10695564 Ga0105242_106955642 150
265 3300009177 Ga0105248_10016667 Ga0105248_100166677 150
266 3300009177 Ga0105248_10036882 Ga0105248_100368825 150
267 3300009177 Ga0105248_10357966 Ga0105248_103579662 150
268 3300009177 Ga0105248_11895006 Ga0105248_118950061 150
269 3300009545 Ga0105237_11044359 Ga0105237_110443591 150
270 3300009551 Ga0105238_10653646 Ga0105238_106536462 150
271 3300009553 Ga0105249_10392952 Ga0105249_103929522 150
272 3300009553 Ga0105249_11606619 Ga0105249_116066192 150
273 3300009553 Ga0105249_12153503 Ga0105249_121535031 150
274 3300010159 Ga0099796_10035380 Ga0099796_100353802 150
275 3300010375 Ga0105239_10085771 Ga0105239_100857712 150
276 3300010375 Ga0105239_11515349 Ga0105239_115153492 150
277 3300013102 Ga0157371_10300641 Ga0157371_103006412 150
278 3300013102 Ga0157371_10693707 Ga0157371_106937072 150
279 3300013296 Ga0157374_10000377 Ga0157374_100003775 150
280 3300013296 Ga0157374_10016314 Ga0157374_100163142 150
281 3300013297 Ga0157378_10095327 Ga0157378_100953272 150
282 3300013297 Ga0157378_10138070 Ga0157378_101380703 150
283 3300013297 Ga0157378_11279824 Ga0157378_112798241 150
284 3300013306 Ga0163162_10010209 Ga0163162_100102092 150
285 3300013306 Ga0163162_10104064 Ga0163162_101040643 150
286 3300013306 Ga0163162_10663243 Ga0163162_106632432 150
287 3300013306 Ga0163162_10774869 Ga0163162_107748691 150
288 3300013306 Ga0163162_11887329 Ga0163162_118873292 150
289 3300013307 Ga0157372_10346555 Ga0157372_103465551 150
290 3300013308 Ga0157375_10131042 Ga0157375_101310422 150
291 3300014325 Ga0163163_11459019 Ga0163163_114590192 150
292 3300014326 Ga0157380_10534719 Ga0157380_105347192 150
293 3300014326 Ga0157380_12159399 Ga0157380_121593991 150
294 3300014968 Ga0157379_10074022 Ga0157379_100740222 150
295 3300014968 Ga0157379_10109045 Ga0157379_101090452 150
296 3300014968 Ga0157379_10182568 Ga0157379_101825682 150
297 3300014969 Ga0157376_10067517 Ga0157376_100675173 150
298 3300014969 Ga0157376_10178178 Ga0157376_101781782 150
299 3300017792 Ga0163161_10003925 Ga0163161_100039257 150
300 3300021361 Ga0213872_10178444 Ga0213872_101784442 150
301 3300021361 Ga0213872_10204747 Ga0213872_102047472 150
302 3300021388 Ga0213875_10048613 Ga0213875_100486132 150
303 3300022732 Ga0224569_114424 Ga0224569_1144241 150
304 3300025899 Ga0207642_10049755 Ga0207642_100497552 150
305 3300025899 Ga0207642_10281045 Ga0207642_102810452 150
306 3300025903 Ga0207680_10001385 Ga0207680_100013853 150
307 3300025903 Ga0207680_10572327 Ga0207680_105723272 150
308 3300025904 Ga0207647_10189229 Ga0207647_101892292 150
309 3300025906 Ga0207699_10060568 Ga0207699_100605682 150
310 3300025907 Ga0207645_10013377 Ga0207645_100133773 150
311 3300025910 Ga0207684_10001945 Ga0207684_1000194513 150
312 3300025910 Ga0207684_10222588 Ga0207684_102225882 150
313 3300025910 Ga0207684_11547747 Ga0207684_115477471 150
314 3300025914 Ga0207671_10292854 Ga0207671_102928542 150
315 3300025914 Ga0207671_10384643 Ga0207671_103846432 150
316 3300025915 Ga0207693_10000124 Ga0207693_1000012449 150
317 3300025915 Ga0207693_10079986 Ga0207693_100799861 150
318 3300025915 Ga0207693_10460575 Ga0207693_104605752 150
319 3300025916 Ga0207663_10043595 Ga0207663_100435952 150
