metagRoot

F446530

General Info

Members	Datasets	Scaffolds	Average Seq Length
450	212	450	142

Family's Representative Sequence

Representative Sequence	3300005334\|Ga0068869_100351060\|Ga0068869_1003510602
Length	165
Sequence	MEIEYFKNAQPLRAAILFRRTKMAHVISTSDRITSVNTESITTAKPSYQAFQILRTAFTVAPIVAGLDKFFHLLVNWDQYLPAFVNKMTGGHGHELMLAVGVIEIVAGLGVAFKPRIFAYVVSAWLLLIVANLLMIPGYFDVALRDFGLSLGALALARLSQEYDR

Samples

	Sample ID	Description	Type	Environment
1	2162886006	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
4	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
5	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
6	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
8	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
9	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
10	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
11	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
12	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
13	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
14	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
15	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
16	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
20	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
21	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
22	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
23	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
26	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
33	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
34	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
35	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
36	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
37	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
38	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
39	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
40	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
41	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
42	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
43	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
44	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
52	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
53	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
54	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
55	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
56	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
57	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
58	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
61	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
62	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
63	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
64	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
65	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
66	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
67	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
68	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
69	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
70	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
71	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
72	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
74	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
75	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
77	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
78	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
79	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
80	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
81	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
82	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
83	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
84	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
85	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
86	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
87	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
88	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
89	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
90	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
91	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
92	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
93	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
94	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
95	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
96	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
97	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
98	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
99	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
100	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
147	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
150	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
151	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
152	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
153	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
154	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
155	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
156	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
157	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
158	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
159	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
160	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
161	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
162	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
163	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
164	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
165	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
166	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
167	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
168	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
169	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
170	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
171	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
172	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
173	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
174	3300049514	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought	Metagenome	Rhizosphere
175	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
176	3300049516	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought	Metagenome	Rhizosphere
177	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
178	3300049522	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control	Metagenome	Rhizosphere
179	3300049551	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
180	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
181	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
182	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
183	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
184	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
185	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
186	3300049656	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought	Metagenome	Rhizosphere
187	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
188	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
189	3300049667	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control	Metagenome	Rhizosphere
190	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
191	3300049670	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought	Metagenome	Rhizosphere
