F446595
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 450 | 238 | 450 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300025914|Ga0207671_10384643|Ga0207671_103846432 |
| Length | 182 |
| Sequence | MTVEEFKIFLPTIPGQPGVYRFIDKREIPIYVGKAKDLRKRLTAAGHDIVDFGANRLEPGDDYPDFVTPLARAVAAGTLERGIAVCGSGVGASVCANKVPGVHAGLINDHFSARQGVEDDHMNVICLGGRVMGTMVAWDLVESFLAAEFSQEERHLRRLSKVAALETKAANEVGAEASTIPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 158 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 162 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 175 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 176 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 177 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 178 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 213 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 214 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4 |
| Rhizosphere | 94.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10106546 | 3300005293 | Bacteria | 2822 |
| 2 | Ga0065715_10166791 | 3300005293 | Bacteria | 1570 |
| 3 | Ga0065715_10632172 | 3300005293 | Bacteria | 682 |
| 4 | Ga0065707_10015971 | 3300005295 | Bacteria | 2054 |
| 5 | Ga0065707_10347906 | 3300005295 | Bacteria | 923 |
| 6 | Ga0070676_10041866 | 3300005328 | Bacteria | 2657 |
| 7 | Ga0070683_100039824 | 3300005329 | Bacteria | 4317 |
| 8 | Ga0070690_100033878 | 3300005330 | Bacteria | 3199 |
| 9 | Ga0068869_100006864 | 3300005334 | Bacteria | 7242 |
| 10 | Ga0068869_100123206 | 3300005334 | Bacteria | 1985 |
| 11 | Ga0070666_10001715 | 3300005335 | Bacteria | 13364 |
| 12 | Ga0070666_10591432 | 3300005335 | Unclassified | 809 |
| 13 | Ga0070680_100618153 | 3300005336 | Unclassified | 930 |
| 14 | Ga0070682_100389553 | 3300005337 | Unclassified | 1051 |
| 15 | Ga0068868_100008872 | 3300005338 | Bacteria | 7204 |
| 16 | Ga0070660_100028197 | 3300005339 | Bacteria | 4199 |
| 17 | Ga0070687_100170545 | 3300005343 | Bacteria | 1295 |
| 18 | Ga0070668_100220091 | 3300005347 | Unclassified | 1565 |
| 19 | Ga0070669_100023750 | 3300005353 | Bacteria | 4393 |
| 20 | Ga0070669_101544751 | 3300005353 | Unclassified | 577 |
| 21 | Ga0070675_100236178 | 3300005354 | Unclassified | 1596 |
| 22 | Ga0070671_100003755 | 3300005355 | Bacteria | 11927 |
| 23 | Ga0070674_100368152 | 3300005356 | Bacteria | 1166 |
| 24 | Ga0070673_100245584 | 3300005364 | Bacteria | 1558 |
| 25 | Ga0070673_100500486 | 3300005364 | Unclassified | 1099 |
| 26 | Ga0070659_100113469 | 3300005366 | Bacteria | 2189 |
| 27 | Ga0070667_100004703 | 3300005367 | Bacteria | 11448 |
| 28 | Ga0070667_100539678 | 3300005367 | Unclassified | 1071 |
| 29 | Ga0070709_10010814 | 3300005434 | Bacteria | 5065 |
| 30 | Ga0070709_10021636 | 3300005434 | Bacteria | 3748 |
| 31 | Ga0070709_10047885 | 3300005434 | Bacteria | 2665 |
| 32 | Ga0070709_11206972 | 3300005434 | Bacteria | 608 |
| 33 | Ga0070714_100161808 | 3300005435 | Unclassified | 2026 |
| 34 | Ga0070714_100293323 | 3300005435 | Bacteria | 1514 |
| 35 | Ga0070713_100001526 | 3300005436 | Bacteria | 14773 |
| 36 | Ga0070713_100533146 | 3300005436 | Bacteria | 1110 |
| 37 | Ga0070713_100550048 | 3300005436 | Bacteria | 1093 |
| 38 | Ga0070713_100662443 | 3300005436 | Bacteria | 995 |
| 39 | Ga0070710_11422605 | 3300005437 | Bacteria | 519 |
| 40 | Ga0070701_10029136 | 3300005438 | Bacteria | 2720 |
| 41 | Ga0070711_100027812 | 3300005439 | Bacteria | 3715 |
| 42 | Ga0070711_100143925 | 3300005439 | Unclassified | 1791 |
| 43 | Ga0070711_100165485 | 3300005439 | Unclassified | 1680 |
| 44 | Ga0070711_100724290 | 3300005439 | Bacteria | 839 |
| 45 | Ga0070711_101167462 | 3300005439 | Unclassified | 665 |
| 46 | Ga0070705_100055548 | 3300005440 | Unclassified | 2328 |
| 47 | Ga0070705_100307024 | 3300005440 | Bacteria | 1139 |
| 48 | Ga0070700_100365841 | 3300005441 | Bacteria | 1074 |
| 49 | Ga0070694_100000274 | 3300005444 | Bacteria | 27377 |
| 50 | Ga0070708_100000460 | 3300005445 | Bacteria | 30625 |
| 51 | Ga0070708_100011652 | 3300005445 | Bacteria | 7155 |
| 52 | Ga0070678_100007607 | 3300005456 | Bacteria | 6437 |
| 53 | Ga0070678_100106091 | 3300005456 | Bacteria | 2188 |
| 54 | Ga0070662_100051507 | 3300005457 | Bacteria | 2973 |
| 55 | Ga0070662_100962832 | 3300005457 | Unclassified | 730 |
| 56 | Ga0070681_10037936 | 3300005458 | Bacteria | 4832 |
| 57 | Ga0070681_10208626 | 3300005458 | Bacteria | 1870 |
| 58 | Ga0068867_100011563 | 3300005459 | Bacteria | 6231 |
| 59 | Ga0068867_100587487 | 3300005459 | Bacteria | 969 |
| 60 | Ga0070706_100058150 | 3300005467 | Bacteria | 3568 |
| 61 | Ga0070706_100067456 | 3300005467 | Bacteria | 3309 |
| 62 | Ga0070706_100799857 | 3300005467 | Bacteria | 873 |
| 63 | Ga0070707_100008282 | 3300005468 | Bacteria | 9648 |
| 64 | Ga0070707_100021828 | 3300005468 | Bacteria | 6052 |
| 65 | Ga0070707_100026419 | 3300005468 | Bacteria | 5512 |
| 66 | Ga0070707_100206770 | 3300005468 | Bacteria | 1913 |
| 67 | Ga0070698_100002476 | 3300005471 | Bacteria | 20366 |
| 68 | Ga0070698_100475316 | 3300005471 | Bacteria | 1186 |
| 69 | Ga0070699_100000738 | 3300005518 | Bacteria | 30317 |
| 70 | Ga0070699_100028933 | 3300005518 | Bacteria | 4777 |
| 71 | Ga0070699_100104232 | 3300005518 | Bacteria | 2488 |
| 72 | Ga0070679_100032040 | 3300005530 | Bacteria | 5197 |
| 73 | Ga0070684_100225020 | 3300005535 | Bacteria | 1712 |
| 74 | Ga0070697_100081515 | 3300005536 | Unclassified | 2666 |
| 75 | Ga0068853_100370865 | 3300005539 | Bacteria | 1335 |
| 76 | Ga0068853_100954443 | 3300005539 | Bacteria | 825 |
| 77 | Ga0070672_101280690 | 3300005543 | Unclassified | 654 |
| 78 | Ga0070686_100060182 | 3300005544 | Bacteria | 2450 |
| 79 | Ga0070686_100272257 | 3300005544 | Bacteria | 1245 |
| 80 | Ga0070686_100916403 | 3300005544 | Unclassified | 714 |
| 81 | Ga0070695_100055650 | 3300005545 | Bacteria | 2550 |
| 82 | Ga0070695_100062695 | 3300005545 | Bacteria | 2415 |
| 83 | Ga0070695_100067486 | 3300005545 | Bacteria | 2333 |
| 84 | Ga0070695_100242445 | 3300005545 | Unclassified | 1308 |
| 85 | Ga0070696_100179830 | 3300005546 | Bacteria | 1568 |
| 86 | Ga0070693_100024503 | 3300005547 | Bacteria | 3237 |
| 87 | Ga0070693_100592163 | 3300005547 | Unclassified | 799 |
| 88 | Ga0070665_101521467 | 3300005548 | Unclassified | 677 |
| 89 | Ga0070704_100046421 | 3300005549 | Bacteria | 3029 |
| 90 | Ga0070704_100176924 | 3300005549 | Bacteria | 1703 |
| 91 | Ga0068855_100321513 | 3300005563 | Bacteria | 1710 |
| 92 | Ga0068855_100942747 | 3300005563 | Bacteria | 910 |
| 93 | Ga0070664_100118891 | 3300005564 | Bacteria | 2312 |
| 94 | Ga0070664_100228315 | 3300005564 | Bacteria | 1668 |
| 95 | Ga0068857_100002970 | 3300005577 | Bacteria | 13970 |
| 96 | Ga0068854_100212769 | 3300005578 | Bacteria | 1526 |
| 97 | Ga0068856_100039123 | 3300005614 | Bacteria | 4656 |
| 98 | Ga0068856_100440799 | 3300005614 | Bacteria | 1323 |
| 99 | Ga0068856_102022221 | 3300005614 | Unclassified | 586 |
| 100 | Ga0070702_100420185 | 3300005615 | Unclassified | 962 |
| 101 | Ga0068859_100220624 | 3300005617 | Bacteria | 1984 |
| 102 | Ga0068866_10002078 | 3300005718 | Bacteria | 8323 |
| 103 | Ga0068861_100064426 | 3300005719 | Bacteria | 2820 |
| 104 | Ga0068861_102437905 | 3300005719 | Unclassified | 526 |
| 105 | Ga0068863_100209583 | 3300005841 | Bacteria | 1876 |
| 106 | Ga0068863_100303054 | 3300005841 | Bacteria | 1550 |
| 107 | Ga0068863_100595298 | 3300005841 | Bacteria | 1094 |
| 108 | Ga0068858_100022629 | 3300005842 | Bacteria | 5861 |
| 109 | Ga0068858_100050888 | 3300005842 | Bacteria | 3834 |
| 110 | Ga0068858_100224168 | 3300005842 | Bacteria | 1781 |
| 111 | Ga0068860_100018177 | 3300005843 | Bacteria | 6843 |
| 112 | Ga0068860_100048112 | 3300005843 | Bacteria | 4065 |
| 113 | Ga0068860_100098532 | 3300005843 | Bacteria | 2787 |