320 3300025916 Ga0207663_10055534 Ga0207663_100555342 150
321 3300025916 Ga0207663_10296978 Ga0207663_102969782 150
322 3300025918 Ga0207662_10002895 Ga0207662_100028955 150
323 3300025920 Ga0207649_10165334 Ga0207649_101653342 150
324 3300025922 Ga0207646_10003115 Ga0207646_1000311510 150
325 3300025922 Ga0207646_10009119 Ga0207646_100091197 150
326 3300025922 Ga0207646_10041964 Ga0207646_100419642 150
327 3300025922 Ga0207646_10253483 Ga0207646_102534833 150
328 3300025923 Ga0207681_10127345 Ga0207681_101273452 150
329 3300025923 Ga0207681_10289088 Ga0207681_102890882 150
330 3300025924 Ga0207694_10188519 Ga0207694_101885192 150
331 3300025927 Ga0207687_10034284 Ga0207687_100342844 150
332 3300025927 Ga0207687_10122018 Ga0207687_101220182 150
333 3300025928 Ga0207700_10007287 Ga0207700_100072877 150
334 3300025929 Ga0207664_10411310 Ga0207664_104113102 150
335 3300025931 Ga0207644_10015295 Ga0207644_100152956 150
336 3300025933 Ga0207706_10002401 Ga0207706_1000240114 150
337 3300025934 Ga0207686_10599046 Ga0207686_105990462 150
338 3300025934 Ga0207686_11060857 Ga0207686_110608572 150
339 3300025938 Ga0207704_10080341 Ga0207704_100803412 150
340 3300025938 Ga0207704_10880733 Ga0207704_108807332 150
341 3300025939 Ga0207665_10001677 Ga0207665_100016778 150
342 3300025939 Ga0207665_10006349 Ga0207665_100063495 150
343 3300025939 Ga0207665_10015541 Ga0207665_100155414 150
344 3300025939 Ga0207665_10144972 Ga0207665_101449722 150
345 3300025941 Ga0207711_10682365 Ga0207711_106823652 150
346 3300025941 Ga0207711_11149225 Ga0207711_111492252 150
347 3300025942 Ga0207689_10001367 Ga0207689_100013673 150
348 3300025942 Ga0207689_10210681 Ga0207689_102106812 150
349 3300025944 Ga0207661_10012931 Ga0207661_100129315 150
350 3300025945 Ga0207679_10172787 Ga0207679_101727872 150
351 3300025949 Ga0207667_10134569 Ga0207667_101345692 150
352 3300025961 Ga0207712_10480551 Ga0207712_104805512 150
353 3300025972 Ga0207668_10688611 Ga0207668_106886111 150
354 3300025981 Ga0207640_10175842 Ga0207640_101758422 150
355 3300026035 Ga0207703_10030135 Ga0207703_100301352 150
356 3300026035 Ga0207703_10892257 Ga0207703_108922572 150
357 3300026041 Ga0207639_11360643 Ga0207639_113606432 150
358 3300026067 Ga0207678_10088375 Ga0207678_100883752 150
359 3300026075 Ga0207708_10087432 Ga0207708_100874323 150
360 3300026078 Ga0207702_10431438 Ga0207702_104314382 150
361 3300026088 Ga0207641_10080777 Ga0207641_100807773 150
362 3300026088 Ga0207641_10557045 Ga0207641_105570451 150
363 3300026088 Ga0207641_10700618 Ga0207641_107006181 150
364 3300026089 Ga0207648_10013759 Ga0207648_100137595 150
365 3300026089 Ga0207648_10057018 Ga0207648_100570182 150
366 3300026118 Ga0207675_100016104 Ga0207675_1000161045 150
367 3300026118 Ga0207675_100058993 Ga0207675_1000589932 150
368 3300026118 Ga0207675_100750929 Ga0207675_1007509291 150
369 3300026118 Ga0207675_102303598 Ga0207675_1023035981 150
370 3300026121 Ga0207683_10007606 Ga0207683_100076065 150
371 3300027907 Ga0207428_10042309 Ga0207428_100423093 150
372 3300027907 Ga0207428_10450273 Ga0207428_104502731 150
373 3300028379 Ga0268266_10001863 Ga0268266_100018633 150
374 3300028380 Ga0268265_10364961 Ga0268265_103649612 150