192	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
193	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
194	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
195	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
196	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
197	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
198	3300049758	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought	Metagenome	Rhizosphere
199	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
200	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
201	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
202	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
203	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
204	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
205	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
206	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
207	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
208	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
209	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
210	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
211	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
212	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.33
Metatranscriptomes	0.67
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	1.56
Rhizosphere	98.22
Stem	0
Stem Tuber	0
Unclassified	0.22

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL3b_contig_845003	2162886006	Unclassified	1551
2	SwRhRL2b_contig_247340	2162886007	Unclassified	2670
3	JGI24751J29686_10000104	3300002459	Bacteria	46525
4	JGI25406J46586_10052579	3300003203	Unclassified	1356
5	Ga0058859_11316573	3300004798	Unclassified	531
6	Ga0065714_10300741	3300005288	Unclassified	693
7	Ga0065704_10003860	3300005289	Bacteria	7478
8	Ga0065704_10087855	3300005289	Bacteria	2977
9	Ga0065712_10001203	3300005290	Bacteria	8144
10	Ga0065712_10002067	3300005290	Bacteria	6304
11	Ga0065715_10142326	3300005293	Bacteria	1835
12	Ga0065715_10721573	3300005293	Bacteria	641
13	Ga0065707_10003307	3300005295	Bacteria	5295
14	Ga0065707_10100760	3300005295	Bacteria	2892
15	Ga0070676_10016149	3300005328	Bacteria	4125
16	Ga0070676_10415230	3300005328	Unclassified	939
17	Ga0070676_10519913	3300005328	Bacteria	848
18	Ga0070670_100000159	3300005331	Bacteria	61313
19	Ga0070670_100076932	3300005331	Bacteria	2867
20	Ga0070670_100706842	3300005331	Unclassified	906
21	Ga0070670_101489324	3300005331	Unclassified	621
22	Ga0068869_100351060	3300005334	Bacteria	1202
23	Ga0068869_100562040	3300005334	Bacteria	960
24	Ga0068869_100857711	3300005334	Unclassified	784
25	Ga0070680_100110358	3300005336	Bacteria	2290
26	Ga0070680_100320409	3300005336	Unclassified	1316
27	Ga0070680_100566861	3300005336	Bacteria	974
28	Ga0070682_100011432	3300005337	Bacteria	5072
29	Ga0068868_100374904	3300005338	Bacteria	1223
30	Ga0068868_101678106	3300005338	Unclassified	598
31	Ga0070660_101496914	3300005339	Bacteria	574
32	Ga0070689_100000508	3300005340	Bacteria	22987
33	Ga0070689_100133545	3300005340	Bacteria	1992
34	Ga0070689_100158114	3300005340	Bacteria	1830
35	Ga0070689_100225519	3300005340	Bacteria	1539
36	Ga0070687_100942157	3300005343	Unclassified	622
37	Ga0070687_101085821	3300005343	Unclassified	585
38	Ga0070687_101301051	3300005343	Unclassified	540
39	Ga0070661_100653544	3300005344	Bacteria	854
40	Ga0070692_10019787	3300005345	Bacteria	3254
41	Ga0070692_10029010	3300005345	Unclassified	2756
42	Ga0070692_10266329	3300005345	Unclassified	1032
43	Ga0070692_10272368	3300005345	Bacteria	1023
44	Ga0070668_100261536	3300005347	Bacteria	1439
45	Ga0070669_100021847	3300005353	Bacteria	4575
46	Ga0070669_100146900	3300005353	Bacteria	1822
47	Ga0070669_101103195	3300005353	Unclassified	683
48	Ga0070669_101287954	3300005353	Bacteria	633
49	Ga0070675_100187441	3300005354	Unclassified	1791
50	Ga0070675_101970864	3300005354	Unclassified	539
51	Ga0070673_100668300	3300005364	Bacteria	952
52	Ga0070673_100857353	3300005364	Unclassified	841
53	Ga0070688_100071938	3300005365	Bacteria	2215
54	Ga0070688_100369844	3300005365	Unclassified	1054
55	Ga0070688_100661358	3300005365	Unclassified	805
56	Ga0070688_100984952	3300005365	Bacteria	669
57	Ga0070659_100307616	3300005366	Unclassified	1323
58	Ga0070705_100048360	3300005440	Unclassified	2463
59	Ga0070705_100147200	3300005440	Unclassified	1558
60	Ga0070705_100645240	3300005440	Bacteria	825
61	Ga0070705_100856250	3300005440	Unclassified	728
62	Ga0070705_101719911	3300005440	Unclassified	530
63	Ga0070700_100260922	3300005441	Bacteria	1248
64	Ga0070700_100534842	3300005441	Bacteria	908
65	Ga0070700_100723485	3300005441	Bacteria	794
66	Ga0070700_101224228	3300005441	Unclassified	628
67	Ga0070694_100010619	3300005444	Bacteria	5689
68	Ga0070694_100041646	3300005444	Bacteria	3065
69	Ga0070694_100091948	3300005444	Bacteria	2131
70	Ga0070694_100328663	3300005444	Unclassified	1179
71	Ga0070694_101353308	3300005444	Unclassified	600
72	Ga0070678_100775394	3300005456	Bacteria	869
73	Ga0070662_100583609	3300005457	Bacteria	939
74	Ga0070662_100877481	3300005457	Unclassified	765
75	Ga0068867_100457870	3300005459	Unclassified	1088
76	Ga0070706_100738444	3300005467	Bacteria	912
77	Ga0070707_100569368	3300005468	Unclassified	1095
78	Ga0070707_100879744	3300005468	Unclassified	860
79	Ga0070698_100016878	3300005471	Bacteria	7700
80	Ga0070699_100011193	3300005518	Bacteria	7752
81	Ga0070699_100011383	3300005518	Bacteria	7679
82	Ga0070699_100369560	3300005518	Unclassified	1294
83	Ga0070679_100652521	3300005530	Bacteria	995
84	Ga0070697_100000466	3300005536	Bacteria	30951
85	Ga0070697_100131685	3300005536	Bacteria	2098
86	Ga0070697_100341509	3300005536	Bacteria	1292
87	Ga0068853_100360287	3300005539	Bacteria	1354
88	Ga0070672_100127186	3300005543	Unclassified	2091
89	Ga0070672_100348500	3300005543	Unclassified	1262
90	Ga0070695_100438030	3300005545	Bacteria	999
91	Ga0070696_100018114	3300005546	Bacteria	4757
92	Ga0070696_100194800	3300005546	Unclassified	1510
93	Ga0070696_100312303	3300005546	Unclassified	1207
94	Ga0070696_100329829	3300005546	Unclassified	1177
95	Ga0070696_100730863	3300005546	Bacteria	809
96	Ga0070693_100016770	3300005547	Bacteria	3796
97	Ga0070704_100086834	3300005549	Bacteria	2320
98	Ga0070704_100370648	3300005549	Unclassified	1214
99	Ga0070704_100608902	3300005549	Unclassified	961
100	Ga0070704_100934262	3300005549	Unclassified	782
101	Ga0068855_100348050	3300005563	Unclassified	1633
102	Ga0068855_101607770	3300005563	Bacteria	665
103	Ga0070664_100801922	3300005564	Unclassified	880
104	Ga0070664_100842827	3300005564	Unclassified	858
105	Ga0070664_100901352	3300005564	Unclassified	829
106	Ga0070664_101285014	3300005564	Unclassified	691
107	Ga0068857_100294843	3300005577	Bacteria	1494
108	Ga0068857_101878151	3300005577	Unclassified	587
109	Ga0068854_100215115	3300005578	Unclassified	1518
110	Ga0068854_100393680	3300005578	Unclassified	1145
111	Ga0068854_100438106	3300005578	Bacteria	1089
112	Ga0070702_100034869	3300005615	Bacteria	2777
113	Ga0068852_100259276	3300005616	Bacteria	1669
114	Ga0068852_100844904	3300005616	Unclassified	931
115	Ga0068852_100965557	3300005616	Bacteria	870
116	Ga0068859_100024800	3300005617	Bacteria	6018
117	Ga0068859_100041721	3300005617	Bacteria	4609
118	Ga0068859_100045818	3300005617	Bacteria	4392
119	Ga0068859_100053047	3300005617	Bacteria	4077
120	Ga0068859_100053114	3300005617	Bacteria	4074
121	Ga0068859_100087993	3300005617	Bacteria	3155
122	Ga0068859_100140432	3300005617	Unclassified	2489