| 114 | Ga0068862_100058468 | 3300005844 | Bacteria | 3307 |
| 115 | Ga0068862_100367938 | 3300005844 | Bacteria | 1337 |
| 116 | Ga0070717_11516831 | 3300006028 | Unclassified | 608 |
| 117 | Ga0070715_10002149 | 3300006163 | Bacteria | 5973 |
| 118 | Ga0070716_100001260 | 3300006173 | Bacteria | 11149 |
| 119 | Ga0070716_100068889 | 3300006173 | Bacteria | 2072 |
| 120 | Ga0070716_100155807 | 3300006173 | Bacteria | 1475 |
| 121 | Ga0070716_100392254 | 3300006173 | Bacteria | 996 |
| 122 | Ga0070712_100000101 | 3300006175 | Bacteria | 43677 |
| 123 | Ga0070712_100629087 | 3300006175 | Unclassified | 910 |
| 124 | Ga0070712_101245128 | 3300006175 | Unclassified | 648 |
| 125 | Ga0097621_100093154 | 3300006237 | Bacteria | 2524 |
| 126 | Ga0097621_100561100 | 3300006237 | Bacteria | 1040 |
| 127 | Ga0097621_100734479 | 3300006237 | Bacteria | 911 |
| 128 | Ga0097621_101656228 | 3300006237 | Unclassified | 609 |
| 129 | Ga0068871_100011641 | 3300006358 | Bacteria | 6458 |
| 130 | Ga0068871_100306238 | 3300006358 | Bacteria | 1396 |
| 131 | Ga0068871_100407400 | 3300006358 | Unclassified | 1212 |
| 132 | Ga0068871_100862836 | 3300006358 | Unclassified | 837 |
| 133 | Ga0075428_100269570 | 3300006844 | Bacteria | 1832 |
| 134 | Ga0075433_10002499 | 3300006852 | Bacteria | 13989 |
| 135 | Ga0075433_10509491 | 3300006852 | Bacteria | 1059 |
| 136 | Ga0075434_100001045 | 3300006871 | Bacteria | 22585 |
| 137 | Ga0075434_100111228 | 3300006871 | Bacteria | 2750 |
| 138 | Ga0075434_101177993 | 3300006871 | Bacteria | 779 |
| 139 | Ga0075434_101228024 | 3300006871 | Bacteria | 761 |
| 140 | Ga0075429_100055711 | 3300006880 | Bacteria | 3440 |
| 141 | Ga0068865_100009086 | 3300006881 | Bacteria | 6150 |
| 142 | Ga0068865_100092055 | 3300006881 | Bacteria | 2202 |
| 143 | Ga0068865_101141826 | 3300006881 | Unclassified | 688 |
| 144 | Ga0075436_100021131 | 3300006914 | Bacteria | 4466 |
| 145 | Ga0075436_100255455 | 3300006914 | Unclassified | 1249 |
| 146 | Ga0097620_100220627 | 3300006931 | Bacteria | 1984 |
| 147 | Ga0075435_100002717 | 3300007076 | Bacteria | 11814 |
| 148 | Ga0075435_100085392 | 3300007076 | Bacteria | 2598 |
| 149 | Ga0075435_100346839 | 3300007076 | Bacteria | 1272 |
| 150 | Ga0111539_10098845 | 3300009094 | Bacteria | 3427 |
| 151 | Ga0105245_10056336 | 3300009098 | Bacteria | 3533 |
| 152 | Ga0105245_10065624 | 3300009098 | Bacteria | 3283 |
| 153 | Ga0105245_10242426 | 3300009098 | Bacteria | 1748 |
| 154 | Ga0105245_10612523 | 3300009098 | Bacteria | 1116 |
| 155 | Ga0114129_10038495 | 3300009147 | Bacteria | 6745 |
| 156 | Ga0114129_10127678 | 3300009147 | Bacteria | 3495 |
| 157 | Ga0114129_10428847 | 3300009147 | Bacteria | 1738 |
| 158 | Ga0114129_10749899 | 3300009147 | Bacteria | 1250 |
| 159 | Ga0114129_11622730 | 3300009147 | Bacteria | 791 |
| 160 | Ga0105243_10033564 | 3300009148 | Bacteria | 3969 |
| 161 | Ga0105243_10725843 | 3300009148 | Bacteria | 971 |
| 162 | Ga0105241_10005346 | 3300009174 | Bacteria | 9487 |
| 163 | Ga0105241_10128295 | 3300009174 | Bacteria | 2050 |
| 164 | Ga0105241_10404595 | 3300009174 | Bacteria | 1198 |
| 165 | Ga0105242_10062813 | 3300009176 | Bacteria | 3057 |
| 166 | Ga0105242_10224326 | 3300009176 | Bacteria | 1681 |
| 167 | Ga0105242_10235384 | 3300009176 | Bacteria | 1643 |
| 168 | Ga0105242_10695564 | 3300009176 | Unclassified | 994 |
| 169 | Ga0105248_10016667 | 3300009177 | Bacteria | 8087 |
| 170 | Ga0105248_10036882 | 3300009177 | Bacteria | 5468 |
| 171 | Ga0105248_10107503 | 3300009177 | Unclassified | 3146 |
| 172 | Ga0105248_10357966 | 3300009177 | Bacteria | 1643 |
| 173 | Ga0105248_11895006 | 3300009177 | Unclassified | 677 |
| 174 | Ga0105237_11044359 | 3300009545 | Unclassified | 824 |
| 175 | Ga0105238_10177380 | 3300009551 | Bacteria | 2107 |
| 176 | Ga0105238_10653646 | 3300009551 | Bacteria | 1061 |
| 177 | Ga0105249_10392952 | 3300009553 | Bacteria | 1415 |
| 178 | Ga0105249_11606619 | 3300009553 | Bacteria | 723 |
| 179 | Ga0105249_12153503 | 3300009553 | Unclassified | 630 |
| 180 | Ga0099796_10035380 | 3300010159 | Bacteria | 1656 |
| 181 | Ga0105239_10011627 | 3300010375 | Bacteria | 9821 |
| 182 | Ga0105239_10085771 | 3300010375 | Bacteria | 3471 |
| 183 | Ga0105239_11515349 | 3300010375 | Unclassified | 775 |
| 184 | Ga0157371_10300641 | 3300013102 | Unclassified | 1162 |
| 185 | Ga0157371_10693707 | 3300013102 | Unclassified | 762 |
| 186 | Ga0157374_10000377 | 3300013296 | Bacteria | 41023 |
| 187 | Ga0157374_10016314 | 3300013296 | Bacteria | 6524 |
| 188 | Ga0157374_10358781 | 3300013296 | Bacteria | 1449 |
| 189 | Ga0157378_10095327 | 3300013297 | Bacteria | 2710 |
| 190 | Ga0157378_10138070 | 3300013297 | Bacteria | 2262 |
| 191 | Ga0157378_10252647 | 3300013297 | Bacteria | 1688 |
| 192 | Ga0157378_11279824 | 3300013297 | Unclassified | 774 |
| 193 | Ga0157378_11380959 | 3300013297 | Bacteria | 747 |
| 194 | Ga0163162_10001545 | 3300013306 | Bacteria | 21498 |
| 195 | Ga0163162_10010209 | 3300013306 | Bacteria | 9123 |
| 196 | Ga0163162_10104064 | 3300013306 | Bacteria | 2933 |
| 197 | Ga0163162_10663243 | 3300013306 | Bacteria | 1166 |
| 198 | Ga0163162_10774869 | 3300013306 | Unclassified | 1078 |
| 199 | Ga0163162_11887329 | 3300013306 | Unclassified | 684 |
| 200 | Ga0157372_10346555 | 3300013307 | Bacteria | 1731 |
| 201 | Ga0157375_10131042 | 3300013308 | Bacteria | 2627 |
| 202 | Ga0157375_12750627 | 3300013308 | Unclassified | 588 |
| 203 | Ga0163163_11459019 | 3300014325 | Unclassified | 746 |
| 204 | Ga0157380_10534719 | 3300014326 | Bacteria | 1146 |
| 205 | Ga0157380_12159399 | 3300014326 | Unclassified | 620 |
| 206 | Ga0157379_10074022 | 3300014968 | Bacteria | 3049 |
| 207 | Ga0157379_10109045 | 3300014968 | Bacteria | 2486 |
| 208 | Ga0157379_10182568 | 3300014968 | Bacteria | 1895 |
| 209 | Ga0157376_10067517 | 3300014969 | Bacteria | 3025 |
| 210 | Ga0157376_10178178 | 3300014969 | Bacteria | 1941 |
| 211 | Ga0163161_10003925 | 3300017792 | Bacteria | 10432 |
| 212 | Ga0213872_10178444 | 3300021361 | Unclassified | 918 |
| 213 | Ga0213872_10204747 | 3300021361 | Bacteria | 845 |
| 214 | Ga0213875_10048613 | 3300021388 | Bacteria | 1990 |
| 215 | Ga0224569_114424 | 3300022732 | Bacteria | 552 |
| 216 | Ga0207642_10049755 | 3300025899 | Bacteria | 1886 |
| 217 | Ga0207642_10281045 | 3300025899 | Bacteria | 957 |
| 218 | Ga0207680_10001385 | 3300025903 | Bacteria | 11453 |
| 219 | Ga0207680_10572327 | 3300025903 | Unclassified | 807 |
| 220 | Ga0207647_10189229 | 3300025904 | Bacteria | 1193 |
| 221 | Ga0207699_10047858 | 3300025906 | Unclassified | 2509 |
| 222 | Ga0207699_10060568 | 3300025906 | Bacteria | 2274 |
| 223 | Ga0207645_10013377 | 3300025907 | Bacteria | 5531 |
| 224 | Ga0207645_10187976 | 3300025907 | Bacteria | 1356 |
| 225 | Ga0207684_10001945 | 3300025910 | Bacteria | 21405 |
| 226 | Ga0207684_10222588 | 3300025910 | Unclassified | 1628 |
| 227 | Ga0207684_10900001 | 3300025910 | Bacteria | 744 |
| 228 | Ga0207684_11547747 | 3300025910 | Unclassified | 538 |
| 229 | Ga0207654_10223122 | 3300025911 | Bacteria | 1251 |
| 230 | Ga0207654_10412841 | 3300025911 | Bacteria | 941 |
| 231 | Ga0207707_10022584 | 3300025912 | Bacteria | 5499 |
| 232 | Ga0207671_10257585 | 3300025914 | Bacteria | 1372 |
| 233 | Ga0207671_10292854 | 3300025914 | Bacteria | 1285 |
| 234 | Ga0207671_10384643 | 3300025914 | Unclassified | 1115 |
| 235 | Ga0207693_10000124 | 3300025915 | Bacteria | 69213 |
| 236 | Ga0207693_10079986 | 3300025915 | Bacteria | 2558 |
| 237 | Ga0207693_10460575 | 3300025915 | Bacteria | 993 |
| 238 | Ga0207663_10043595 | 3300025916 | Bacteria | 2748 |
| 239 | Ga0207663_10055534 | 3300025916 | Bacteria | 2485 |
| 240 | Ga0207663_10091224 | 3300025916 | Unclassified | 2022 |
| 241 | Ga0207663_10296978 | 3300025916 | Bacteria | 1205 |
| 242 | Ga0207662_10002895 | 3300025918 | Bacteria | 8701 |