375 3300028381 Ga0268264_10109600 Ga0268264_101096002 150
376 3300028381 Ga0268264_10163536 Ga0268264_101635362 150
377 3300028381 Ga0268264_10656643 Ga0268264_106566432 150
378 3300028381 Ga0268264_10956037 Ga0268264_109560372 150
379 3300028556 Ga0265337_1005118 Ga0265337_10051183 150
380 3300028666 Ga0265336_10173352 Ga0265336_101733521 150
381 3300028800 Ga0265338_10481903 Ga0265338_104819031 150
382 3300031240 Ga0265320_10000566 Ga0265320_100005663 150
383 3300035118 Ga0373954_0169551 Ga0373954_0169551_594_1052 150
384 3300035695 Ga0373927_0404176 Ga0373927_0404176_374_826 150
385 3300035695 Ga0373927_0625606 Ga0373927_0625606_64_522 150
386 3300035725 Ga0373947_0148624 Ga0373947_0148624_789_1247 150
387 3300035725 Ga0373947_0203528 Ga0373947_0203528_20_472 150
388 3300036647 Ga0316582_0654955 Ga0316582_0654955_103_561 150
389 3300037068 Ga0373925_0042100 Ga0373925_0042100_2903_3373 150
390 3300037068 Ga0373925_0217581 Ga0373925_0217581_317_769 150
391 3300037418 Ga0395900_0227648 Ga0395900_0227648_1209_1661 150
392 3300037418 Ga0395900_0888325 Ga0395900_0888325_47_511 150
393 3300037466 Ga0395898_0702278 Ga0395898_0702278_210_662 150
394 3300037466 Ga0395898_1165701 Ga0395898_1165701_138_602 150
395 3300037471 Ga0395905_0038392 Ga0395905_0038392_3501_3989 150
396 3300037471 Ga0395905_0079656 Ga0395905_0079656_2584_3036 150
397 3300037471 Ga0395905_1035144 Ga0395905_1035144_17_481 150
398 3300037853 Ga0436364_0897119 Ga0436364_0897119_1973_2431 150
399 3300038443 Ga0395901_1059919 Ga0395901_1059919_268_720 150
400 3300038443 Ga0395901_1338498 Ga0395901_1338498_131_619 150
401 3300039437 Ga0436365_0197260 Ga0436365_0197260_14578_15036 150
402 3300039438 Ga0436360_0142918 Ga0436360_0142918_599_1057 150
403 3300039447 Ga0436361_0008440 Ga0436361_0008440_2289_2747 150
404 3300039447 Ga0436361_0205323 Ga0436361_0205323_832_1290 150
405 3300039447 Ga0436361_0704747 Ga0436361_0704747_246_704 150
406 3300039447 Ga0436361_0890240 Ga0436361_0890240_937_1434 150
407 3300039450 Ga0436363_0139442 Ga0436363_0139442_387_851 150
408 3300039450 Ga0436363_0333474 Ga0436363_0333474_684_1172 150
409 3300039450 Ga0436363_0531043 Ga0436363_0531043_315_803 150
410 3300039453 Ga0436362_0774554 Ga0436362_0774554_518_976 150
411 3300042012 Ga0439455_0094101 Ga0439455_0094101_26_496 150
412 3300042461 Ga0439460_0082915 Ga0439460_0082915_472_924 150
413 3300042876 Ga0451577_0036129 Ga0451577_0036129_3306_3797 150
414 3300042876 Ga0451577_0138762 Ga0451577_0138762_393_857 150
415 3300044673 Ga0453683_0003011 Ga0453683_0003011_907_1398 150
416 3300044712 Ga0453684_0034236 Ga0453684_0034236_4456_4947 150
417 3300044712 Ga0453684_0323151 Ga0453684_0323151_459_923 150
418 3300045051 Ga0451576_0019885 Ga0451576_0019885_3518_4009 150
419 3300046472 Ga0495580_0364433 Ga0495580_0364433_66_518 150
420 3300046543 Ga0495645_0000454 Ga0495645_0000454_1164_1622 150
421 3300046543 Ga0495645_0576456 Ga0495645_0576456_93_581 150
422 3300046691 Ga0495670_0038933 Ga0495670_0038933_1559_2017 150
423 3300048904 Ga0496101_0436426 Ga0496101_0436426_331_819 150
424 3300048905 Ga0496102_0004151 Ga0496102_0004151_3807_4295 150
425 3300048906 Ga0496103_0060343 Ga0496103_0060343_1341_1829 150