123	Ga0068859_100293532	3300005617	Bacteria	1719
124	Ga0068859_100340143	3300005617	Bacteria	1595
125	Ga0068859_100612641	3300005617	Bacteria	1181
126	Ga0068859_100788574	3300005617	Bacteria	1038
127	Ga0068859_101037082	3300005617	Bacteria	901
128	Ga0068864_100017765	3300005618	Bacteria	5933
129	Ga0068864_100036229	3300005618	Bacteria	4204
130	Ga0068864_100213831	3300005618	Bacteria	1776
131	Ga0068864_100896066	3300005618	Unclassified	876
132	Ga0068864_100900530	3300005618	Unclassified	874
133	Ga0068864_100921164	3300005618	Unclassified	864
134	Ga0068866_10522864	3300005718	Unclassified	789
135	Ga0068861_100053582	3300005719	Bacteria	3070
136	Ga0068861_100396746	3300005719	Unclassified	1223
137	Ga0068861_100410050	3300005719	Unclassified	1205
138	Ga0068851_10130288	3300005834	Unclassified	1360
139	Ga0068870_10052741	3300005840	Bacteria	2157
140	Ga0068870_10061530	3300005840	Bacteria	2019
141	Ga0068870_10259877	3300005840	Unclassified	1080
142	Ga0068870_10635649	3300005840	Unclassified	729
143	Ga0068863_100319958	3300005841	Bacteria	1507
144	Ga0068863_100569887	3300005841	Unclassified	1119
145	Ga0068863_100705942	3300005841	Unclassified	1003
146	Ga0068858_100046986	3300005842	Bacteria	4003
147	Ga0068858_100129790	3300005842	Bacteria	2362
148	Ga0068858_101540971	3300005842	Unclassified	656
149	Ga0068860_100024799	3300005843	Bacteria	5792
150	Ga0068860_100077052	3300005843	Bacteria	3170
151	Ga0068860_100475693	3300005843	Unclassified	1245
152	Ga0068862_100138241	3300005844	Bacteria	2161
153	Ga0068862_100209127	3300005844	Bacteria	1763
154	Ga0068862_100319869	3300005844	Unclassified	1432
155	Ga0068862_100649831	3300005844	Bacteria	1017
156	Ga0081455_10164834	3300005937	Unclassified	1694
157	Ga0081539_10001671	3300005985	Bacteria	35893
158	Ga0070716_100022967	3300006173	Bacteria	3302
159	Ga0075428_100005901	3300006844	Bacteria	13609
160	Ga0075428_100048643	3300006844	Bacteria	4654
161	Ga0075428_100110852	3300006844	Bacteria	2990
162	Ga0075428_100148139	3300006844	Bacteria	2551
163	Ga0075428_100178282	3300006844	Bacteria	2301
164	Ga0075428_100559979	3300006844	Bacteria	1222
165	Ga0075428_100865730	3300006844	Bacteria	959
166	Ga0075428_101557156	3300006844	Unclassified	692
167	Ga0075430_100026185	3300006846	Bacteria	4963
168	Ga0075430_100119848	3300006846	Bacteria	2193
169	Ga0075430_100123671	3300006846	Bacteria	2156
170	Ga0075431_100029239	3300006847	Bacteria	5670
171	Ga0075431_100100618	3300006847	Bacteria	2982
172	Ga0075431_100112217	3300006847	Bacteria	2814
173	Ga0075431_100214463	3300006847	Bacteria	1965
174	Ga0075431_101484506	3300006847	Unclassified	637
175	Ga0075433_10062817	3300006852	Bacteria	3253
176	Ga0075433_10296332	3300006852	Bacteria	1432
177	Ga0075433_10348882	3300006852	Bacteria	1308
178	Ga0075433_10447569	3300006852	Unclassified	1139
179	Ga0075434_100146297	3300006871	Bacteria	2383
180	Ga0075429_100120257	3300006880	Bacteria	2296
181	Ga0075429_100146992	3300006880	Unclassified	2063
182	Ga0075429_100179898	3300006880	Unclassified	1853
183	Ga0075429_100244602	3300006880	Bacteria	1571
184	Ga0075429_101440485	3300006880	Unclassified	600
185	Ga0068865_101332279	3300006881	Unclassified	639
186	Ga0097620_100024801	3300006931	Bacteria	6018
187	Ga0097620_100041721	3300006931	Bacteria	4609
188	Ga0097620_100045818	3300006931	Bacteria	4392
189	Ga0097620_100053047	3300006931	Bacteria	4077
190	Ga0097620_100053113	3300006931	Bacteria	4074
191	Ga0097620_100087993	3300006931	Bacteria	3155
192	Ga0097620_100140429	3300006931	Unclassified	2489
193	Ga0097620_100293541	3300006931	Bacteria	1719
194	Ga0097620_100340150	3300006931	Bacteria	1595
195	Ga0097620_100612630	3300006931	Bacteria	1181
196	Ga0097620_100788576	3300006931	Bacteria	1038
197	Ga0097620_101037283	3300006931	Bacteria	901
198	Ga0105250_10180942	3300009092	Bacteria	885
199	Ga0105240_10010742	3300009093	Bacteria	12844
200	Ga0105240_10847096	3300009093	Bacteria	987
201	Ga0105240_11690629	3300009093	Unclassified	661
202	Ga0111539_10020622	3300009094	Bacteria	8117
203	Ga0111539_10024213	3300009094	Bacteria	7454
204	Ga0111539_10102466	3300009094	Unclassified	3360
205	Ga0105245_11397450	3300009098	Unclassified	750
206	Ga0105247_10028605	3300009101	Bacteria	3373
207	Ga0114129_10070376	3300009147	Bacteria	4878
208	Ga0114129_10133954	3300009147	Bacteria	3401
209	Ga0114129_10307517	3300009147	Unclassified	2111
210	Ga0105243_10261509	3300009148	Bacteria	1550
211	Ga0105243_10438076	3300009148	Unclassified	1223
212	Ga0105241_10061243	3300009174	Unclassified	2898
213	Ga0105241_10136487	3300009174	Bacteria	1992
214	Ga0105241_10148724	3300009174	Bacteria	1914
215	Ga0105241_10249345	3300009174	Unclassified	1504
216	Ga0105241_10279225	3300009174	Bacteria	1426
217	Ga0105241_10429595	3300009174	Unclassified	1164
218	Ga0105241_10665076	3300009174	Bacteria	947
219	Ga0105241_10769892	3300009174	Unclassified	884
220	Ga0105241_11146145	3300009174	Unclassified	734
221	Ga0105242_10268536	3300009176	Bacteria	1544
222	Ga0105248_10068075	3300009177	Bacteria	3998
223	Ga0105248_10131577	3300009177	Bacteria	2823
224	Ga0105248_10508691	3300009177	Bacteria	1358
225	Ga0105248_10584538	3300009177	Bacteria	1260
226	Ga0105248_10961349	3300009177	Bacteria	965
227	Ga0105248_11888814	3300009177	Unclassified	678
228	Ga0105237_10004423	3300009545	Bacteria	16288
229	Ga0105238_10563139	3300009551	Bacteria	1145
230	Ga0105249_10002693	3300009553	Bacteria	15358
231	Ga0105239_10835092	3300010375	Bacteria	1056
232	Ga0105246_10077146	3300011119	Bacteria	2363
233	Ga0157373_10008338	3300013100	Bacteria	7698
234	Ga0157373_10139090	3300013100	Bacteria	1707
235	Ga0157373_10770947	3300013100	Unclassified	708
236	Ga0157378_10029644	3300013297	Unclassified	4832
237	Ga0157378_10552353	3300013297	Unclassified	1157
238	Ga0163162_10042928	3300013306	Bacteria	4527
239	Ga0163162_10164842	3300013306	Bacteria	2340
240	Ga0163162_10257011	3300013306	Unclassified	1878
241	Ga0163162_10678476	3300013306	Bacteria	1153
242	Ga0163162_11096329	3300013306	Bacteria	902
243	Ga0163162_13443098	3300013306	Unclassified	504
244	Ga0157372_10033294	3300013307	Bacteria	5658
245	Ga0157372_11735028	3300013307	Unclassified	718
246	Ga0157372_11887077	3300013307	Unclassified	687
247	Ga0157375_10015150	3300013308	Bacteria	6896
248	Ga0157375_10193714	3300013308	Bacteria	2187
249	Ga0157375_10669345	3300013308	Unclassified	1193
250	Ga0157375_10698822	3300013308	Unclassified	1168
251	Ga0163163_10002062	3300014325	Bacteria	16976
252	Ga0163163_10002406	3300014325	Bacteria	15837
253	Ga0163163_10065466	3300014325	Bacteria	3608
254	Ga0157380_10070115	3300014326	Bacteria	2831
255	Ga0157377_10109894	3300014745	Unclassified	1656
256	Ga0157377_11372032	3300014745	Unclassified	556
257	Ga0157379_10111698	3300014968	Unclassified	2455
258	Ga0163161_10514158	3300017792	Bacteria	977
259	Ga0206356_10032938	3300020070	Unclassified	668
260	Ga0213873_10065614	3300021358	Bacteria	991
261	Ga0207656_10099144	3300025321	Unclassified	1333
262	Ga0207653_10000576	3300025885	Bacteria	13175
263	Ga0207682_10225107	3300025893	Bacteria	868
264	Ga0207642_10392598	3300025899	Bacteria	828
265	Ga0207710_10000680	3300025900	Bacteria	19152
266	Ga0207710_10515266	3300025900	Unclassified	621
267	Ga0207688_10294967	3300025901	Unclassified	990
268	Ga0207647_10072191	3300025904	Bacteria	2082
269	Ga0207647_10108812	3300025904	Bacteria	1640
270	Ga0207647_10393874	3300025904	Unclassified	781
271	Ga0207645_10955571	3300025907	Bacteria	581
272	Ga0207643_10006933	3300025908	Bacteria	6076
273	Ga0207643_10061733	3300025908	Bacteria	2141