| 243 | Ga0207649_10165334 | 3300025920 | Bacteria | 1536 |
| 244 | Ga0207652_11147405 | 3300025921 | Unclassified | 678 |
| 245 | Ga0207646_10003115 | 3300025922 | Bacteria | 19043 |
| 246 | Ga0207646_10009119 | 3300025922 | Bacteria | 9846 |
| 247 | Ga0207646_10041964 | 3300025922 | Bacteria | 4110 |
| 248 | Ga0207646_10253483 | 3300025922 | Bacteria | 1590 |
| 249 | Ga0207681_10127345 | 3300025923 | Bacteria | 1877 |
| 250 | Ga0207681_10186892 | 3300025923 | Bacteria | 1582 |
| 251 | Ga0207681_10289088 | 3300025923 | Bacteria | 1293 |
| 252 | Ga0207694_10188519 | 3300025924 | Bacteria | 1675 |
| 253 | Ga0207687_10034284 | 3300025927 | Bacteria | 3446 |
| 254 | Ga0207687_10122018 | 3300025927 | Bacteria | 1950 |
| 255 | Ga0207700_10007287 | 3300025928 | Bacteria | 6749 |
| 256 | Ga0207664_10411310 | 3300025929 | Bacteria | 1204 |
| 257 | Ga0207644_10015295 | 3300025931 | Bacteria | 5147 |
| 258 | Ga0207706_10002401 | 3300025933 | Bacteria | 18268 |
| 259 | Ga0207706_10011251 | 3300025933 | Bacteria | 8159 |
| 260 | Ga0207686_10599046 | 3300025934 | Unclassified | 867 |
| 261 | Ga0207686_11060857 | 3300025934 | Unclassified | 659 |
| 262 | Ga0207709_10124058 | 3300025935 | Bacteria | 1749 |
| 263 | Ga0207669_10339957 | 3300025937 | Unclassified | 1156 |
| 264 | Ga0207704_10080341 | 3300025938 | Bacteria | 2105 |
| 265 | Ga0207704_10880733 | 3300025938 | Unclassified | 752 |
| 266 | Ga0207665_10001677 | 3300025939 | Bacteria | 14902 |
| 267 | Ga0207665_10006349 | 3300025939 | Bacteria | 7839 |
| 268 | Ga0207665_10015541 | 3300025939 | Bacteria | 4996 |
| 269 | Ga0207665_10042759 | 3300025939 | Unclassified | 3029 |
| 270 | Ga0207665_10144972 | 3300025939 | Bacteria | 1696 |
| 271 | Ga0207711_10682365 | 3300025941 | Bacteria | 958 |
| 272 | Ga0207711_11149225 | 3300025941 | Unclassified | 717 |
| 273 | Ga0207689_10001367 | 3300025942 | Bacteria | 23390 |
| 274 | Ga0207689_10210681 | 3300025942 | Bacteria | 1606 |
| 275 | Ga0207661_10012931 | 3300025944 | Bacteria | 6088 |
| 276 | Ga0207679_10084189 | 3300025945 | Bacteria | 2440 |
| 277 | Ga0207679_10172787 | 3300025945 | Bacteria | 1781 |
| 278 | Ga0207667_10079596 | 3300025949 | Bacteria | 3396 |
| 279 | Ga0207667_10134569 | 3300025949 | Bacteria | 2545 |
| 280 | Ga0207712_10480551 | 3300025961 | Unclassified | 1059 |
| 281 | Ga0207668_10688611 | 3300025972 | Unclassified | 897 |
| 282 | Ga0207640_10175842 | 3300025981 | Bacteria | 1600 |
| 283 | Ga0207658_11415222 | 3300025986 | Unclassified | 636 |
| 284 | Ga0207703_10030135 | 3300026035 | Bacteria | 4286 |
| 285 | Ga0207703_10892257 | 3300026035 | Unclassified | 851 |
| 286 | Ga0207639_10217944 | 3300026041 | Bacteria | 1647 |
| 287 | Ga0207639_11360643 | 3300026041 | Unclassified | 666 |
| 288 | Ga0207678_10088375 | 3300026067 | Bacteria | 2648 |
| 289 | Ga0207708_10087432 | 3300026075 | Bacteria | 2400 |
| 290 | Ga0207702_10280177 | 3300026078 | Bacteria | 1576 |
| 291 | Ga0207702_10431438 | 3300026078 | Bacteria | 1276 |
| 292 | Ga0207641_10080777 | 3300026088 | Bacteria | 2822 |
| 293 | Ga0207641_10250859 | 3300026088 | Bacteria | 1653 |
| 294 | Ga0207641_10447223 | 3300026088 | Bacteria | 1248 |
| 295 | Ga0207641_10557045 | 3300026088 | Bacteria | 1118 |
| 296 | Ga0207641_10700618 | 3300026088 | Unclassified | 997 |
| 297 | Ga0207648_10013759 | 3300026089 | Bacteria | 7510 |
| 298 | Ga0207648_10013933 | 3300026089 | Bacteria | 7455 |
| 299 | Ga0207648_10057018 | 3300026089 | Bacteria | 3408 |
| 300 | Ga0207674_10004517 | 3300026116 | Bacteria | 16711 |
| 301 | Ga0207675_100016104 | 3300026118 | Bacteria | 6983 |
| 302 | Ga0207675_100058993 | 3300026118 | Bacteria | 3582 |
| 303 | Ga0207675_100293407 | 3300026118 | Bacteria | 1582 |
| 304 | Ga0207675_100750929 | 3300026118 | Unclassified | 987 |
| 305 | Ga0207675_102303598 | 3300026118 | Unclassified | 552 |
| 306 | Ga0207683_10007606 | 3300026121 | Bacteria | 9281 |
| 307 | Ga0207683_10116177 | 3300026121 | Bacteria | 2399 |
| 308 | Ga0207428_10042309 | 3300027907 | Bacteria | 3684 |
| 309 | Ga0207428_10450273 | 3300027907 | Bacteria | 939 |
| 310 | Ga0268266_10001863 | 3300028379 | Bacteria | 23829 |
| 311 | Ga0268265_10364961 | 3300028380 | Unclassified | 1323 |
| 312 | Ga0268264_10109600 | 3300028381 | Bacteria | 2416 |
| 313 | Ga0268264_10163536 | 3300028381 | Bacteria | 2007 |
| 314 | Ga0268264_10656643 | 3300028381 | Unclassified | 1038 |
| 315 | Ga0268264_10956037 | 3300028381 | Bacteria | 862 |
| 316 | Ga0265337_1005118 | 3300028556 | Bacteria | 5276 |
| 317 | Ga0265336_10173352 | 3300028666 | Unclassified | 641 |
| 318 | Ga0265338_10481903 | 3300028800 | Bacteria | 875 |
| 319 | Ga0265320_10000566 | 3300031240 | Bacteria | 28582 |
| 320 | Ga0373938_0031388 | 3300034957 | Bacteria | 1139 |
| 321 | Ga0373954_0169551 | 3300035118 | Unclassified | 1069 |
| 322 | Ga0373931_0307888 | 3300035691 | Bacteria | 980 |
| 323 | Ga0373927_0404176 | 3300035695 | Bacteria | 901 |
| 324 | Ga0373927_0625606 | 3300035695 | Bacteria | 712 |
| 325 | Ga0373947_0148624 | 3300035725 | Bacteria | 1508 |
| 326 | Ga0373947_0203528 | 3300035725 | Bacteria | 1296 |
| 327 | Ga0316582_0654955 | 3300036647 | Bacteria | 722 |
| 328 | Ga0373925_0042100 | 3300037068 | Bacteria | 3388 |
| 329 | Ga0373925_0217581 | 3300037068 | Unclassified | 1524 |
| 330 | Ga0395900_0227648 | 3300037418 | Bacteria | 1877 |
| 331 | Ga0395900_0888325 | 3300037418 | Bacteria | 815 |
| 332 | Ga0395898_0702278 | 3300037466 | Bacteria | 953 |
| 333 | Ga0395898_1165701 | 3300037466 | Bacteria | 702 |
| 334 | Ga0395898_1471053 | 3300037466 | Unclassified | 608 |
| 335 | Ga0395905_0038392 | 3300037471 | Bacteria | 4494 |
| 336 | Ga0395905_0079656 | 3300037471 | Bacteria | 3071 |
| 337 | Ga0395905_0147061 | 3300037471 | Bacteria | 2217 |
| 338 | Ga0395905_0155463 | 3300037471 | Bacteria | 2151 |
| 339 | Ga0395905_1035144 | 3300037471 | Bacteria | 724 |
| 340 | Ga0436364_0897119 | 3300037853 | Bacteria | 4903 |
| 341 | Ga0395901_1059919 | 3300038443 | Unclassified | 783 |
| 342 | Ga0395901_1338498 | 3300038443 | Unclassified | 677 |
| 343 | Ga0436365_0197260 | 3300039437 | Bacteria | 27939 |
| 344 | Ga0436360_0142918 | 3300039438 | Bacteria | 2666 |
| 345 | Ga0436361_0008440 | 3300039447 | Bacteria | 5180 |
| 346 | Ga0436361_0205323 | 3300039447 | Unclassified | 1489 |
| 347 | Ga0436361_0704747 | 3300039447 | Unclassified | 1387 |
| 348 | Ga0436361_0890240 | 3300039447 | Bacteria | 1472 |
| 349 | Ga0436363_0139442 | 3300039450 | Bacteria | 1319 |
| 350 | Ga0436363_0333474 | 3300039450 | Bacteria | 1228 |
| 351 | Ga0436363_0531043 | 3300039450 | Unclassified | 1021 |
| 352 | Ga0436362_0774554 | 3300039453 | Bacteria | 989 |
| 353 | Ga0439455_0094101 | 3300042012 | Bacteria | 824 |
| 354 | Ga0439460_0082915 | 3300042461 | Bacteria | 1009 |
| 355 | Ga0451577_0036129 | 3300042876 | Bacteria | 4449 |
| 356 | Ga0451577_0138762 | 3300042876 | Bacteria | 2184 |
| 357 | Ga0453683_0003011 | 3300044673 | Bacteria | 12616 |
| 358 | Ga0453684_0034236 | 3300044712 | Bacteria | 7056 |
| 359 | Ga0453684_0323151 | 3300044712 | Bacteria | 1747 |
| 360 | Ga0451576_0019885 | 3300045051 | Bacteria | 7323 |
| 361 | Ga0495629_0439701 | 3300046459 | Bacteria | 884 |
| 362 | Ga0495653_0562202 | 3300046463 | Bacteria | 705 |
| 363 | Ga0495580_0364433 | 3300046472 | Bacteria | 978 |
| 364 | Ga0495608_0012034 | 3300046511 | Bacteria | 6016 |
| 365 | Ga0495618_0003435 | 3300046514 | Bacteria | 9850 |
| 366 | Ga0495628_0245463 | 3300046516 | Unclassified | 1338 |
| 367 | Ga0495630_0021228 | 3300046517 | Bacteria | 4795 |
| 368 | Ga0495652_0010360 | 3300046529 | Bacteria | 8447 |
| 369 | Ga0495640_0185072 | 3300046533 | Bacteria | 1326 |
| 370 | Ga0495586_0028430 | 3300046535 | Bacteria | 2992 |
| 371 | Ga0495587_0053707 | 3300046536 | Bacteria | 2375 |
| 372 | Ga0495587_0773909 | 3300046536 | Unclassified | 525 |