426 3300048907 Ga0496104_0028538 Ga0496104_0028538_3105_3593 150
427 3300048907 Ga0496104_0124897 Ga0496104_0124897_550_1059 150
428 3300048909 Ga0496106_0737840 Ga0496106_0737840_97_585 150
429 3300048910 Ga0496107_0082071 Ga0496107_0082071_89_577 150
430 3300048915 Ga0496112_0055928 Ga0496112_0055928_2910_3398 150
431 3300048915 Ga0496112_0125100 Ga0496112_0125100_1884_2372 150
432 3300048915 Ga0496112_0290841 Ga0496112_0290841_416_904 150
433 3300048916 Ga0496113_0125774 Ga0496113_0125774_1205_1693 150
434 3300048916 Ga0496113_1371378 Ga0496113_1371378_20_508 150
435 3300050507 nmdc:mga05p37_1168375_c1 nmdc:mga05p37_1168375_c1_288_746 150
436 3300050507 nmdc:mga05p37_450266_c1 nmdc:mga05p37_450266_c1_26_532 150
437 3300050507 nmdc:mga05p37_5636_c1 nmdc:mga05p37_5636_c1_12962_13432 150
438 3300050507 nmdc:mga05p37_702169_c1 nmdc:mga05p37_702169_c1_163_618 150
439 3300050512 nmdc:mga0n895_101298_c1 nmdc:mga0n895_101298_c1_1005_1493 150
440 3300050512 nmdc:mga0n895_1083_c1 nmdc:mga0n895_1083_c1_5393_5881 150
441 3300050512 nmdc:mga0n895_1445519_c1 nmdc:mga0n895_1445519_c1_111_569 150
442 3300050512 nmdc:mga0n895_21782_c1 nmdc:mga0n895_21782_c1_4652_5119 150
443 3300050513 nmdc:mga0rr50_19936_c1 nmdc:mga0rr50_19936_c1_2838_3326 150
444 3300050513 nmdc:mga0rr50_23174_c1 nmdc:mga0rr50_23174_c1_1185_1673 150
445 3300050513 nmdc:mga0rr50_464870_c1 nmdc:mga0rr50_464870_c1_546_1013 150
446 3300050514 nmdc:mga08x19_17553_c1 nmdc:mga08x19_17553_c1_686_1174 150
447 3300050514 nmdc:mga08x19_484309_c1 nmdc:mga08x19_484309_c1_76_564 150
448 3300050515 nmdc:mga0a205_1094376_c1 nmdc:mga0a205_1094376_c1_51_503 150
449 3300050515 nmdc:mga0a205_18702_c1 nmdc:mga0a205_18702_c1_5885_6373 150
450 3300050515 nmdc:mga0a205_6176_c1 nmdc:mga0a205_6176_c1_8803_9291 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

32

162

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9655 1 142
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9616 2 146
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.961 2 142
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.96 2 147
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9593 1 147
ID Description Score Start End Superfamily
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9655 1 142 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9605 2 147 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9545 2 142 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9543 1 130 3.40.1400.10
5ifzB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9504 1 129 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A7V7VPN7-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9946 2 142 GO:0005975
GO:0006098
GO:0016861
GO:0017057
AF-A0A518D8V1-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9885 1 146 GO:0005975
GO:0006098
GO:0016861
GO:0017057
AF-A0A5C6D3P3-F1-model_v4 Putative sugar phosphate isomerase YwlF (EC 5.3.1.-) 0.988 2 146 GO:0005975
GO:0016861
AF-A0A1G3ZJR7-F1-model_v4 Ribose-5-phosphate isomerase 0.987 1 146 GO:0005975
GO:0016861
AF-A0A3A4VMN2-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9863 1 138 GO:0004751
GO:0005975

Feature Viewer

pLDDT pTM Quality
95.61 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map