274	Ga0207643_10352614	3300025908	Bacteria	924
275	Ga0207643_10404131	3300025908	Unclassified	864
276	Ga0207654_10120153	3300025911	Bacteria	1649
277	Ga0207695_10036933	3300025913	Bacteria	5275
278	Ga0207671_10003336	3300025914	Bacteria	16127
279	Ga0207660_10005726	3300025917	Bacteria	8063
280	Ga0207660_10669272	3300025917	Unclassified	846
281	Ga0207662_10055814	3300025918	Bacteria	2357
282	Ga0207657_10264125	3300025919	Bacteria	1369
283	Ga0207649_10601882	3300025920	Bacteria	845
284	Ga0207649_11189362	3300025920	Bacteria	602
285	Ga0207681_10028133	3300025923	Bacteria	3640
286	Ga0207681_10275495	3300025923	Bacteria	1323
287	Ga0207650_10000007	3300025925	Bacteria	530810
288	Ga0207650_10077157	3300025925	Bacteria	2518
289	Ga0207650_10233482	3300025925	Bacteria	1484
290	Ga0207659_10218569	3300025926	Bacteria	1531
291	Ga0207659_10356371	3300025926	Bacteria	1215
292	Ga0207690_10542716	3300025932	Bacteria	944
293	Ga0207690_10654541	3300025932	Bacteria	861
294	Ga0207706_10070197	3300025933	Bacteria	3081
295	Ga0207706_10375449	3300025933	Unclassified	1234
296	Ga0207686_10078620	3300025934	Bacteria	2145
297	Ga0207709_10081293	3300025935	Bacteria	2089
298	Ga0207670_10000512	3300025936	Bacteria	21354
299	Ga0207670_10239685	3300025936	Bacteria	1397
300	Ga0207670_10673768	3300025936	Unclassified	854
301	Ga0207665_10073965	3300025939	Bacteria	2332
302	Ga0207691_10106382	3300025940	Bacteria	2499
303	Ga0207691_10337030	3300025940	Bacteria	1291
304	Ga0207711_10008512	3300025941	Bacteria	8582
305	Ga0207711_10270771	3300025941	Bacteria	1562
306	Ga0207711_10488874	3300025941	Unclassified	1147
307	Ga0207711_10516408	3300025941	Bacteria	1114
308	Ga0207689_10166897	3300025942	Bacteria	1814
309	Ga0207689_10271167	3300025942	Bacteria	1405
310	Ga0207689_10393062	3300025942	Bacteria	1155
311	Ga0207689_11136977	3300025942	Bacteria	658
312	Ga0207679_10854926	3300025945	Unclassified	831
313	Ga0207679_10889836	3300025945	Unclassified	814
314	Ga0207667_10153724	3300025949	Unclassified	2368
315	Ga0207651_11121204	3300025960	Unclassified	705
316	Ga0207651_11558203	3300025960	Unclassified	595
317	Ga0207712_10094195	3300025961	Unclassified	2212
318	Ga0207668_11783259	3300025972	Bacteria	555
319	Ga0207640_10292851	3300025981	Unclassified	1284
320	Ga0207640_10484937	3300025981	Unclassified	1026
321	Ga0207658_10735772	3300025986	Bacteria	893
322	Ga0207677_10346319	3300026023	Bacteria	1243
323	Ga0207677_10928017	3300026023	Bacteria	786
324	Ga0207703_10208012	3300026035	Bacteria	1743
325	Ga0207703_10218035	3300026035	Bacteria	1704
326	Ga0207639_10182101	3300026041	Bacteria	1788
327	Ga0207639_11369122	3300026041	Unclassified	664
328	Ga0207708_10097473	3300026075	Bacteria	2272
329	Ga0207708_10141072	3300026075	Bacteria	1890
330	Ga0207708_10509449	3300026075	Bacteria	1010
331	Ga0207708_10611133	3300026075	Unclassified	924
332	Ga0207641_10024746	3300026088	Bacteria	4948
333	Ga0207641_10646102	3300026088	Unclassified	1039
334	Ga0207641_11687235	3300026088	Unclassified	635
335	Ga0207648_10114687	3300026089	Bacteria	2367
336	Ga0207648_10312051	3300026089	Bacteria	1412
337	Ga0207648_10715610	3300026089	Bacteria	928
338	Ga0207648_10839680	3300026089	Unclassified	856
339	Ga0207676_10002353	3300026095	Bacteria	13506
340	Ga0207676_10110143	3300026095	Bacteria	2303
341	Ga0207674_10563447	3300026116	Bacteria	1100
342	Ga0207674_10831912	3300026116	Unclassified	890
343	Ga0207674_10960672	3300026116	Unclassified	823
344	Ga0207675_100009005	3300026118	Bacteria	9365
345	Ga0207675_100302086	3300026118	Unclassified	1559
346	Ga0207683_10767243	3300026121	Unclassified	895
347	Ga0207698_10132022	3300026142	Bacteria	2136
348	Ga0207698_10771612	3300026142	Unclassified	962
349	Ga0207698_10942029	3300026142	Bacteria	872
350	Ga0207428_10091723	3300027907	Bacteria	2358
351	Ga0268265_10758885	3300028380	Unclassified	942
352	Ga0268264_10056099	3300028381	Bacteria	3292
353	Ga0268264_10271678	3300028381	Bacteria	1584
354	Ga0268264_10282681	3300028381	Bacteria	1555
355	Ga0268264_10298620	3300028381	Bacteria	1515
356	Ga0268264_10366278	3300028381	Unclassified	1376
357	Ga0316183_1174873	3300030742	Bacteria	518
358	Ga0307408_100053363	3300031548	Bacteria	2919
359	Ga0307408_100251766	3300031548	Bacteria	1457
360	Ga0307405_10013353	3300031731	Bacteria	4379
361	Ga0307413_10006264	3300031824	Bacteria	5406
362	Ga0307410_10003849	3300031852	Bacteria	7628
363	Ga0307406_10015094	3300031901	Unclassified	4462
364	Ga0307407_10030425	3300031903	Bacteria	2912
365	Ga0307412_10022333	3300031911	Bacteria	3878
366	Ga0307409_100094434	3300031995	Bacteria	2461
367	Ga0307409_100323601	3300031995	Bacteria	1444
368	Ga0307416_100091845	3300032002	Bacteria	2609
369	Ga0307416_100643088	3300032002	Bacteria	1145
370	Ga0307416_102571651	3300032002	Bacteria	607
371	Ga0307415_100058780	3300032126	Bacteria	2648
372	Ga0307415_100864549	3300032126	Bacteria	831
373	Ga0307415_100962459	3300032126	Bacteria	791
374	Ga0373930_0143789	3300034816	Unclassified	594
375	Ga0373949_0197385	3300035090	Unclassified	603
376	Ga0373951_0038410	3300035091	Unclassified	1148
377	Ga0373931_1063233	3300035691	Bacteria	550
378	Ga0395900_0050817	3300037418	Bacteria	4270
379	Ga0395900_0633678	3300037418	Bacteria	1007
380	Ga0395898_0490965	3300037466	Bacteria	1168
381	Ga0395905_0003438	3300037471	Bacteria	16945
382	Ga0395905_0183581	3300037471	Unclassified	1964
383	Ga0439442_075844	3300042002	Bacteria	718
384	Ga0439455_0252053	3300042012	Unclassified	517
385	Ga0451576_1351969	3300045051	Unclassified	742
386	Ga0451576_1398605	3300045051	Bacteria	728
387	Ga0451576_1526506	3300045051	Unclassified	694
388	Ga0496102_1009207	3300048905	Bacteria	753
389	Ga0496103_0271935	3300048906	Bacteria	1090
390	Ga0496103_0437944	3300048906	Bacteria	839
391	Ga0496112_0049106	3300048915	Bacteria	4136
392	Ga0496112_0394662	3300048915	Unclassified	1324
393	Ga0496112_0699318	3300048915	Bacteria	942
394	Ga0496113_0076019	3300048916	Unclassified	2564
395	Ga0501291_030154	3300049514	Bacteria	911
396	Ga0501292_051841	3300049515	Bacteria	729
397	Ga0501293_012166	3300049516	Bacteria	761
398	Ga0501298_169633	3300049521	Bacteria	542
399	Ga0501299_062201	3300049522	Unclassified	793
400	Ga0501335_040413	3300049551	Bacteria	549
401	Ga0501039_0139264	3300049575	Bacteria	1906
402	Ga0501041_0360091	3300049577	Bacteria	920
403	Ga0501042_1134057	3300049578	Unclassified	570
404	Ga0501046_0228793	3300049580	Unclassified	1375
405	Ga0501198_034766	3300049649	Bacteria	854
406	Ga0501202_206587	3300049652	Bacteria	539
407	Ga0501209_192209	3300049656	Bacteria	626
408	Ga0501217_207573	3300049661	Unclassified	613
409	Ga0501223_046379	3300049663	Bacteria	843
410	Ga0501230_167160	3300049667	Unclassified	504
411	Ga0501233_087237	3300049668	Bacteria	810
412	Ga0501236_014889	3300049670	Bacteria	1083
413	Ga0501239_008150	3300049672	Bacteria	1114
414	Ga0501249_012700	3300049679	Bacteria	1783
415	Ga0501253_131451	3300049683	Bacteria	616
416	Ga0501257_021887	3300049686	Bacteria	1510
417	Ga0501225_0132656	3300049705	Bacteria	747
418	Ga0501234_027738	3300049707	Bacteria	911
419	Ga0501234_055772	3300049707	Bacteria	663
420	Ga0501241_031564	3300049758	Bacteria	1003
421	Ga0501241_046149	3300049758	Bacteria	853
422	Ga0501268_176559	3300049765	Unclassified	506
423	Ga0501273_066508	3300049770	Bacteria	577
424	Ga0501279_017074	3300049775	Bacteria	1015
425	nmdc:mga05p37_235004_c1	3300050507	Bacteria	2207
426	nmdc:mga05p37_352664_c1	3300050507	Unclassified	1732
427	nmdc:mga09592_116104_c1	3300050508	Unclassified	2297
428	nmdc:mga09592_186482_c1	3300050508	Unclassified	1795