| 373 | Ga0495645_0000454 | 3300046543 | Bacteria | 28172 |
| 374 | Ga0495645_0576456 | 3300046543 | Bacteria | 695 |
| 375 | Ga0495667_0149074 | 3300046559 | Bacteria | 1506 |
| 376 | Ga0495634_0018033 | 3300046642 | Bacteria | 5030 |
| 377 | Ga0495635_0056724 | 3300046663 | Bacteria | 2696 |
| 378 | Ga0495599_0147259 | 3300046678 | Unclassified | 1459 |
| 379 | Ga0495646_0022599 | 3300046680 | Bacteria | 3966 |
| 380 | Ga0495647_0047342 | 3300046681 | Bacteria | 1659 |
| 381 | Ga0495658_0409776 | 3300046683 | Bacteria | 864 |
| 382 | Ga0495613_0010278 | 3300046689 | Bacteria | 6952 |
| 383 | Ga0495624_0075577 | 3300046690 | Bacteria | 2092 |
| 384 | Ga0495670_0038933 | 3300046691 | Bacteria | 2371 |
| 385 | Ga0495600_0221116 | 3300046809 | Bacteria | 1211 |
| 386 | Ga0495581_0459844 | 3300047315 | Unclassified | 741 |
| 387 | Ga0495674_0038443 | 3300047319 | Bacteria | 4295 |
| 388 | Ga0495674_0310015 | 3300047319 | Bacteria | 1288 |
| 389 | Ga0495676_0931995 | 3300047321 | Unclassified | 556 |
| 390 | Ga0495680_0024622 | 3300047322 | Bacteria | 4992 |
| 391 | Ga0495680_0797620 | 3300047322 | Bacteria | 617 |
| 392 | Ga0495675_0012257 | 3300047444 | Bacteria | 5395 |
| 393 | Ga0495675_0176061 | 3300047444 | Unclassified | 1312 |
| 394 | Ga0495684_0000635 | 3300047471 | Bacteria | 28267 |
| 395 | Ga0495602_0013807 | 3300048088 | Bacteria | 8236 |
| 396 | Ga0495602_0376094 | 3300048088 | Bacteria | 1019 |
| 397 | Ga0496100_0093366 | 3300048903 | Unclassified | 2059 |
| 398 | Ga0496101_0436426 | 3300048904 | Bacteria | 1033 |
| 399 | Ga0496102_0004151 | 3300048905 | Bacteria | 12273 |
| 400 | Ga0496102_0629925 | 3300048905 | Bacteria | 996 |
| 401 | Ga0496103_0060343 | 3300048906 | Bacteria | 2357 |
| 402 | Ga0496103_0306357 | 3300048906 | Bacteria | 1022 |
| 403 | Ga0496104_0028538 | 3300048907 | Bacteria | 5172 |
| 404 | Ga0496104_0124897 | 3300048907 | Bacteria | 2471 |
| 405 | Ga0496106_0737840 | 3300048909 | Unclassified | 783 |
| 406 | Ga0496107_0082071 | 3300048910 | Bacteria | 2351 |
| 407 | Ga0496107_0241292 | 3300048910 | Bacteria | 1345 |
| 408 | Ga0496107_0296836 | 3300048910 | Bacteria | 1203 |
| 409 | Ga0496112_0055928 | 3300048915 | Bacteria | 3882 |
| 410 | Ga0496112_0125100 | 3300048915 | Bacteria | 2542 |
| 411 | Ga0496112_0290841 | 3300048915 | Unclassified | 1580 |
| 412 | Ga0496112_0342648 | 3300048915 | Bacteria | 1438 |
| 413 | Ga0496113_0125774 | 3300048916 | Bacteria | 2008 |
| 414 | Ga0496113_1371378 | 3300048916 | Unclassified | 548 |
| 415 | Ga0501034_0244960 | 3300049571 | Bacteria | 1738 |
| 416 | Ga0501037_0022688 | 3300049573 | Bacteria | 4640 |
| 417 | Ga0501040_0131418 | 3300049576 | Bacteria | 1761 |
| 418 | Ga0501041_0043065 | 3300049577 | Bacteria | 2744 |
| 419 | Ga0501041_0174857 | 3300049577 | Bacteria | 1344 |
| 420 | Ga0501042_0249548 | 3300049578 | Bacteria | 1280 |
| 421 | Ga0501043_0137630 | 3300049579 | Bacteria | 1913 |
| 422 | Ga0501072_0363772 | 3300049588 | Unclassified | 1148 |
| 423 | Ga0501073_0140096 | 3300049589 | Bacteria | 1676 |
| 424 | Ga0501075_0574354 | 3300049591 | Bacteria | 860 |
| 425 | Ga0501076_0256988 | 3300049592 | Bacteria | 1430 |
| 426 | Ga0501079_0237568 | 3300049741 | Bacteria | 1424 |
| 427 | Ga0501079_0282117 | 3300049741 | Bacteria | 1299 |
| 428 | Ga0501035_0064996 | 3300049822 | Bacteria | 3241 |
| 429 | Ga0501035_0677470 | 3300049822 | Bacteria | 834 |
| 430 | Ga0501045_0080697 | 3300049824 | Bacteria | 2399 |
| 431 | nmdc:mga05p37_1168375_c1 | 3300050507 | Unclassified | 799 |
| 432 | nmdc:mga05p37_450266_c1 | 3300050507 | Bacteria | 1490 |
| 433 | nmdc:mga05p37_5636_c1 | 3300050507 | Bacteria | 14719 |
| 434 | nmdc:mga05p37_702169_c1 | 3300050507 | Unclassified | 1123 |
| 435 | nmdc:mga08y16_402394_c1 | 3300050511 | Bacteria | 1401 |
| 436 | nmdc:mga0n895_101298_c1 | 3300050512 | Bacteria | 2890 |
| 437 | nmdc:mga0n895_1083_c1 | 3300050512 | Bacteria | 19897 |
| 438 | nmdc:mga0n895_112759_c1 | 3300050512 | Bacteria | 2736 |
| 439 | nmdc:mga0n895_1445519_c1 | 3300050512 | Bacteria | 655 |
| 440 | nmdc:mga0n895_21782_c1 | 3300050512 | Bacteria | 5999 |
| 441 | nmdc:mga0rr50_19936_c1 | 3300050513 | Bacteria | 4540 |
| 442 | nmdc:mga0rr50_23174_c1 | 3300050513 | Bacteria | 4275 |
| 443 | nmdc:mga0rr50_464870_c1 | 3300050513 | Bacteria | 1073 |
| 444 | nmdc:mga08x19_17553_c1 | 3300050514 | Bacteria | 4380 |
| 445 | nmdc:mga08x19_28278_c1 | 3300050514 | Bacteria | 3511 |
| 446 | nmdc:mga08x19_484309_c1 | 3300050514 | Bacteria | 872 |
| 447 | nmdc:mga0a205_1094376_c1 | 3300050515 | Unclassified | 644 |
| 448 | nmdc:mga0a205_18702_c1 | 3300050515 | Bacteria | 6520 |
| 449 | nmdc:mga0a205_6176_c1 | 3300050515 | Bacteria | 10809 |
| 450 | Ga0501082_1307218 | 3300060353 | Unclassified | 633 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10358781 | Ga0157374_103587812 | 139 |
| 2 | 3300006173 | Ga0070716_100392254 | Ga0070716_1003922542 | 143 |
| 3 | 3300013308 | Ga0157375_12750627 | Ga0157375_127506272 | 146 |
| 4 | 3300005336 | Ga0070680_100618153 | Ga0070680_1006181532 | 147 |
| 5 | 3300005367 | Ga0070667_100539678 | Ga0070667_1005396782 | 147 |
| 6 | 3300005439 | Ga0070711_100143925 | Ga0070711_1001439252 | 147 |
| 7 | 3300005458 | Ga0070681_10037936 | Ga0070681_100379363 | 147 |
| 8 | 3300005530 | Ga0070679_100032040 | Ga0070679_1000320403 | 147 |
| 9 | 3300005539 | Ga0068853_100370865 | Ga0068853_1003708652 | 147 |
| 10 | 3300005563 | Ga0068855_100321513 | Ga0068855_1003215132 | 147 |
| 11 | 3300005564 | Ga0070664_100118891 | Ga0070664_1001188913 | 147 |
| 12 | 3300005577 | Ga0068857_100002970 | Ga0068857_10000297010 | 147 |
| 13 | 3300005614 | Ga0068856_100039123 | Ga0068856_1000391233 | 147 |
| 14 | 3300005841 | Ga0068863_100303054 | Ga0068863_1003030542 | 147 |
| 15 | 3300006237 | Ga0097621_100734479 | Ga0097621_1007344791 | 147 |
| 16 | 3300006237 | Ga0097621_101656228 | Ga0097621_1016562281 | 147 |
| 17 | 3300006358 | Ga0068871_100407400 | Ga0068871_1004074001 | 147 |
| 18 | 3300009098 | Ga0105245_10612523 | Ga0105245_106125231 | 147 |
| 19 | 3300009148 | Ga0105243_10033564 | Ga0105243_100335643 | 147 |
| 20 | 3300009174 | Ga0105241_10005346 | Ga0105241_100053464 | 147 |
| 21 | 3300009176 | Ga0105242_10235384 | Ga0105242_102353841 | 147 |
| 22 | 3300009177 | Ga0105248_10107503 | Ga0105248_101075033 | 147 |
| 23 | 3300009551 | Ga0105238_10177380 | Ga0105238_101773802 | 147 |
| 24 | 3300010375 | Ga0105239_10011627 | Ga0105239_100116274 | 147 |
| 25 | 3300013297 | Ga0157378_10252647 | Ga0157378_102526472 | 147 |
| 26 | 3300013306 | Ga0163162_10001545 | Ga0163162_100015456 | 147 |
| 27 | 3300025906 | Ga0207699_10047858 | Ga0207699_100478582 | 147 |
| 28 | 3300025907 | Ga0207645_10187976 | Ga0207645_101879761 | 147 |
| 29 | 3300025911 | Ga0207654_10223122 | Ga0207654_102231222 | 147 |
| 30 | 3300025911 | Ga0207654_10412841 | Ga0207654_104128412 | 147 |
| 31 | 3300025912 | Ga0207707_10022584 | Ga0207707_100225844 | 147 |
| 32 | 3300025914 | Ga0207671_10257585 | Ga0207671_102575852 | 147 |
| 33 | 3300025916 | Ga0207663_10091224 | Ga0207663_100912243 | 147 |
| 34 | 3300025921 | Ga0207652_11147405 | Ga0207652_111474052 | 147 |
| 35 | 3300025933 | Ga0207706_10011251 | Ga0207706_100112513 | 147 |
| 36 | 3300025937 | Ga0207669_10339957 | Ga0207669_103399572 | 147 |
| 37 | 3300025939 | Ga0207665_10042759 | Ga0207665_100427592 | 147 |
| 38 | 3300025945 | Ga0207679_10084189 | Ga0207679_100841893 | 147 |
| 39 | 3300025949 | Ga0207667_10079596 | Ga0207667_100795964 | 147 |
| 40 | 3300025986 | Ga0207658_11415222 | Ga0207658_114152221 | 147 |
| 41 | 3300026041 | Ga0207639_10217944 | Ga0207639_102179442 | 147 |
| 42 | 3300026078 | Ga0207702_10280177 | Ga0207702_102801773 | 147 |
| 43 | 3300026088 | Ga0207641_10250859 | Ga0207641_102508592 | 147 |
| 44 | 3300026116 | Ga0207674_10004517 | Ga0207674_1000451710 | 147 |