429	nmdc:mga09592_311390_c1	3300050508	Bacteria	1364
430	nmdc:mga09592_351297_c1	3300050508	Unclassified	1276
431	nmdc:mga0qj67_250551_c1	3300050509	Bacteria	1437
432	nmdc:mga0qj67_73639_c1	3300050509	Bacteria	2728
433	nmdc:mga06r32_1043076_c1	3300050510	Unclassified	769
434	nmdc:mga06r32_18063_c1	3300050510	Bacteria	6450
435	nmdc:mga06r32_182092_c1	3300050510	Unclassified	2087
436	nmdc:mga06r32_357028_c1	3300050510	Bacteria	1446
437	nmdc:mga06r32_424432_c1	3300050510	Unclassified	1311
438	nmdc:mga06r32_578194_c1	3300050510	Unclassified	1096
439	nmdc:mga08y16_317789_c1	3300050511	Bacteria	1603
440	nmdc:mga0n895_328051_c1	3300050512	Unclassified	1551
441	nmdc:mga0n895_934663_c1	3300050512	Unclassified	851
442	nmdc:mga0rr50_310804_c1	3300050513	Unclassified	1320
443	nmdc:mga0a205_109436_c1	3300050515	Unclassified	1215
444	nmdc:mga0a205_233793_c1	3300050515	Bacteria	1720
445	nmdc:mga0a205_457895_c1	3300050515	Unclassified	1135
446	nmdc:mga0a205_64024_c1	3300050515	Bacteria	3552
447	Ga0501084_0015200	3300054114	Bacteria	6383
448	Ga0501084_1339586	3300054114	Unclassified	600
449	Ga0501082_0267165	3300060353	Bacteria	1489
450	Ga0530510_0978590	3300061734	Unclassified	647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026089	Ga0207648_10312051	Ga0207648_103120512	131
2	3300009147	Ga0114129_10070376	Ga0114129_100703761	132
3	3300009174	Ga0105241_10148724	Ga0105241_101487242	132
4	3300009551	Ga0105238_10563139	Ga0105238_105631392	132
5	3300020070	Ga0206356_10032938	Ga0206356_100329382	132
6	3300035090	Ga0373949_0197385	Ga0373949_0197385_118_525	132
7	3300050507	nmdc:mga05p37_352664_c1	nmdc:mga05p37_352664_c1_132_536	132
8	3300050508	nmdc:mga09592_186482_c1	nmdc:mga09592_186482_c1_1265_1669	132
9	3300050509	nmdc:mga0qj67_250551_c1	nmdc:mga0qj67_250551_c1_822_1226	132
10	3300050510	nmdc:mga06r32_424432_c1	nmdc:mga06r32_424432_c1_97_501	132
11	3300005456	Ga0070678_100775394	Ga0070678_1007753941	133
12	3300025893	Ga0207682_10225107	Ga0207682_102251071	133
13	3300026121	Ga0207683_10767243	Ga0207683_107672432	133
14	3300025942	Ga0207689_11136977	Ga0207689_111369771	135
15	3300013306	Ga0163162_10042928	Ga0163162_100429282	136
16	3300013308	Ga0157375_10193714	Ga0157375_101937143	136
17	3300005440	Ga0070705_100147200	Ga0070705_1001472002	138
18	3300006844	Ga0075428_100005901	Ga0075428_1000059013	138
19	3300006852	Ga0075433_10348882	Ga0075433_103488822	138
20	3300009174	Ga0105241_11146145	Ga0105241_111461451	138
21	3300013308	Ga0157375_10669345	Ga0157375_106693452	138
22	3300050510	nmdc:mga06r32_578194_c1	nmdc:mga06r32_578194_c1_445_864	138
23	3300005289	Ga0065704_10087855	Ga0065704_100878554	139
24	3300005295	Ga0065707_10100760	Ga0065707_101007602	139
25	3300005440	Ga0070705_100856250	Ga0070705_1008562501	139
26	3300005468	Ga0070707_100569368	Ga0070707_1005693682	139
27	3300005471	Ga0070698_100016878	Ga0070698_1000168783	139
28	3300005518	Ga0070699_100011193	Ga0070699_1000111933	139
29	3300005536	Ga0070697_100000466	Ga0070697_10000046612	139
30	3300005546	Ga0070696_100018114	Ga0070696_1000181142	139
31	3300002459	JGI24751J29686_10000104	JGI24751J29686_1000010415	140
32	3300004798	Ga0058859_11316573	Ga0058859_113165731	140
33	3300005290	Ga0065712_10002067	Ga0065712_100020675	140
34	3300005293	Ga0065715_10721573	Ga0065715_107215731	140
35	3300005328	Ga0070676_10415230	Ga0070676_104152302	140
36	3300005328	Ga0070676_10519913	Ga0070676_105199132	140
37	3300005331	Ga0070670_100000159	Ga0070670_10000015912	140
38	3300005331	Ga0070670_100076932	Ga0070670_1000769322	140
39	3300005331	Ga0070670_100706842	Ga0070670_1007068421	140
40	3300005334	Ga0068869_100562040	Ga0068869_1005620402	140
41	3300005336	Ga0070680_100320409	Ga0070680_1003204092	140
42	3300005336	Ga0070680_100566861	Ga0070680_1005668612	140
43	3300005339	Ga0070660_101496914	Ga0070660_1014969141	140
44	3300005340	Ga0070689_100000508	Ga0070689_1000005083	140
45	3300005340	Ga0070689_100133545	Ga0070689_1001335452	140
46	3300005340	Ga0070689_100158114	Ga0070689_1001581142	140
47	3300005340	Ga0070689_100225519	Ga0070689_1002255192	140
48	3300005343	Ga0070687_101085821	Ga0070687_1010858212	140
49	3300005343	Ga0070687_101301051	Ga0070687_1013010511	140
50	3300005344	Ga0070661_100653544	Ga0070661_1006535442	140
51	3300005345	Ga0070692_10029010	Ga0070692_100290102	140
52	3300005345	Ga0070692_10272368	Ga0070692_102723682	140
53	3300005347	Ga0070668_100261536	Ga0070668_1002615363	140
54	3300005353	Ga0070669_100021847	Ga0070669_1000218474	140
55	3300005353	Ga0070669_100146900	Ga0070669_1001469002	140
56	3300005353	Ga0070669_101287954	Ga0070669_1012879541	140
57	3300005354	Ga0070675_101970864	Ga0070675_1019708641	140
58	3300005364	Ga0070673_100857353	Ga0070673_1008573532	140
59	3300005365	Ga0070688_100071938	Ga0070688_1000719382	140
60	3300005366	Ga0070659_100307616	Ga0070659_1003076161	140
61	3300005440	Ga0070705_100645240	Ga0070705_1006452401	140
62	3300005441	Ga0070700_100534842	Ga0070700_1005348422	140
63	3300005441	Ga0070700_100723485	Ga0070700_1007234852	140
64	3300005441	Ga0070700_101224228	Ga0070700_1012242281	140
65	3300005444	Ga0070694_100091948	Ga0070694_1000919482	140
66	3300005444	Ga0070694_101353308	Ga0070694_1013533081	140
67	3300005457	Ga0070662_100877481	Ga0070662_1008774811	140
68	3300005459	Ga0068867_100457870	Ga0068867_1004578701	140
69	3300005467	Ga0070706_100738444	Ga0070706_1007384442	140
70	3300005468	Ga0070707_100879744	Ga0070707_1008797442	140
71	3300005518	Ga0070699_100011383	Ga0070699_1000113837	140
72	3300005530	Ga0070679_100652521	Ga0070679_1006525212	140
73	3300005539	Ga0068853_100360287	Ga0068853_1003602872	140
74	3300005545	Ga0070695_100438030	Ga0070695_1004380301	140
75	3300005549	Ga0070704_100934262	Ga0070704_1009342622	140
76	3300005563	Ga0068855_101607770	Ga0068855_1016077701	140
77	3300005564	Ga0070664_100901352	Ga0070664_1009013522	140
78	3300005564	Ga0070664_101285014	Ga0070664_1012850142	140
79	3300005577	Ga0068857_101878151	Ga0068857_1018781511	140
80	3300005578	Ga0068854_100393680	Ga0068854_1003936802	140
81	3300005578	Ga0068854_100438106	Ga0068854_1004381062	140
82	3300005616	Ga0068852_100259276	Ga0068852_1002592762	140
83	3300005616	Ga0068852_100844904	Ga0068852_1008449042	140
84	3300005617	Ga0068859_100041721	Ga0068859_1000417212	140
85	3300005617	Ga0068859_100045818	Ga0068859_1000458185	140
86	3300005617	Ga0068859_100053114	Ga0068859_1000531143	140
87	3300005617	Ga0068859_100140432	Ga0068859_1001404323	140
88	3300005617	Ga0068859_100293532	Ga0068859_1002935322	140
89	3300005617	Ga0068859_100612641	Ga0068859_1006126412	140
90	3300005618	Ga0068864_100036229	Ga0068864_1000362293	140
91	3300005618	Ga0068864_100213831	Ga0068864_1002138312	140
92	3300005618	Ga0068864_100896066	Ga0068864_1008960661	140
93	3300005618	Ga0068864_100921164	Ga0068864_1009211641	140
94	3300005718	Ga0068866_10522864	Ga0068866_105228642	140
95	3300005719	Ga0068861_100053582	Ga0068861_1000535823	140
96	3300005719	Ga0068861_100410050	Ga0068861_1004100502	140
97	3300005840	Ga0068870_10052741	Ga0068870_100527411	140
98	3300005840	Ga0068870_10061530	Ga0068870_100615301	140
99	3300005841	Ga0068863_100705942	Ga0068863_1007059421	140
100	3300005842	Ga0068858_100129790	Ga0068858_1001297903	140
101	3300005842	Ga0068858_101540971	Ga0068858_1015409711	140
102	3300005843	Ga0068860_100024799	Ga0068860_1000247993	140
103	3300005844	Ga0068862_100138241	Ga0068862_1001382413	140
104	3300005844	Ga0068862_100209127	Ga0068862_1002091271	140
105	3300005844	Ga0068862_100319869	Ga0068862_1003198692	140
106	3300005844	Ga0068862_100649831	Ga0068862_1006498311	140
107	3300005937	Ga0081455_10164834	Ga0081455_101648342	140
108	3300006844	Ga0075428_100148139	Ga0075428_1001481393	140
109	3300006844	Ga0075428_100559979	Ga0075428_1005599792	140
110	3300006844	Ga0075428_101557156	Ga0075428_1015571561	140
111	3300006846	Ga0075430_100123671	Ga0075430_1001236714	140
112	3300006847	Ga0075431_100029239	Ga0075431_1000292393	140
113	3300006847	Ga0075431_100112217	Ga0075431_1001122172	140
114	3300006852	Ga0075433_10447569	Ga0075433_104475691	140
115	3300006871	Ga0075434_100146297	Ga0075434_1001462971	140
116	3300006880	Ga0075429_101440485	Ga0075429_1014404852	140
117	3300006931	Ga0097620_100041721	Ga0097620_1000417212	140
118	3300006931	Ga0097620_100045818	Ga0097620_1000458184	140
119	3300006931	Ga0097620_100053113	Ga0097620_1000531133	140
120	3300006931	Ga0097620_100140429	Ga0097620_1001404292	140
121	3300006931	Ga0097620_100293541	Ga0097620_1002935412	140
122	3300006931	Ga0097620_100612630	Ga0097620_1006126302	140
123	3300009092	Ga0105250_10180942	Ga0105250_101809422	140
124	3300009093	Ga0105240_10847096	Ga0105240_108470962	140
125	3300009098	Ga0105245_11397450	Ga0105245_113974501	140
126	3300009101	Ga0105247_10028605	Ga0105247_100286053	140
127	3300009148	Ga0105243_10261509	Ga0105243_102615092	140
128	3300009148	Ga0105243_10438076	Ga0105243_104380762	140
129	3300009174	Ga0105241_10061243	Ga0105241_100612434	140
130	3300009174	Ga0105241_10136487	Ga0105241_101364872	140
131	3300009174	Ga0105241_10249345	Ga0105241_102493452	140
132	3300009174	Ga0105241_10279225	Ga0105241_102792252	140
133	3300009174	Ga0105241_10429595	Ga0105241_104295952	140
134	3300009176	Ga0105242_10268536	Ga0105242_102685361	140
135	3300009177	Ga0105248_10068075	Ga0105248_100680752	140
136	3300009177	Ga0105248_10131577	Ga0105248_101315773	140
137	3300009177	Ga0105248_10508691	Ga0105248_105086912	140
138	3300009177	Ga0105248_10961349	Ga0105248_109613491	140
139	3300009177	Ga0105248_11888814	Ga0105248_118888141	140
140	3300009553	Ga0105249_10002693	Ga0105249_100026937	140
141	3300010375	Ga0105239_10835092	Ga0105239_108350922	140
142	3300013100	Ga0157373_10008338	Ga0157373_100083386	140
143	3300013100	Ga0157373_10139090	Ga0157373_101390902	140
144	3300013100	Ga0157373_10770947	Ga0157373_107709471	140
145	3300013297	Ga0157378_10552353	Ga0157378_105523532	140
146	3300013306	Ga0163162_10164842	Ga0163162_101648423	140
147	3300013306	Ga0163162_10678476	Ga0163162_106784762	140
148	3300013306	Ga0163162_11096329	Ga0163162_110963292	140
149	3300013306	Ga0163162_13443098	Ga0163162_134430981	140
150	3300013308	Ga0157375_10698822	Ga0157375_106988222	140
151	3300014325	Ga0163163_10002062	Ga0163163_1000206214	140
152	3300014325	Ga0163163_10065466	Ga0163163_100654662	140
153	3300014326	Ga0157380_10070115	Ga0157380_100701153	140
154	3300014745	Ga0157377_10109894	Ga0157377_101098942	140
155	3300017792	Ga0163161_10514158	Ga0163161_105141581	140
156	3300025899	Ga0207642_10392598	Ga0207642_103925981	140
157	3300025900	Ga0207710_10000680	Ga0207710_100006802	140
158	3300025900	Ga0207710_10515266	Ga0207710_105152661	140
159	3300025901	Ga0207688_10294967	Ga0207688_102949672	140
160	3300025904	Ga0207647_10072191	Ga0207647_100721912	140
161	3300025904	Ga0207647_10108812	Ga0207647_101088122	140
162	3300025907	Ga0207645_10955571	Ga0207645_109555712	140
163	3300025908	Ga0207643_10006933	Ga0207643_100069335	140
164	3300025908	Ga0207643_10061733	Ga0207643_100617333	140
165	3300025908	Ga0207643_10352614	Ga0207643_103526142	140
166	3300025911	Ga0207654_10120153	Ga0207654_101201532	140
167	3300025917	Ga0207660_10669272	Ga0207660_106692722	140
168	3300025918	Ga0207662_10055814	Ga0207662_100558141	140
169	3300025919	Ga0207657_10264125	Ga0207657_102641252	140
170	3300025920	Ga0207649_11189362	Ga0207649_111893622	140
171	3300025923	Ga0207681_10028133	Ga0207681_100281332	140
172	3300025923	Ga0207681_10275495	Ga0207681_102754952	140
173	3300025925	Ga0207650_10000007	Ga0207650_10000007389	140
174	3300025925	Ga0207650_10077157	Ga0207650_100771572	140
175	3300025925	Ga0207650_10233482	Ga0207650_102334821	140
176	3300025926	Ga0207659_10356371	Ga0207659_103563712	140
177	3300025932	Ga0207690_10654541	Ga0207690_106545412	140
178	3300025933	Ga0207706_10375449	Ga0207706_103754492	140
179	3300025934	Ga0207686_10078620	Ga0207686_100786202	140
180	3300025935	Ga0207709_10081293	Ga0207709_100812933	140
181	3300025936	Ga0207670_10000512	Ga0207670_1000051213	140
182	3300025936	Ga0207670_10239685	Ga0207670_102396852	140
183	3300025936	Ga0207670_10673768	Ga0207670_106737682	140
184	3300025940	Ga0207691_10337030	Ga0207691_103370302	140
185	3300025941	Ga0207711_10008512	Ga0207711_100085124	140
186	3300025941	Ga0207711_10270771	Ga0207711_102707712	140
187	3300025941	Ga0207711_10488874	Ga0207711_104888742	140
188	3300025941	Ga0207711_10516408	Ga0207711_105164082	140
189	3300025942	Ga0207689_10166897	Ga0207689_101668972	140
190	3300025945	Ga0207679_10854926	Ga0207679_108549262	140
191	3300025960	Ga0207651_11121204	Ga0207651_111212042	140
192	3300025961	Ga0207712_10094195	Ga0207712_100941952	140
193	3300025972	Ga0207668_11783259	Ga0207668_117832591	140
194	3300025981	Ga0207640_10484937	Ga0207640_104849372	140
195	3300026023	Ga0207677_10928017	Ga0207677_109280172	140
196	3300026035	Ga0207703_10208012	Ga0207703_102080122	140
197	3300026041	Ga0207639_10182101	Ga0207639_101821013	140
198	3300026075	Ga0207708_10097473	Ga0207708_100974731	140
199	3300026075	Ga0207708_10141072	Ga0207708_101410721	140
200	3300026075	Ga0207708_10509449	Ga0207708_105094492	140
201	3300026088	Ga0207641_10024746	Ga0207641_100247463	140
202	3300026089	Ga0207648_10114687	Ga0207648_101146873	140
203	3300026089	Ga0207648_10715610	Ga0207648_107156102	140
204	3300026089	Ga0207648_10839680	Ga0207648_108396802	140
205	3300026095	Ga0207676_10002353	Ga0207676_100023533	140
206	3300026095	Ga0207676_10110143	Ga0207676_101101431	140
207	3300026116	Ga0207674_10831912	Ga0207674_108319122	140
208	3300026116	Ga0207674_10960672	Ga0207674_109606722	140
209	3300026118	Ga0207675_100009005	Ga0207675_1000090059	140
210	3300026118	Ga0207675_100302086	Ga0207675_1003020862	140
211	3300026142	Ga0207698_10132022	Ga0207698_101320222	140
212	3300026142	Ga0207698_10771612	Ga0207698_107716122	140
213	3300028380	Ga0268265_10758885	Ga0268265_107588852	140
214	3300028381	Ga0268264_10271678	Ga0268264_102716782	140
215	3300028381	Ga0268264_10282681	Ga0268264_102826812	140
216	3300028381	Ga0268264_10298620	Ga0268264_102986202	140
217	3300042002	Ga0439442_075844	Ga0439442_075844_60_482	140
218	3300042012	Ga0439455_0252053	Ga0439455_0252053_69_491	140
219	3300048906	Ga0496103_0437944	Ga0496103_0437944_386_808	140
220	3300048915	Ga0496112_0049106	Ga0496112_0049106_1108_1530	140
221	3300049575	Ga0501039_0139264	Ga0501039_0139264_1308_1736	140
222	3300049580	Ga0501046_0228793	Ga0501046_0228793_557_985	140
223	3300003203	JGI25406J46586_10052579	JGI25406J46586_100525791	141
224	3300005288	Ga0065714_10300741	Ga0065714_103007412	141
225	3300005290	Ga0065712_10001203	Ga0065712_100012037	141
226	3300005293	Ga0065715_10142326	Ga0065715_101423262	141
227	3300005331	Ga0070670_101489324	Ga0070670_1014893241	141
228	3300005334	Ga0068869_100351060	Ga0068869_1003510602	141
229	3300005334	Ga0068869_100857711	Ga0068869_1008577112	141
230	3300005337	Ga0070682_100011432	Ga0070682_1000114324	141
231	3300005338	Ga0068868_100374904	Ga0068868_1003749041	141
232	3300005338	Ga0068868_101678106	Ga0068868_1016781061	141
233	3300005345	Ga0070692_10019787	Ga0070692_100197871	141