| 45 | 3300046536 | Ga0495587_0773909 | Ga0495587_0773909_19_462 | 147 |
| 46 | 3300047444 | Ga0495675_0176061 | Ga0495675_0176061_156_599 | 147 |
| 47 | 3300048088 | Ga0495602_0376094 | Ga0495602_0376094_556_999 | 147 |
| 48 | 3300048903 | Ga0496100_0093366 | Ga0496100_0093366_1268_1711 | 147 |
| 49 | 3300048910 | Ga0496107_0241292 | Ga0496107_0241292_226_669 | 147 |
| 50 | 3300048915 | Ga0496112_0342648 | Ga0496112_0342648_941_1384 | 147 |
| 51 | 3300005293 | Ga0065715_10632172 | Ga0065715_106321722 | 148 |
| 52 | 3300005295 | Ga0065707_10015971 | Ga0065707_100159712 | 148 |
| 53 | 3300005343 | Ga0070687_100170545 | Ga0070687_1001705452 | 148 |
| 54 | 3300005356 | Ga0070674_100368152 | Ga0070674_1003681522 | 148 |
| 55 | 3300005439 | Ga0070711_100165485 | Ga0070711_1001654853 | 148 |
| 56 | 3300005440 | Ga0070705_100307024 | Ga0070705_1003070242 | 148 |
| 57 | 3300005441 | Ga0070700_100365841 | Ga0070700_1003658411 | 148 |
| 58 | 3300005456 | Ga0070678_100106091 | Ga0070678_1001060912 | 148 |
| 59 | 3300005459 | Ga0068867_100587487 | Ga0068867_1005874872 | 148 |
| 60 | 3300005518 | Ga0070699_100028933 | Ga0070699_1000289334 | 148 |
| 61 | 3300005545 | Ga0070695_100055650 | Ga0070695_1000556502 | 148 |
| 62 | 3300005547 | Ga0070693_100024503 | Ga0070693_1000245032 | 148 |
| 63 | 3300005549 | Ga0070704_100176924 | Ga0070704_1001769242 | 148 |
| 64 | 3300005617 | Ga0068859_100220624 | Ga0068859_1002206242 | 148 |
| 65 | 3300006931 | Ga0097620_100220627 | Ga0097620_1002206272 | 148 |
| 66 | 3300009098 | Ga0105245_10242426 | Ga0105245_102424262 | 148 |
| 67 | 3300009148 | Ga0105243_10725843 | Ga0105243_107258432 | 148 |
| 68 | 3300009174 | Ga0105241_10128295 | Ga0105241_101282952 | 148 |
| 69 | 3300009176 | Ga0105242_10062813 | Ga0105242_100628132 | 148 |
| 70 | 3300025910 | Ga0207684_10900001 | Ga0207684_109000012 | 148 |
| 71 | 3300025923 | Ga0207681_10186892 | Ga0207681_101868922 | 148 |
| 72 | 3300025935 | Ga0207709_10124058 | Ga0207709_101240583 | 148 |
| 73 | 3300026088 | Ga0207641_10447223 | Ga0207641_104472232 | 148 |
| 74 | 3300026089 | Ga0207648_10013933 | Ga0207648_100139331 | 148 |
| 75 | 3300026118 | Ga0207675_100293407 | Ga0207675_1002934073 | 148 |
| 76 | 3300026121 | Ga0207683_10116177 | Ga0207683_101161773 | 148 |
| 77 | 3300034957 | Ga0373938_0031388 | Ga0373938_0031388_336_782 | 148 |
| 78 | 3300035691 | Ga0373931_0307888 | Ga0373931_0307888_313_759 | 148 |
| 79 | 3300037466 | Ga0395898_1471053 | Ga0395898_1471053_68_550 | 148 |
| 80 | 3300037471 | Ga0395905_0147061 | Ga0395905_0147061_416_904 | 148 |
| 81 | 3300037471 | Ga0395905_0155463 | Ga0395905_0155463_352_834 | 148 |
| 82 | 3300046511 | Ga0495608_0012034 | Ga0495608_0012034_3444_3890 | 148 |
| 83 | 3300046514 | Ga0495618_0003435 | Ga0495618_0003435_292_738 | 148 |
| 84 | 3300046516 | Ga0495628_0245463 | Ga0495628_0245463_589_1035 | 148 |
| 85 | 3300046517 | Ga0495630_0021228 | Ga0495630_0021228_4103_4549 | 148 |
| 86 | 3300046529 | Ga0495652_0010360 | Ga0495652_0010360_4553_4999 | 148 |
| 87 | 3300046533 | Ga0495640_0185072 | Ga0495640_0185072_502_948 | 148 |
| 88 | 3300046535 | Ga0495586_0028430 | Ga0495586_0028430_121_567 | 148 |
| 89 | 3300046536 | Ga0495587_0053707 | Ga0495587_0053707_887_1333 | 148 |
| 90 | 3300046559 | Ga0495667_0149074 | Ga0495667_0149074_750_1196 | 148 |
| 91 | 3300046642 | Ga0495634_0018033 | Ga0495634_0018033_871_1317 | 148 |
| 92 | 3300046663 | Ga0495635_0056724 | Ga0495635_0056724_473_919 | 148 |
| 93 | 3300046678 | Ga0495599_0147259 | Ga0495599_0147259_893_1339 | 148 |
| 94 | 3300046680 | Ga0495646_0022599 | Ga0495646_0022599_3032_3478 | 148 |
| 95 | 3300046689 | Ga0495613_0010278 | Ga0495613_0010278_3171_3617 | 148 |
| 96 | 3300046690 | Ga0495624_0075577 | Ga0495624_0075577_869_1315 | 148 |
| 97 | 3300046809 | Ga0495600_0221116 | Ga0495600_0221116_118_564 | 148 |
| 98 | 3300047315 | Ga0495581_0459844 | Ga0495581_0459844_42_488 | 148 |
| 99 | 3300047319 | Ga0495674_0038443 | Ga0495674_0038443_589_1035 | 148 |
| 100 | 3300047321 | Ga0495676_0931995 | Ga0495676_0931995_100_546 | 148 |
| 101 | 3300047322 | Ga0495680_0024622 | Ga0495680_0024622_992_1438 | 148 |
| 102 | 3300047444 | Ga0495675_0012257 | Ga0495675_0012257_1544_1990 | 148 |
| 103 | 3300047471 | Ga0495684_0000635 | Ga0495684_0000635_22530_22976 | 148 |
| 104 | 3300048088 | Ga0495602_0013807 | Ga0495602_0013807_4500_4946 | 148 |
| 105 | 3300048905 | Ga0496102_0629925 | Ga0496102_0629925_29_475 | 148 |
| 106 | 3300048906 | Ga0496103_0306357 | Ga0496103_0306357_301_747 | 148 |
| 107 | 3300048910 | Ga0496107_0296836 | Ga0496107_0296836_299_745 | 148 |
| 108 | 3300049577 | Ga0501041_0174857 | Ga0501041_0174857_213_659 | 148 |
| 109 | 3300049588 | Ga0501072_0363772 | Ga0501072_0363772_108_554 | 148 |
| 110 | 3300049591 | Ga0501075_0574354 | Ga0501075_0574354_353_799 | 148 |
| 111 | 3300049741 | Ga0501079_0237568 | Ga0501079_0237568_545_991 | 148 |
| 112 | 3300049822 | Ga0501035_0677470 | Ga0501035_0677470_132_578 | 148 |
| 113 | 3300013297 | Ga0157378_11380959 | Ga0157378_113809591 | 149 |
| 114 | 3300046459 | Ga0495629_0439701 | Ga0495629_0439701_295_744 | 149 |
| 115 | 3300046463 | Ga0495653_0562202 | Ga0495653_0562202_52_501 | 149 |
| 116 | 3300046681 | Ga0495647_0047342 | Ga0495647_0047342_532_981 | 149 |
| 117 | 3300046683 | Ga0495658_0409776 | Ga0495658_0409776_272_721 | 149 |
| 118 | 3300047319 | Ga0495674_0310015 | Ga0495674_0310015_210_659 | 149 |
| 119 | 3300047322 | Ga0495680_0797620 | Ga0495680_0797620_88_537 | 149 |
| 120 | 3300049571 | Ga0501034_0244960 | Ga0501034_0244960_11_460 | 149 |
| 121 | 3300049573 | Ga0501037_0022688 | Ga0501037_0022688_646_1095 | 149 |
| 122 | 3300049576 | Ga0501040_0131418 | Ga0501040_0131418_371_820 | 149 |
| 123 | 3300049577 | Ga0501041_0043065 | Ga0501041_0043065_973_1422 | 149 |
| 124 | 3300049578 | Ga0501042_0249548 | Ga0501042_0249548_341_790 | 149 |
| 125 | 3300049579 | Ga0501043_0137630 | Ga0501043_0137630_935_1384 | 149 |
| 126 | 3300049589 | Ga0501073_0140096 | Ga0501073_0140096_465_914 | 149 |
| 127 | 3300049592 | Ga0501076_0256988 | Ga0501076_0256988_825_1274 | 149 |
| 128 | 3300049741 | Ga0501079_0282117 | Ga0501079_0282117_632_1081 | 149 |
| 129 | 3300049822 | Ga0501035_0064996 | Ga0501035_0064996_631_1080 | 149 |
| 130 | 3300049824 | Ga0501045_0080697 | Ga0501045_0080697_517_966 | 149 |
| 131 | 3300050511 | nmdc:mga08y16_402394_c1 | nmdc:mga08y16_402394_c1_620_1069 | 149 |
| 132 | 3300050512 | nmdc:mga0n895_112759_c1 | nmdc:mga0n895_112759_c1_2266_2715 | 149 |
| 133 | 3300050514 | nmdc:mga08x19_28278_c1 | nmdc:mga08x19_28278_c1_2785_3234 | 149 |
| 134 | 3300060353 | Ga0501082_1307218 | Ga0501082_1307218_172_621 | 149 |
| 135 | 3300005293 | Ga0065715_10106546 | Ga0065715_101065462 | 150 |
| 136 | 3300005293 | Ga0065715_10166791 | Ga0065715_101667912 | 150 |
| 137 | 3300005295 | Ga0065707_10347906 | Ga0065707_103479062 | 150 |
| 138 | 3300005328 | Ga0070676_10041866 | Ga0070676_100418663 | 150 |
| 139 | 3300005329 | Ga0070683_100039824 | Ga0070683_1000398242 | 150 |
| 140 | 3300005330 | Ga0070690_100033878 | Ga0070690_1000338783 | 150 |
| 141 | 3300005334 | Ga0068869_100006864 | Ga0068869_1000068647 | 150 |
| 142 | 3300005334 | Ga0068869_100123206 | Ga0068869_1001232062 | 150 |
| 143 | 3300005335 | Ga0070666_10001715 | Ga0070666_100017153 | 150 |
| 144 | 3300005335 | Ga0070666_10591432 | Ga0070666_105914321 | 150 |
| 145 | 3300005337 | Ga0070682_100389553 | Ga0070682_1003895532 | 150 |
| 146 | 3300005338 | Ga0068868_100008872 | Ga0068868_1000088727 | 150 |
| 147 | 3300005339 | Ga0070660_100028197 | Ga0070660_1000281972 | 150 |
| 148 | 3300005347 | Ga0070668_100220091 | Ga0070668_1002200913 | 150 |
| 149 | 3300005353 | Ga0070669_100023750 | Ga0070669_1000237503 | 150 |
| 150 | 3300005353 | Ga0070669_101544751 | Ga0070669_1015447511 | 150 |
| 151 | 3300005354 | Ga0070675_100236178 | Ga0070675_1002361782 | 150 |
| 152 | 3300005355 | Ga0070671_100003755 | Ga0070671_1000037552 | 150 |
| 153 | 3300005364 | Ga0070673_100245584 | Ga0070673_1002455842 | 150 |
| 154 | 3300005364 | Ga0070673_100500486 | Ga0070673_1005004862 | 150 |
| 155 | 3300005366 | Ga0070659_100113469 | Ga0070659_1001134691 | 150 |
| 156 | 3300005367 | Ga0070667_100004703 | Ga0070667_10000470311 | 150 |
| 157 | 3300005434 | Ga0070709_10010814 | Ga0070709_100108144 | 150 |
| 158 | 3300005434 | Ga0070709_10021636 | Ga0070709_100216363 | 150 |
| 159 | 3300005434 | Ga0070709_10047885 | Ga0070709_100478851 | 150 |
| 160 | 3300005434 | Ga0070709_11206972 | Ga0070709_112069721 | 150 |
| 161 | 3300005435 | Ga0070714_100161808 | Ga0070714_1001618082 | 150 |
| 162 | 3300005435 | Ga0070714_100293323 | Ga0070714_1002933232 | 150 |
| 163 | 3300005436 | Ga0070713_100001526 | Ga0070713_10000152612 | 150 |
| 164 | 3300005436 | Ga0070713_100533146 | Ga0070713_1005331462 | 150 |
| 165 | 3300005436 | Ga0070713_100550048 | Ga0070713_1005500482 | 150 |
| 166 | 3300005436 | Ga0070713_100662443 | Ga0070713_1006624432 | 150 |
| 167 | 3300005437 | Ga0070710_11422605 | Ga0070710_114226051 | 150 |
| 168 | 3300005438 | Ga0070701_10029136 | Ga0070701_100291362 | 150 |
| 169 | 3300005439 | Ga0070711_100027812 | Ga0070711_1000278122 | 150 |
| 170 | 3300005439 | Ga0070711_100724290 | Ga0070711_1007242902 | 150 |
| 171 | 3300005439 | Ga0070711_101167462 | Ga0070711_1011674622 | 150 |
| 172 | 3300005440 | Ga0070705_100055548 | Ga0070705_1000555483 | 150 |
| 173 | 3300005444 | Ga0070694_100000274 | Ga0070694_1000002744 | 150 |
| 174 | 3300005445 | Ga0070708_100000460 | Ga0070708_1000004605 | 150 |
| 175 | 3300005445 | Ga0070708_100011652 | Ga0070708_1000116525 | 150 |
| 176 | 3300005456 | Ga0070678_100007607 | Ga0070678_1000076076 | 150 |
| 177 | 3300005457 | Ga0070662_100051507 | Ga0070662_1000515071 | 150 |
| 178 | 3300005457 | Ga0070662_100962832 | Ga0070662_1009628322 | 150 |
| 179 | 3300005458 | Ga0070681_10208626 | Ga0070681_102086262 | 150 |
| 180 | 3300005459 | Ga0068867_100011563 | Ga0068867_1000115632 | 150 |
| 181 | 3300005467 | Ga0070706_100058150 | Ga0070706_1000581503 | 150 |
| 182 | 3300005467 | Ga0070706_100067456 | Ga0070706_1000674562 | 150 |
| 183 | 3300005467 | Ga0070706_100799857 | Ga0070706_1007998572 | 150 |
| 184 | 3300005468 | Ga0070707_100008282 | Ga0070707_1000082824 | 150 |
| 185 | 3300005468 | Ga0070707_100021828 | Ga0070707_1000218282 | 150 |
| 186 | 3300005468 | Ga0070707_100026419 | Ga0070707_1000264192 | 150 |
| 187 | 3300005468 | Ga0070707_100206770 | Ga0070707_1002067702 | 150 |
| 188 | 3300005471 | Ga0070698_100002476 | Ga0070698_10000247619 | 150 |
| 189 | 3300005471 | Ga0070698_100475316 | Ga0070698_1004753162 | 150 |
| 190 | 3300005518 | Ga0070699_100000738 | Ga0070699_10000073821 | 150 |
| 191 | 3300005518 | Ga0070699_100104232 | Ga0070699_1001042322 | 150 |
| 192 | 3300005535 | Ga0070684_100225020 | Ga0070684_1002250202 | 150 |
| 193 | 3300005536 | Ga0070697_100081515 | Ga0070697_1000815151 | 150 |
| 194 | 3300005539 | Ga0068853_100954443 | Ga0068853_1009544432 | 150 |
| 195 | 3300005543 | Ga0070672_101280690 | Ga0070672_1012806902 | 150 |
| 196 | 3300005544 | Ga0070686_100060182 | Ga0070686_1000601822 | 150 |
| 197 | 3300005544 | Ga0070686_100272257 | Ga0070686_1002722572 | 150 |
| 198 | 3300005544 | Ga0070686_100916403 | Ga0070686_1009164031 | 150 |
| 199 | 3300005545 | Ga0070695_100062695 | Ga0070695_1000626952 | 150 |
| 200 | 3300005545 | Ga0070695_100067486 | Ga0070695_1000674863 | 150 |
| 201 | 3300005545 | Ga0070695_100242445 | Ga0070695_1002424452 | 150 |
| 202 | 3300005546 | Ga0070696_100179830 | Ga0070696_1001798302 | 150 |
| 203 | 3300005547 | Ga0070693_100592163 | Ga0070693_1005921631 | 150 |
| 204 | 3300005548 | Ga0070665_101521467 | Ga0070665_1015214672 | 150 |
| 205 | 3300005549 | Ga0070704_100046421 | Ga0070704_1000464212 | 150 |
| 206 | 3300005563 | Ga0068855_100942747 | Ga0068855_1009427472 | 150 |
| 207 | 3300005564 | Ga0070664_100228315 | Ga0070664_1002283152 | 150 |
| 208 | 3300005578 | Ga0068854_100212769 | Ga0068854_1002127692 | 150 |
| 209 | 3300005614 | Ga0068856_100440799 | Ga0068856_1004407992 | 150 |
| 210 | 3300005614 | Ga0068856_102022221 | Ga0068856_1020222211 | 150 |
| 211 | 3300005615 | Ga0070702_100420185 | Ga0070702_1004201852 | 150 |
| 212 | 3300005718 | Ga0068866_10002078 | Ga0068866_100020787 | 150 |
| 213 | 3300005719 | Ga0068861_100064426 | Ga0068861_1000644262 | 150 |
| 214 | 3300005719 | Ga0068861_102437905 | Ga0068861_1024379051 | 150 |
| 215 | 3300005841 | Ga0068863_100209583 | Ga0068863_1002095832 | 150 |
| 216 | 3300005841 | Ga0068863_100595298 | Ga0068863_1005952982 | 150 |
| 217 | 3300005842 | Ga0068858_100022629 | Ga0068858_1000226294 | 150 |
| 218 | 3300005842 | Ga0068858_100050888 | Ga0068858_1000508882 | 150 |
| 219 | 3300005842 | Ga0068858_100224168 | Ga0068858_1002241682 | 150 |
| 220 | 3300005843 | Ga0068860_100018177 | Ga0068860_1000181773 | 150 |
| 221 | 3300005843 | Ga0068860_100048112 | Ga0068860_1000481123 | 150 |
| 222 | 3300005843 | Ga0068860_100098532 | Ga0068860_1000985322 | 150 |
| 223 | 3300005844 | Ga0068862_100058468 | Ga0068862_1000584684 | 150 |
| 224 | 3300005844 | Ga0068862_100367938 | Ga0068862_1003679382 | 150 |
| 225 | 3300006028 | Ga0070717_11516831 | Ga0070717_115168311 | 150 |
| 226 | 3300006163 | Ga0070715_10002149 | Ga0070715_100021493 | 150 |
| 227 | 3300006173 | Ga0070716_100001260 | Ga0070716_1000012604 | 150 |
| 228 | 3300006173 | Ga0070716_100068889 | Ga0070716_1000688892 | 150 |
| 229 | 3300006173 | Ga0070716_100155807 | Ga0070716_1001558072 | 150 |
| 230 | 3300006175 | Ga0070712_100000101 | Ga0070712_10000010112 | 150 |
| 231 | 3300006175 | Ga0070712_100629087 | Ga0070712_1006290872 | 150 |
| 232 | 3300006175 | Ga0070712_101245128 | Ga0070712_1012451281 | 150 |
| 233 | 3300006237 | Ga0097621_100093154 | Ga0097621_1000931541 | 150 |
| 234 | 3300006237 | Ga0097621_100561100 | Ga0097621_1005611002 | 150 |
| 235 | 3300006358 | Ga0068871_100011641 | Ga0068871_1000116412 | 150 |
| 236 | 3300006358 | Ga0068871_100306238 | Ga0068871_1003062382 | 150 |
| 237 | 3300006358 | Ga0068871_100862836 | Ga0068871_1008628362 | 150 |
| 238 | 3300006844 | Ga0075428_100269570 | Ga0075428_1002695702 | 150 |
| 239 | 3300006852 | Ga0075433_10002499 | Ga0075433_100024995 | 150 |
| 240 | 3300006852 | Ga0075433_10509491 | Ga0075433_105094912 | 150 |
| 241 | 3300006871 | Ga0075434_100001045 | Ga0075434_1000010456 | 150 |
| 242 | 3300006871 | Ga0075434_100111228 | Ga0075434_1001112282 | 150 |
| 243 | 3300006871 | Ga0075434_101177993 | Ga0075434_1011779932 | 150 |
| 244 | 3300006871 | Ga0075434_101228024 | Ga0075434_1012280242 | 150 |
| 245 | 3300006880 | Ga0075429_100055711 | Ga0075429_1000557113 | 150 |
| 246 | 3300006881 | Ga0068865_100009086 | Ga0068865_1000090862 | 150 |
| 247 | 3300006881 | Ga0068865_100092055 | Ga0068865_1000920552 | 150 |
| 248 | 3300006881 | Ga0068865_101141826 | Ga0068865_1011418262 | 150 |
| 249 | 3300006914 | Ga0075436_100021131 | Ga0075436_1000211312 | 150 |
| 250 | 3300006914 | Ga0075436_100255455 | Ga0075436_1002554552 | 150 |
| 251 | 3300007076 | Ga0075435_100002717 | Ga0075435_1000027178 | 150 |
| 252 | 3300007076 | Ga0075435_100085392 | Ga0075435_1000853923 | 150 |
| 253 | 3300007076 | Ga0075435_100346839 | Ga0075435_1003468392 | 150 |
| 254 | 3300009094 | Ga0111539_10098845 | Ga0111539_100988453 | 150 |
| 255 | 3300009098 | Ga0105245_10056336 | Ga0105245_100563364 | 150 |
| 256 | 3300009098 | Ga0105245_10065624 | Ga0105245_100656242 | 150 |
| 257 | 3300009147 | Ga0114129_10038495 | Ga0114129_100384957 | 150 |
| 258 | 3300009147 | Ga0114129_10127678 | Ga0114129_101276783 | 150 |
| 259 | 3300009147 | Ga0114129_10428847 | Ga0114129_104288472 | 150 |
| 260 | 3300009147 | Ga0114129_10749899 | Ga0114129_107498992 | 150 |