234	3300005353	Ga0070669_101103195	Ga0070669_1011031951	141
235	3300005354	Ga0070675_100187441	Ga0070675_1001874412	141
236	3300005364	Ga0070673_100668300	Ga0070673_1006683001	141
237	3300005365	Ga0070688_100661358	Ga0070688_1006613581	141
238	3300005365	Ga0070688_100984952	Ga0070688_1009849521	141
239	3300005440	Ga0070705_100048360	Ga0070705_1000483603	141
240	3300005440	Ga0070705_101719911	Ga0070705_1017199111	141
241	3300005441	Ga0070700_100260922	Ga0070700_1002609221	141
242	3300005444	Ga0070694_100010619	Ga0070694_1000106193	141
243	3300005444	Ga0070694_100041646	Ga0070694_1000416461	141
244	3300005444	Ga0070694_100328663	Ga0070694_1003286632	141
245	3300005457	Ga0070662_100583609	Ga0070662_1005836092	141
246	3300005518	Ga0070699_100369560	Ga0070699_1003695602	141
247	3300005536	Ga0070697_100131685	Ga0070697_1001316852	141
248	3300005536	Ga0070697_100341509	Ga0070697_1003415092	141
249	3300005543	Ga0070672_100127186	Ga0070672_1001271861	141
250	3300005546	Ga0070696_100329829	Ga0070696_1003298292	141
251	3300005546	Ga0070696_100730863	Ga0070696_1007308631	141
252	3300005547	Ga0070693_100016770	Ga0070693_1000167704	141
253	3300005549	Ga0070704_100086834	Ga0070704_1000868343	141
254	3300005549	Ga0070704_100608902	Ga0070704_1006089022	141
255	3300005563	Ga0068855_100348050	Ga0068855_1003480501	141
256	3300005564	Ga0070664_100801922	Ga0070664_1008019223	141
257	3300005564	Ga0070664_100842827	Ga0070664_1008428271	141
258	3300005577	Ga0068857_100294843	Ga0068857_1002948432	141
259	3300005615	Ga0070702_100034869	Ga0070702_1000348692	141
260	3300005616	Ga0068852_100965557	Ga0068852_1009655572	141
261	3300005617	Ga0068859_100053047	Ga0068859_1000530473	141
262	3300005617	Ga0068859_100087993	Ga0068859_1000879932	141
263	3300005617	Ga0068859_100340143	Ga0068859_1003401432	141
264	3300005617	Ga0068859_101037082	Ga0068859_1010370822	141
265	3300005618	Ga0068864_100017765	Ga0068864_1000177654	141
266	3300005618	Ga0068864_100900530	Ga0068864_1009005301	141
267	3300005834	Ga0068851_10130288	Ga0068851_101302882	141
268	3300005840	Ga0068870_10259877	Ga0068870_102598772	141
269	3300005841	Ga0068863_100319958	Ga0068863_1003199582	141
270	3300005841	Ga0068863_100569887	Ga0068863_1005698872	141
271	3300005842	Ga0068858_100046986	Ga0068858_1000469863	141
272	3300005843	Ga0068860_100077052	Ga0068860_1000770521	141
273	3300005985	Ga0081539_10001671	Ga0081539_100016715	141
274	3300006173	Ga0070716_100022967	Ga0070716_1000229673	141
275	3300006844	Ga0075428_100048643	Ga0075428_1000486432	141
276	3300006844	Ga0075428_100110852	Ga0075428_1001108522	141
277	3300006844	Ga0075428_100178282	Ga0075428_1001782822	141
278	3300006846	Ga0075430_100119848	Ga0075430_1001198482	141
279	3300006847	Ga0075431_100100618	Ga0075431_1001006182	141
280	3300006847	Ga0075431_101484506	Ga0075431_1014845061	141
281	3300006852	Ga0075433_10062817	Ga0075433_100628174	141
282	3300006852	Ga0075433_10296332	Ga0075433_102963322	141
283	3300006880	Ga0075429_100120257	Ga0075429_1001202572	141
284	3300006880	Ga0075429_100244602	Ga0075429_1002446022	141
285	3300006931	Ga0097620_100053047	Ga0097620_1000530473	141
286	3300006931	Ga0097620_100087993	Ga0097620_1000879932	141
287	3300006931	Ga0097620_100340150	Ga0097620_1003401502	141
288	3300006931	Ga0097620_101037283	Ga0097620_1010372832	141
289	3300009093	Ga0105240_10010742	Ga0105240_100107427	141
290	3300009093	Ga0105240_11690629	Ga0105240_116906291	141
291	3300009094	Ga0111539_10020622	Ga0111539_100206223	141
292	3300009147	Ga0114129_10133954	Ga0114129_101339544	141
293	3300009147	Ga0114129_10307517	Ga0114129_103075173	141
294	3300009174	Ga0105241_10665076	Ga0105241_106650761	141
295	3300009174	Ga0105241_10769892	Ga0105241_107698922	141
296	3300009545	Ga0105237_10004423	Ga0105237_1000442310	141
297	3300013307	Ga0157372_10033294	Ga0157372_100332943	141
298	3300013307	Ga0157372_11887077	Ga0157372_118870771	141
299	3300014325	Ga0163163_10002406	Ga0163163_100024063	141
300	3300014745	Ga0157377_11372032	Ga0157377_113720321	141
301	3300014968	Ga0157379_10111698	Ga0157379_101116983	141
302	3300021358	Ga0213873_10065614	Ga0213873_100656142	141
303	3300025321	Ga0207656_10099144	Ga0207656_100991442	141
304	3300025885	Ga0207653_10000576	Ga0207653_100005765	141
305	3300025904	Ga0207647_10393874	Ga0207647_103938741	141
306	3300025908	Ga0207643_10404131	Ga0207643_104041311	141
307	3300025913	Ga0207695_10036933	Ga0207695_100369332	141
308	3300025914	Ga0207671_10003336	Ga0207671_100033363	141
309	3300025920	Ga0207649_10601882	Ga0207649_106018822	141
310	3300025926	Ga0207659_10218569	Ga0207659_102185692	141
311	3300025932	Ga0207690_10542716	Ga0207690_105427162	141
312	3300025939	Ga0207665_10073965	Ga0207665_100739652	141
313	3300025940	Ga0207691_10106382	Ga0207691_101063822	141
314	3300025942	Ga0207689_10271167	Ga0207689_102711671	141
315	3300025942	Ga0207689_10393062	Ga0207689_103930622	141
316	3300025945	Ga0207679_10889836	Ga0207679_108898362	141
317	3300025949	Ga0207667_10153724	Ga0207667_101537243	141
318	3300025960	Ga0207651_11558203	Ga0207651_115582031	141
319	3300025981	Ga0207640_10292851	Ga0207640_102928512	141
320	3300026023	Ga0207677_10346319	Ga0207677_103463192	141
321	3300026035	Ga0207703_10218035	Ga0207703_102180352	141
322	3300026041	Ga0207639_11369122	Ga0207639_113691222	141
323	3300026088	Ga0207641_11687235	Ga0207641_116872351	141
324	3300026116	Ga0207674_10563447	Ga0207674_105634472	141
325	3300026142	Ga0207698_10942029	Ga0207698_109420292	141
326	3300028381	Ga0268264_10056099	Ga0268264_100560993	141
327	3300030742	Ga0316183_1174873	Ga0316183_11748731	141
328	3300031548	Ga0307408_100053363	Ga0307408_1000533635	141
329	3300031548	Ga0307408_100251766	Ga0307408_1002517661	141
330	3300031731	Ga0307405_10013353	Ga0307405_100133533	141
331	3300031824	Ga0307413_10006264	Ga0307413_100062646	141
332	3300031852	Ga0307410_10003849	Ga0307410_100038497	141
333	3300031901	Ga0307406_10015094	Ga0307406_100150944	141
334	3300031903	Ga0307407_10030425	Ga0307407_100304253	141
335	3300031911	Ga0307412_10022333	Ga0307412_100223333	141
336	3300031995	Ga0307409_100094434	Ga0307409_1000944343	141
337	3300031995	Ga0307409_100323601	Ga0307409_1003236012	141
338	3300032002	Ga0307416_100091845	Ga0307416_1000918452	141
339	3300032126	Ga0307415_100058780	Ga0307415_1000587804	141
340	3300032126	Ga0307415_100864549	Ga0307415_1008645492	141
341	3300032126	Ga0307415_100962459	Ga0307415_1009624592	141
342	3300034816	Ga0373930_0143789	Ga0373930_0143789_112_543	141
343	3300035691	Ga0373931_1063233	Ga0373931_1063233_78_509	141
344	3300037418	Ga0395900_0050817	Ga0395900_0050817_2741_3172	141
345	3300037418	Ga0395900_0633678	Ga0395900_0633678_509_946	141
346	3300037466	Ga0395898_0490965	Ga0395898_0490965_344_775	141
347	3300037471	Ga0395905_0003438	Ga0395905_0003438_15104_15535	141
348	3300037471	Ga0395905_0183581	Ga0395905_0183581_753_1184	141
349	3300045051	Ga0451576_1351969	Ga0451576_1351969_45_491	141
350	3300045051	Ga0451576_1398605	Ga0451576_1398605_79_510	141
351	3300048905	Ga0496102_1009207	Ga0496102_1009207_113_544	141
352	3300048906	Ga0496103_0271935	Ga0496103_0271935_564_995	141
353	3300048915	Ga0496112_0394662	Ga0496112_0394662_601_1032	141
354	3300048915	Ga0496112_0699318	Ga0496112_0699318_316_747	141
355	3300048916	Ga0496113_0076019	Ga0496113_0076019_434_865	141
356	3300049514	Ga0501291_030154	Ga0501291_030154_283_714	141
357	3300049515	Ga0501292_051841	Ga0501292_051841_193_624	141
358	3300049516	Ga0501293_012166	Ga0501293_012166_46_477	141