| 261 | 3300009147 | Ga0114129_11622730 | Ga0114129_116227302 | 150 |
| 262 | 3300009174 | Ga0105241_10404595 | Ga0105241_104045952 | 150 |
| 263 | 3300009176 | Ga0105242_10224326 | Ga0105242_102243262 | 150 |
| 264 | 3300009176 | Ga0105242_10695564 | Ga0105242_106955642 | 150 |
| 265 | 3300009177 | Ga0105248_10016667 | Ga0105248_100166677 | 150 |
| 266 | 3300009177 | Ga0105248_10036882 | Ga0105248_100368825 | 150 |
| 267 | 3300009177 | Ga0105248_10357966 | Ga0105248_103579662 | 150 |
| 268 | 3300009177 | Ga0105248_11895006 | Ga0105248_118950061 | 150 |
| 269 | 3300009545 | Ga0105237_11044359 | Ga0105237_110443591 | 150 |
| 270 | 3300009551 | Ga0105238_10653646 | Ga0105238_106536462 | 150 |
| 271 | 3300009553 | Ga0105249_10392952 | Ga0105249_103929522 | 150 |
| 272 | 3300009553 | Ga0105249_11606619 | Ga0105249_116066192 | 150 |
| 273 | 3300009553 | Ga0105249_12153503 | Ga0105249_121535031 | 150 |
| 274 | 3300010159 | Ga0099796_10035380 | Ga0099796_100353802 | 150 |
| 275 | 3300010375 | Ga0105239_10085771 | Ga0105239_100857712 | 150 |
| 276 | 3300010375 | Ga0105239_11515349 | Ga0105239_115153492 | 150 |
| 277 | 3300013102 | Ga0157371_10300641 | Ga0157371_103006412 | 150 |
| 278 | 3300013102 | Ga0157371_10693707 | Ga0157371_106937072 | 150 |
| 279 | 3300013296 | Ga0157374_10000377 | Ga0157374_100003775 | 150 |
| 280 | 3300013296 | Ga0157374_10016314 | Ga0157374_100163142 | 150 |
| 281 | 3300013297 | Ga0157378_10095327 | Ga0157378_100953272 | 150 |
| 282 | 3300013297 | Ga0157378_10138070 | Ga0157378_101380703 | 150 |
| 283 | 3300013297 | Ga0157378_11279824 | Ga0157378_112798241 | 150 |
| 284 | 3300013306 | Ga0163162_10010209 | Ga0163162_100102092 | 150 |
| 285 | 3300013306 | Ga0163162_10104064 | Ga0163162_101040643 | 150 |
| 286 | 3300013306 | Ga0163162_10663243 | Ga0163162_106632432 | 150 |
| 287 | 3300013306 | Ga0163162_10774869 | Ga0163162_107748691 | 150 |
| 288 | 3300013306 | Ga0163162_11887329 | Ga0163162_118873292 | 150 |
| 289 | 3300013307 | Ga0157372_10346555 | Ga0157372_103465551 | 150 |
| 290 | 3300013308 | Ga0157375_10131042 | Ga0157375_101310422 | 150 |
| 291 | 3300014325 | Ga0163163_11459019 | Ga0163163_114590192 | 150 |
| 292 | 3300014326 | Ga0157380_10534719 | Ga0157380_105347192 | 150 |
| 293 | 3300014326 | Ga0157380_12159399 | Ga0157380_121593991 | 150 |
| 294 | 3300014968 | Ga0157379_10074022 | Ga0157379_100740222 | 150 |
| 295 | 3300014968 | Ga0157379_10109045 | Ga0157379_101090452 | 150 |
| 296 | 3300014968 | Ga0157379_10182568 | Ga0157379_101825682 | 150 |
| 297 | 3300014969 | Ga0157376_10067517 | Ga0157376_100675173 | 150 |
| 298 | 3300014969 | Ga0157376_10178178 | Ga0157376_101781782 | 150 |
| 299 | 3300017792 | Ga0163161_10003925 | Ga0163161_100039257 | 150 |
| 300 | 3300021361 | Ga0213872_10178444 | Ga0213872_101784442 | 150 |
| 301 | 3300021361 | Ga0213872_10204747 | Ga0213872_102047472 | 150 |
| 302 | 3300021388 | Ga0213875_10048613 | Ga0213875_100486132 | 150 |
| 303 | 3300022732 | Ga0224569_114424 | Ga0224569_1144241 | 150 |
| 304 | 3300025899 | Ga0207642_10049755 | Ga0207642_100497552 | 150 |
| 305 | 3300025899 | Ga0207642_10281045 | Ga0207642_102810452 | 150 |
| 306 | 3300025903 | Ga0207680_10001385 | Ga0207680_100013853 | 150 |
| 307 | 3300025903 | Ga0207680_10572327 | Ga0207680_105723272 | 150 |
| 308 | 3300025904 | Ga0207647_10189229 | Ga0207647_101892292 | 150 |
| 309 | 3300025906 | Ga0207699_10060568 | Ga0207699_100605682 | 150 |
| 310 | 3300025907 | Ga0207645_10013377 | Ga0207645_100133773 | 150 |
| 311 | 3300025910 | Ga0207684_10001945 | Ga0207684_1000194513 | 150 |
| 312 | 3300025910 | Ga0207684_10222588 | Ga0207684_102225882 | 150 |
| 313 | 3300025910 | Ga0207684_11547747 | Ga0207684_115477471 | 150 |
| 314 | 3300025914 | Ga0207671_10292854 | Ga0207671_102928542 | 150 |
| 315 | 3300025914 | Ga0207671_10384643 | Ga0207671_103846432 | 150 |
| 316 | 3300025915 | Ga0207693_10000124 | Ga0207693_1000012449 | 150 |
| 317 | 3300025915 | Ga0207693_10079986 | Ga0207693_100799861 | 150 |
| 318 | 3300025915 | Ga0207693_10460575 | Ga0207693_104605752 | 150 |
| 319 | 3300025916 | Ga0207663_10043595 | Ga0207663_100435952 | 150 |
| 320 | 3300025916 | Ga0207663_10055534 | Ga0207663_100555342 | 150 |
| 321 | 3300025916 | Ga0207663_10296978 | Ga0207663_102969782 | 150 |
| 322 | 3300025918 | Ga0207662_10002895 | Ga0207662_100028955 | 150 |
| 323 | 3300025920 | Ga0207649_10165334 | Ga0207649_101653342 | 150 |
| 324 | 3300025922 | Ga0207646_10003115 | Ga0207646_1000311510 | 150 |
| 325 | 3300025922 | Ga0207646_10009119 | Ga0207646_100091197 | 150 |
| 326 | 3300025922 | Ga0207646_10041964 | Ga0207646_100419642 | 150 |
| 327 | 3300025922 | Ga0207646_10253483 | Ga0207646_102534833 | 150 |
| 328 | 3300025923 | Ga0207681_10127345 | Ga0207681_101273452 | 150 |
| 329 | 3300025923 | Ga0207681_10289088 | Ga0207681_102890882 | 150 |
| 330 | 3300025924 | Ga0207694_10188519 | Ga0207694_101885192 | 150 |
| 331 | 3300025927 | Ga0207687_10034284 | Ga0207687_100342844 | 150 |
| 332 | 3300025927 | Ga0207687_10122018 | Ga0207687_101220182 | 150 |
| 333 | 3300025928 | Ga0207700_10007287 | Ga0207700_100072877 | 150 |
| 334 | 3300025929 | Ga0207664_10411310 | Ga0207664_104113102 | 150 |
| 335 | 3300025931 | Ga0207644_10015295 | Ga0207644_100152956 | 150 |
| 336 | 3300025933 | Ga0207706_10002401 | Ga0207706_1000240114 | 150 |
| 337 | 3300025934 | Ga0207686_10599046 | Ga0207686_105990462 | 150 |
| 338 | 3300025934 | Ga0207686_11060857 | Ga0207686_110608572 | 150 |
| 339 | 3300025938 | Ga0207704_10080341 | Ga0207704_100803412 | 150 |
| 340 | 3300025938 | Ga0207704_10880733 | Ga0207704_108807332 | 150 |
| 341 | 3300025939 | Ga0207665_10001677 | Ga0207665_100016778 | 150 |
| 342 | 3300025939 | Ga0207665_10006349 | Ga0207665_100063495 | 150 |
| 343 | 3300025939 | Ga0207665_10015541 | Ga0207665_100155414 | 150 |
| 344 | 3300025939 | Ga0207665_10144972 | Ga0207665_101449722 | 150 |
| 345 | 3300025941 | Ga0207711_10682365 | Ga0207711_106823652 | 150 |
| 346 | 3300025941 | Ga0207711_11149225 | Ga0207711_111492252 | 150 |
| 347 | 3300025942 | Ga0207689_10001367 | Ga0207689_100013673 | 150 |
| 348 | 3300025942 | Ga0207689_10210681 | Ga0207689_102106812 | 150 |
| 349 | 3300025944 | Ga0207661_10012931 | Ga0207661_100129315 | 150 |
| 350 | 3300025945 | Ga0207679_10172787 | Ga0207679_101727872 | 150 |
| 351 | 3300025949 | Ga0207667_10134569 | Ga0207667_101345692 | 150 |
| 352 | 3300025961 | Ga0207712_10480551 | Ga0207712_104805512 | 150 |
| 353 | 3300025972 | Ga0207668_10688611 | Ga0207668_106886111 | 150 |
| 354 | 3300025981 | Ga0207640_10175842 | Ga0207640_101758422 | 150 |
| 355 | 3300026035 | Ga0207703_10030135 | Ga0207703_100301352 | 150 |
| 356 | 3300026035 | Ga0207703_10892257 | Ga0207703_108922572 | 150 |
| 357 | 3300026041 | Ga0207639_11360643 | Ga0207639_113606432 | 150 |
| 358 | 3300026067 | Ga0207678_10088375 | Ga0207678_100883752 | 150 |
| 359 | 3300026075 | Ga0207708_10087432 | Ga0207708_100874323 | 150 |
| 360 | 3300026078 | Ga0207702_10431438 | Ga0207702_104314382 | 150 |
| 361 | 3300026088 | Ga0207641_10080777 | Ga0207641_100807773 | 150 |
| 362 | 3300026088 | Ga0207641_10557045 | Ga0207641_105570451 | 150 |
| 363 | 3300026088 | Ga0207641_10700618 | Ga0207641_107006181 | 150 |
| 364 | 3300026089 | Ga0207648_10013759 | Ga0207648_100137595 | 150 |
| 365 | 3300026089 | Ga0207648_10057018 | Ga0207648_100570182 | 150 |
| 366 | 3300026118 | Ga0207675_100016104 | Ga0207675_1000161045 | 150 |
| 367 | 3300026118 | Ga0207675_100058993 | Ga0207675_1000589932 | 150 |
| 368 | 3300026118 | Ga0207675_100750929 | Ga0207675_1007509291 | 150 |
| 369 | 3300026118 | Ga0207675_102303598 | Ga0207675_1023035981 | 150 |
| 370 | 3300026121 | Ga0207683_10007606 | Ga0207683_100076065 | 150 |
| 371 | 3300027907 | Ga0207428_10042309 | Ga0207428_100423093 | 150 |
| 372 | 3300027907 | Ga0207428_10450273 | Ga0207428_104502731 | 150 |