359	3300049521	Ga0501298_169633	Ga0501298_169633_54_485	141
360	3300049522	Ga0501299_062201	Ga0501299_062201_274_735	141
361	3300049551	Ga0501335_040413	Ga0501335_040413_36_467	141
362	3300049577	Ga0501041_0360091	Ga0501041_0360091_413_847	141
363	3300049578	Ga0501042_1134057	Ga0501042_1134057_94_528	141
364	3300049649	Ga0501198_034766	Ga0501198_034766_409_840	141
365	3300049652	Ga0501202_206587	Ga0501202_206587_83_514	141
366	3300049656	Ga0501209_192209	Ga0501209_192209_90_521	141
367	3300049661	Ga0501217_207573	Ga0501217_207573_111_542	141
368	3300049663	Ga0501223_046379	Ga0501223_046379_399_830	141
369	3300049667	Ga0501230_167160	Ga0501230_167160_20_451	141
370	3300049668	Ga0501233_087237	Ga0501233_087237_60_491	141
371	3300049670	Ga0501236_014889	Ga0501236_014889_26_457	141
372	3300049672	Ga0501239_008150	Ga0501239_008150_436_867	141
373	3300049679	Ga0501249_012700	Ga0501249_012700_61_492	141
374	3300049683	Ga0501253_131451	Ga0501253_131451_52_483	141
375	3300049686	Ga0501257_021887	Ga0501257_021887_47_478	141
376	3300049705	Ga0501225_0132656	Ga0501225_0132656_184_615	141
377	3300049707	Ga0501234_027738	Ga0501234_027738_458_889	141
378	3300049707	Ga0501234_055772	Ga0501234_055772_99_530	141
379	3300049758	Ga0501241_031564	Ga0501241_031564_283_714	141
380	3300049758	Ga0501241_046149	Ga0501241_046149_391_822	141
381	3300049765	Ga0501268_176559	Ga0501268_176559_39_470	141
382	3300049770	Ga0501273_066508	Ga0501273_066508_47_478	141
383	3300049775	Ga0501279_017074	Ga0501279_017074_422_853	141
384	3300050507	nmdc:mga05p37_235004_c1	nmdc:mga05p37_235004_c1_772_1203	141
385	3300050508	nmdc:mga09592_311390_c1	nmdc:mga09592_311390_c1_219_650	141
386	3300050508	nmdc:mga09592_351297_c1	nmdc:mga09592_351297_c1_21_452	141
387	3300050509	nmdc:mga0qj67_73639_c1	nmdc:mga0qj67_73639_c1_520_954	141
388	3300050510	nmdc:mga06r32_1043076_c1	nmdc:mga06r32_1043076_c1_186_617	141
389	3300050510	nmdc:mga06r32_18063_c1	nmdc:mga06r32_18063_c1_5844_6278	141
390	3300050510	nmdc:mga06r32_182092_c1	nmdc:mga06r32_182092_c1_934_1368	141
391	3300050510	nmdc:mga06r32_357028_c1	nmdc:mga06r32_357028_c1_116_547	141
392	3300050511	nmdc:mga08y16_317789_c1	nmdc:mga08y16_317789_c1_910_1344	141
393	3300050512	nmdc:mga0n895_328051_c1	nmdc:mga0n895_328051_c1_692_1123	141
394	3300050512	nmdc:mga0n895_934663_c1	nmdc:mga0n895_934663_c1_330_764	141
395	3300050513	nmdc:mga0rr50_310804_c1	nmdc:mga0rr50_310804_c1_189_623	141
396	3300050515	nmdc:mga0a205_109436_c1	nmdc:mga0a205_109436_c1_694_1128	141
397	3300050515	nmdc:mga0a205_233793_c1	nmdc:mga0a205_233793_c1_494_919	141
398	3300050515	nmdc:mga0a205_64024_c1	nmdc:mga0a205_64024_c1_1231_1662	141
399	3300054114	Ga0501084_0015200	Ga0501084_0015200_592_1026	141
400	3300054114	Ga0501084_1339586	Ga0501084_1339586_71_505	141
401	3300060353	Ga0501082_0267165	Ga0501082_0267165_882_1349	141
402	3300061734	Ga0530510_0978590	Ga0530510_0978590_90_524	141
403	2162886006	SwRhRL3b_contig_845003	SwRhRL3b_0307.00000700	142
404	2162886007	SwRhRL2b_contig_247340	SwRhRL2b_0040.00001890	142
405	3300005289	Ga0065704_10003860	Ga0065704_100038605	142
406	3300005295	Ga0065707_10003307	Ga0065707_100033074	142
407	3300005328	Ga0070676_10016149	Ga0070676_100161493	142
408	3300005336	Ga0070680_100110358	Ga0070680_1001103583	142
409	3300005343	Ga0070687_100942157	Ga0070687_1009421571	142
410	3300005345	Ga0070692_10266329	Ga0070692_102663291	142
411	3300005365	Ga0070688_100369844	Ga0070688_1003698442	142
412	3300005543	Ga0070672_100348500	Ga0070672_1003485002	142
413	3300005546	Ga0070696_100194800	Ga0070696_1001948001	142
414	3300005546	Ga0070696_100312303	Ga0070696_1003123032	142
415	3300005549	Ga0070704_100370648	Ga0070704_1003706482	142
416	3300005578	Ga0068854_100215115	Ga0068854_1002151152	142
417	3300005617	Ga0068859_100024800	Ga0068859_1000248003	142
418	3300005617	Ga0068859_100788574	Ga0068859_1007885741	142
419	3300005719	Ga0068861_100396746	Ga0068861_1003967462	142
420	3300005840	Ga0068870_10635649	Ga0068870_106356491	142
421	3300005843	Ga0068860_100475693	Ga0068860_1004756931	142
422	3300006844	Ga0075428_100865730	Ga0075428_1008657301	142
423	3300006846	Ga0075430_100026185	Ga0075430_1000261854	142
424	3300006847	Ga0075431_100214463	Ga0075431_1002144633	142
425	3300006880	Ga0075429_100146992	Ga0075429_1001469922	142
426	3300006880	Ga0075429_100179898	Ga0075429_1001798982	142
427	3300006881	Ga0068865_101332279	Ga0068865_1013322791	142
428	3300006931	Ga0097620_100024801	Ga0097620_1000248013	142
429	3300006931	Ga0097620_100788576	Ga0097620_1007885761	142
430	3300009094	Ga0111539_10024213	Ga0111539_100242136	142
431	3300009094	Ga0111539_10102466	Ga0111539_101024661	142
432	3300009177	Ga0105248_10584538	Ga0105248_105845381	142
433	3300011119	Ga0105246_10077146	Ga0105246_100771462	142
434	3300013297	Ga0157378_10029644	Ga0157378_100296444	142
435	3300013306	Ga0163162_10257011	Ga0163162_102570111	142
436	3300013307	Ga0157372_11735028	Ga0157372_117350281	142
437	3300013308	Ga0157375_10015150	Ga0157375_100151505	142
438	3300025917	Ga0207660_10005726	Ga0207660_100057261	142
439	3300025933	Ga0207706_10070197	Ga0207706_100701973	142
440	3300025986	Ga0207658_10735772	Ga0207658_107357721	142
441	3300026075	Ga0207708_10611133	Ga0207708_106111331	142
442	3300026088	Ga0207641_10646102	Ga0207641_106461021	142
443	3300027907	Ga0207428_10091723	Ga0207428_100917232	142
444	3300028381	Ga0268264_10366278	Ga0268264_103662781	142
445	3300032002	Ga0307416_100643088	Ga0307416_1006430882	142
446	3300032002	Ga0307416_102571651	Ga0307416_1025716511	142
447	3300035091	Ga0373951_0038410	Ga0373951_0038410_26_454	142
448	3300045051	Ga0451576_1526506	Ga0451576_1526506_213_650	142
449	3300050508	nmdc:mga09592_116104_c1	nmdc:mga09592_116104_c1_869_1309	142
450	3300050515	nmdc:mga0a205_457895_c1	nmdc:mga0a205_457895_c1_158_586	142

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6zif-assembly1.cif.gz_C	the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242)	0.532	25	133
3lmf-assembly1.cif.gz_A	crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72	0.525	25	135
3lmf-assembly1.cif.gz_A	crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72	0.5138	25	135
6zif-assembly1.cif.gz_C	the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242)	0.5113	25	133
7a0g-assembly1.cif.gz_HHH	structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens.	0.3898	19	137

ID	Description	Score	Start	End	Superfamily
af_D3ZYP5_7_123_1.20.120.550	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain	0.6152	30	127	1.20.120.550
af_Q9VBT1_137_338_3.90.1200.10	Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe	0.6112	82	137	3.90.1200.10
af_Q8NCS4_7_125_1.20.120.550	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain	0.59	30	127	1.20.120.550
af_P31053_1_108_1.20.5.110	Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;	0.5882	21	111	1.20.5.110
af_A0A6H2EED7_1_133_1.20.140.150	Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;	0.5397	23	141	1.20.140.150

ID	Description	Score	Start	End	GO Terms
AF-A0A4R2H631-F1-model_v4	DoxX-like protein	0.9539	17	136	GO:0016020
AF-A0A534TFL6-F1-model_v4	DoxX family membrane protein	0.953	23	133
AF-A0A346XRI7-F1-model_v4	Putative TRANSMEMBRANE PROTEIN	0.9418	22	137	GO:0016020
AF-A0A534Q1W8-F1-model_v4	DoxX family protein	0.9301	26	140	GO:0016020
AF-C8XFH9-F1-model_v4	DoxX family protein	0.9265	13	142	GO:0016020

Feature Viewer

pLDDT	pTM	Quality
84.41	0.73	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F446530

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map