| 373 | 3300028379 | Ga0268266_10001863 | Ga0268266_100018633 | 150 |
| 374 | 3300028380 | Ga0268265_10364961 | Ga0268265_103649612 | 150 |
| 375 | 3300028381 | Ga0268264_10109600 | Ga0268264_101096002 | 150 |
| 376 | 3300028381 | Ga0268264_10163536 | Ga0268264_101635362 | 150 |
| 377 | 3300028381 | Ga0268264_10656643 | Ga0268264_106566432 | 150 |
| 378 | 3300028381 | Ga0268264_10956037 | Ga0268264_109560372 | 150 |
| 379 | 3300028556 | Ga0265337_1005118 | Ga0265337_10051183 | 150 |
| 380 | 3300028666 | Ga0265336_10173352 | Ga0265336_101733521 | 150 |
| 381 | 3300028800 | Ga0265338_10481903 | Ga0265338_104819031 | 150 |
| 382 | 3300031240 | Ga0265320_10000566 | Ga0265320_100005663 | 150 |
| 383 | 3300035118 | Ga0373954_0169551 | Ga0373954_0169551_594_1052 | 150 |
| 384 | 3300035695 | Ga0373927_0404176 | Ga0373927_0404176_374_826 | 150 |
| 385 | 3300035695 | Ga0373927_0625606 | Ga0373927_0625606_64_522 | 150 |
| 386 | 3300035725 | Ga0373947_0148624 | Ga0373947_0148624_789_1247 | 150 |
| 387 | 3300035725 | Ga0373947_0203528 | Ga0373947_0203528_20_472 | 150 |
| 388 | 3300036647 | Ga0316582_0654955 | Ga0316582_0654955_103_561 | 150 |
| 389 | 3300037068 | Ga0373925_0042100 | Ga0373925_0042100_2903_3373 | 150 |
| 390 | 3300037068 | Ga0373925_0217581 | Ga0373925_0217581_317_769 | 150 |
| 391 | 3300037418 | Ga0395900_0227648 | Ga0395900_0227648_1209_1661 | 150 |
| 392 | 3300037418 | Ga0395900_0888325 | Ga0395900_0888325_47_511 | 150 |
| 393 | 3300037466 | Ga0395898_0702278 | Ga0395898_0702278_210_662 | 150 |
| 394 | 3300037466 | Ga0395898_1165701 | Ga0395898_1165701_138_602 | 150 |
| 395 | 3300037471 | Ga0395905_0038392 | Ga0395905_0038392_3501_3989 | 150 |
| 396 | 3300037471 | Ga0395905_0079656 | Ga0395905_0079656_2584_3036 | 150 |
| 397 | 3300037471 | Ga0395905_1035144 | Ga0395905_1035144_17_481 | 150 |
| 398 | 3300037853 | Ga0436364_0897119 | Ga0436364_0897119_1973_2431 | 150 |
| 399 | 3300038443 | Ga0395901_1059919 | Ga0395901_1059919_268_720 | 150 |
| 400 | 3300038443 | Ga0395901_1338498 | Ga0395901_1338498_131_619 | 150 |
| 401 | 3300039437 | Ga0436365_0197260 | Ga0436365_0197260_14578_15036 | 150 |
| 402 | 3300039438 | Ga0436360_0142918 | Ga0436360_0142918_599_1057 | 150 |
| 403 | 3300039447 | Ga0436361_0008440 | Ga0436361_0008440_2289_2747 | 150 |
| 404 | 3300039447 | Ga0436361_0205323 | Ga0436361_0205323_832_1290 | 150 |
| 405 | 3300039447 | Ga0436361_0704747 | Ga0436361_0704747_246_704 | 150 |
| 406 | 3300039447 | Ga0436361_0890240 | Ga0436361_0890240_937_1434 | 150 |
| 407 | 3300039450 | Ga0436363_0139442 | Ga0436363_0139442_387_851 | 150 |
| 408 | 3300039450 | Ga0436363_0333474 | Ga0436363_0333474_684_1172 | 150 |
| 409 | 3300039450 | Ga0436363_0531043 | Ga0436363_0531043_315_803 | 150 |
| 410 | 3300039453 | Ga0436362_0774554 | Ga0436362_0774554_518_976 | 150 |
| 411 | 3300042012 | Ga0439455_0094101 | Ga0439455_0094101_26_496 | 150 |
| 412 | 3300042461 | Ga0439460_0082915 | Ga0439460_0082915_472_924 | 150 |
| 413 | 3300042876 | Ga0451577_0036129 | Ga0451577_0036129_3306_3797 | 150 |
| 414 | 3300042876 | Ga0451577_0138762 | Ga0451577_0138762_393_857 | 150 |
| 415 | 3300044673 | Ga0453683_0003011 | Ga0453683_0003011_907_1398 | 150 |
| 416 | 3300044712 | Ga0453684_0034236 | Ga0453684_0034236_4456_4947 | 150 |
| 417 | 3300044712 | Ga0453684_0323151 | Ga0453684_0323151_459_923 | 150 |
| 418 | 3300045051 | Ga0451576_0019885 | Ga0451576_0019885_3518_4009 | 150 |
| 419 | 3300046472 | Ga0495580_0364433 | Ga0495580_0364433_66_518 | 150 |
| 420 | 3300046543 | Ga0495645_0000454 | Ga0495645_0000454_1164_1622 | 150 |
| 421 | 3300046543 | Ga0495645_0576456 | Ga0495645_0576456_93_581 | 150 |
| 422 | 3300046691 | Ga0495670_0038933 | Ga0495670_0038933_1559_2017 | 150 |
| 423 | 3300048904 | Ga0496101_0436426 | Ga0496101_0436426_331_819 | 150 |
| 424 | 3300048905 | Ga0496102_0004151 | Ga0496102_0004151_3807_4295 | 150 |
| 425 | 3300048906 | Ga0496103_0060343 | Ga0496103_0060343_1341_1829 | 150 |
| 426 | 3300048907 | Ga0496104_0028538 | Ga0496104_0028538_3105_3593 | 150 |
| 427 | 3300048907 | Ga0496104_0124897 | Ga0496104_0124897_550_1059 | 150 |
| 428 | 3300048909 | Ga0496106_0737840 | Ga0496106_0737840_97_585 | 150 |
| 429 | 3300048910 | Ga0496107_0082071 | Ga0496107_0082071_89_577 | 150 |
| 430 | 3300048915 | Ga0496112_0055928 | Ga0496112_0055928_2910_3398 | 150 |
| 431 | 3300048915 | Ga0496112_0125100 | Ga0496112_0125100_1884_2372 | 150 |
| 432 | 3300048915 | Ga0496112_0290841 | Ga0496112_0290841_416_904 | 150 |
| 433 | 3300048916 | Ga0496113_0125774 | Ga0496113_0125774_1205_1693 | 150 |
| 434 | 3300048916 | Ga0496113_1371378 | Ga0496113_1371378_20_508 | 150 |
| 435 | 3300050507 | nmdc:mga05p37_1168375_c1 | nmdc:mga05p37_1168375_c1_288_746 | 150 |
| 436 | 3300050507 | nmdc:mga05p37_450266_c1 | nmdc:mga05p37_450266_c1_26_532 | 150 |
| 437 | 3300050507 | nmdc:mga05p37_5636_c1 | nmdc:mga05p37_5636_c1_12962_13432 | 150 |
| 438 | 3300050507 | nmdc:mga05p37_702169_c1 | nmdc:mga05p37_702169_c1_163_618 | 150 |
| 439 | 3300050512 | nmdc:mga0n895_101298_c1 | nmdc:mga0n895_101298_c1_1005_1493 | 150 |
| 440 | 3300050512 | nmdc:mga0n895_1083_c1 | nmdc:mga0n895_1083_c1_5393_5881 | 150 |
| 441 | 3300050512 | nmdc:mga0n895_1445519_c1 | nmdc:mga0n895_1445519_c1_111_569 | 150 |
| 442 | 3300050512 | nmdc:mga0n895_21782_c1 | nmdc:mga0n895_21782_c1_4652_5119 | 150 |
| 443 | 3300050513 | nmdc:mga0rr50_19936_c1 | nmdc:mga0rr50_19936_c1_2838_3326 | 150 |
| 444 | 3300050513 | nmdc:mga0rr50_23174_c1 | nmdc:mga0rr50_23174_c1_1185_1673 | 150 |
| 445 | 3300050513 | nmdc:mga0rr50_464870_c1 | nmdc:mga0rr50_464870_c1_546_1013 | 150 |
| 446 | 3300050514 | nmdc:mga08x19_17553_c1 | nmdc:mga08x19_17553_c1_686_1174 | 150 |
| 447 | 3300050514 | nmdc:mga08x19_484309_c1 | nmdc:mga08x19_484309_c1_76_564 | 150 |
| 448 | 3300050515 | nmdc:mga0a205_1094376_c1 | nmdc:mga0a205_1094376_c1_51_503 | 150 |
| 449 | 3300050515 | nmdc:mga0a205_18702_c1 | nmdc:mga0a205_18702_c1_5885_6373 | 150 |
| 450 | 3300050515 | nmdc:mga0a205_6176_c1 | nmdc:mga0a205_6176_c1_8803_9291 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lfk-assembly1.cif.gz_B | crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form | 0.9655 | 1 | 142 |
| 1nn4-assembly1.cif.gz_A | structural genomics, rpib/alsb | 0.9616 | 2 | 146 |
| 1o1x-assembly1.cif.gz_A | crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution | 0.961 | 2 | 142 |
| 2vvr-assembly1.cif.gz_A | crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate | 0.96 | 2 | 147 |
| 3ph4-assembly1.cif.gz_A | clostridium thermocellum ribose-5-phosphate isomerase b with d-allose | 0.9593 | 1 | 147 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lfkB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9655 | 1 | 142 | 3.40.1400.10 |
| 1nn4D00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9605 | 2 | 147 | 3.40.1400.10 |
| 1o1xA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9545 | 2 | 142 | 3.40.1400.10 |
| 3s5pB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9543 | 1 | 130 | 3.40.1400.10 |
| 5ifzB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9504 | 1 | 129 | 3.40.1400.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V7VPN7-F1-model_v4 | 6-phosphogluconolactonase (EC 3.1.1.31) | 0.9946 | 2 | 142 |
GO:0005975
GO:0006098 GO:0016861 GO:0017057 |
| AF-A0A518D8V1-F1-model_v4 | 6-phosphogluconolactonase (EC 3.1.1.31) | 0.9885 | 1 | 146 |
GO:0005975
GO:0006098 GO:0016861 GO:0017057 |
| AF-A0A5C6D3P3-F1-model_v4 | Putative sugar phosphate isomerase YwlF (EC 5.3.1.-) | 0.988 | 2 | 146 |
GO:0005975
GO:0016861 |
| AF-A0A1G3ZJR7-F1-model_v4 | Ribose-5-phosphate isomerase | 0.987 | 1 | 146 |
GO:0005975
GO:0016861 |
| AF-A0A3A4VMN2-F1-model_v4 | Ribose 5-phosphate isomerase B (EC 5.3.1.6) | 0.9863 | 1 | 138 |
GO:0004751
GO:0005975 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar