F446471

General Info

Members Datasets Scaffolds Average Seq Length
449 245 898 148

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0131724|Ga0496100_0131724_171_752
Length 175
Sequence VRHQRVGKKLGRDSAHRKALYSNLAGALIEHGRIKTTVTKAKAVKPIAEQMITLGRRGDLHARRQATAFLRSRDVVHKLFAEVAPRFKDRPGGYARIIKIGPRAGDAAEMAYLELVDEEYVTSQREERTPVPAALVVEPEVPEDDEQLEAEPLDAGAGLGEAGPEEPPADPRKSD

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
97 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
128 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
131 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
132 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
133 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.55
Metatranscriptomes 4.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 9.13
Rhizosphere 89.53
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0131724 3300048903 Bacteria 1762
2 JGI24751J29686_10015183 3300002459 Bacteria 1589
3 Ga0058863_10019711 3300004799 Bacteria 1195
4 Ga0058863_11928444 3300004799 Bacteria 921
5 Ga0058862_12856590 3300004803 Bacteria 823
6 Ga0070658_10067938 3300005327 Bacteria 2913
7 Ga0070658_10118394 3300005327 Bacteria 2199
8 Ga0070658_10178738 3300005327 Bacteria 1785
9 Ga0070683_100113355 3300005329 Bacteria 2559
10 Ga0070683_100232102 3300005329 Bacteria 1754
11 Ga0070670_100022554 3300005331 Bacteria 5418
12 Ga0070680_100018745 3300005336 Bacteria 5476
13 Ga0070660_100008860 3300005339 Bacteria 7053
14 Ga0070660_100058037 3300005339 Bacteria 3000
15 Ga0070660_100256053 3300005339 Bacteria 1428
16 Ga0070660_100308025 3300005339 Bacteria 1299
17 Ga0070660_100382793 3300005339 Bacteria 1161
18 Ga0070661_100071207 3300005344 Bacteria 2558
19 Ga0070661_100072329 3300005344 Bacteria 2537
20 Ga0070668_101579998 3300005347 Bacteria 601
21 Ga0070671_100156764 3300005355 Bacteria 1923
22 Ga0070671_100520148 3300005355 Bacteria 1024
23 Ga0070673_101007385 3300005364 Bacteria 776
24 Ga0070688_101374195 3300005365 Bacteria 572
25 Ga0070659_100274877 3300005366 Bacteria 1400
26 Ga0070659_100603407 3300005366 Bacteria 943
27 Ga0070714_100553326 3300005435 Bacteria 1102
28 Ga0070710_10092303 3300005437 Bacteria 1788
29 Ga0070710_10357269 3300005437 Bacteria 969
30 Ga0070711_100027002 3300005439 Bacteria 3766
31 Ga0070711_100331859 3300005439 Bacteria 1218
32 Ga0070708_100421640 3300005445 Bacteria 1259
33 Ga0070678_100757502 3300005456 Bacteria 879
34 Ga0070681_10094788 3300005458 Bacteria 2933
35 Ga0070681_10095572 3300005458 Bacteria 2920
36 Ga0070681_10124950 3300005458 Bacteria 2505
37 Ga0070681_10293572 3300005458 Bacteria 1535
38 Ga0070685_10290166 3300005466 Bacteria 1099
39 Ga0070707_100545547 3300005468 Bacteria 1122
40 Ga0070707_100624851 3300005468 Bacteria 1040
41 Ga0070698_100117502 3300005471 Bacteria 2622
42 Ga0070698_100298937 3300005471 Bacteria 1540
43 Ga0070679_100057486 3300005530 Bacteria 3877
44 Ga0070679_100354539 3300005530 Bacteria 1414
45 Ga0070679_100937127 3300005530 Bacteria 809
46 Ga0070684_100060538 3300005535 Bacteria 3312
47 Ga0070684_100195298 3300005535 Bacteria 1842
48 Ga0070684_101045752 3300005535 Bacteria 767
49 Ga0068853_100246219 3300005539 Bacteria 1639
50 Ga0070665_100068379 3300005548 Bacteria 3561
51 Ga0068855_100132521 3300005563 Bacteria 2845
52 Ga0068855_100303036 3300005563 Bacteria 1769
53 Ga0068855_100357173 3300005563 Bacteria 1608
54 Ga0068855_100380182 3300005563 Bacteria 1551
55 Ga0068855_100634968 3300005563 Bacteria 1148
56 Ga0068857_100013272 3300005577 Bacteria 7176
57 Ga0068857_100078809 3300005577 Bacteria 2940
58 Ga0068857_100098335 3300005577 Bacteria 2625
59 Ga0068857_100169780 3300005577 Bacteria 1982
60 Ga0068856_100043278 3300005614 Bacteria 4430
61 Ga0068852_100219032 3300005616 Bacteria 1809
62 Ga0068852_100405746 3300005616 Bacteria 1341
63 Ga0068870_10004578 3300005840 Bacteria 5959
64 Ga0068862_100593235 3300005844 Bacteria 1063
65 Ga0068862_101248530 3300005844 Bacteria 743
66 Ga0081455_10006229 3300005937 Bacteria 12846
67 Ga0081455_10042179 3300005937 Bacteria 4005
68 Ga0081538_10000458 3300005981 Bacteria 45661
69 Ga0081538_10104917 3300005981 Bacteria 1408
70 Ga0081538_10135446 3300005981 Bacteria 1148
71 Ga0081540_1006702 3300005983 Bacteria 8329
72 Ga0075370_10799570 3300006353 Bacteria 575
73 Ga0075431_100180066 3300006847 Bacteria 2169
74 Ga0075429_100186647 3300006880 Bacteria 1817
75 Ga0075435_100408935 3300007076 Bacteria 1168
76 Ga0075435_100471632 3300007076 Bacteria 1083
77 Ga0105240_10078072 3300009093 Bacteria 4078
78 Ga0105245_10308762 3300009098 Unclassified 1554
79 Ga0105245_10418663 3300009098 Bacteria 1342
80 Ga0105245_11675535 3300009098 Bacteria 688
81 Ga0114129_10161568 3300009147 Bacteria 3060
82 Ga0105243_10732534 3300009148 Bacteria 967
83 Ga0105243_11504440 3300009148 Bacteria 697
84 Ga0105243_11849276 3300009148 Bacteria 636
85 Ga0105242_10027312 3300009176 Bacteria 4530
86 Ga0105242_10937596 3300009176 Bacteria 869
87 Ga0105237_10888043 3300009545 Bacteria 898
88 Ga0105238_10980539 3300009551 Bacteria 866
89 Ga0105249_11890434 3300009553 Bacteria 670
90 Ga0105239_10515223 3300010375 Bacteria 1360
91 Ga0105239_11060632 3300010375 Bacteria 932
92 Ga0105239_12170221 3300010375 Unclassified 646
93 Ga0157370_10034894 3300013104 Bacteria 4894
94 Ga0157369_10021723 3300013105 Bacteria 7178
95 Ga0157369_10087505 3300013105 Bacteria 3326
96 Ga0157374_10432255 3300013296 Bacteria 1316
97 Ga0157374_10868035 3300013296 Unclassified 919
98 Ga0157372_10566348 3300013307 Bacteria 1324
99 Ga0157376_10288775 3300014969 Bacteria 1548
100 Ga0197907_10303067 3300020069 Bacteria 2967
101 Ga0197907_10637036 3300020069 Bacteria 710
102 Ga0197907_10734533 3300020069 Bacteria 1032
103 Ga0197907_10830350 3300020069 Bacteria 1151
104 Ga0206356_10721937 3300020070 Bacteria 1826
105 Ga0206356_10786472 3300020070 Bacteria 1522
106 Ga0206356_10794487 3300020070 Bacteria 739
107 Ga0206356_11897130 3300020070 Bacteria 804
108 Ga0206350_10176318 3300020080 Bacteria 1149
109 Ga0206354_10644336 3300020081 Bacteria 1337
110 Ga0206354_11110297 3300020081 Bacteria 3760
111 Ga0206354_11313892 3300020081 Bacteria 1361
112 Ga0206353_10167500 3300020082 Bacteria 4116
113 Ga0206353_10291253 3300020082 Bacteria 865
114 Ga0154015_1283306 3300020610 Bacteria 1351
115 Ga0207692_10326301 3300025898 Bacteria 941
116 Ga0207643_10007361 3300025908 Bacteria 5906
117 Ga0207705_10031486 3300025909 Bacteria 3787
118 Ga0207705_10087956 3300025909 Bacteria 2272
119 Ga0207654_10701960 3300025911 Bacteria 727
120 Ga0207707_10023859 3300025912 Bacteria 5350
121 Ga0207707_10093711 3300025912 Bacteria 2623
122 Ga0207707_10107584 3300025912 Bacteria 2438
123 Ga0207707_10241424 3300025912 Bacteria 1571
124 Ga0207695_10099742 3300025913 Bacteria 2901
125 Ga0207695_10537608 3300025913 Bacteria 1050
126 Ga0207693_10196340 3300025915 Bacteria 1587
127 Ga0207663_10153617 3300025916 Bacteria 1617
128 Ga0207663_10478050 3300025916 Bacteria 965
129 Ga0207660_10030615 3300025917 Bacteria 3700
130 Ga0207660_10133853 3300025917 Bacteria 1889
131 Ga0207660_10303458 3300025917 Bacteria 1272
132 Ga0207657_10020324 3300025919 Bacteria 6277
133 Ga0207657_10029814 3300025919 Bacteria 4960
134 Ga0207657_10045506 3300025919 Bacteria 3851
135 Ga0207657_10156439 3300025919 Bacteria 1853
136 Ga0207657_10200766 3300025919 Bacteria 1604
137 Ga0207649_10059925 3300025920 Bacteria 2390
138 Ga0207649_10474065 3300025920 Bacteria 948
139 Ga0207652_10134117 3300025921 Bacteria 2210
140 Ga0207652_10749640 3300025921 Bacteria 869
141 Ga0207646_10239338 3300025922 Bacteria 1640
142 Ga0207646_10332676 3300025922 Bacteria 1372
143 Ga0207646_10435616 3300025922 Bacteria 1183
144 Ga0207646_10723291 3300025922 Bacteria 889
145 Ga0207687_10334818 3300025927 Unclassified 1229
146 Ga0207687_10401368 3300025927 Bacteria 1128
147 Ga0207687_11058238 3300025927 Bacteria 696
148 Ga0207664_10248885 3300025929 Bacteria 1550
149 Ga0207690_10058997 3300025932 Bacteria 2598
150 Ga0207690_10102639 3300025932 Bacteria 2045
151 Ga0207686_10089559 3300025934 Bacteria 2028
152 Ga0207686_10496523 3300025934 Bacteria 946
153 Ga0207669_11306250 3300025937 Bacteria 616
154 Ga0207661_10087903 3300025944 Bacteria 2582
155 Ga0207661_10098100 3300025944 Bacteria 2455
156 Ga0207679_10894884 3300025945 Bacteria 812
157 Ga0207667_10070908 3300025949 Bacteria 3626
158 Ga0207667_10083868 3300025949 Bacteria 3299
159 Ga0207667_10150305 3300025949 Bacteria 2397
160 Ga0207667_10203280 3300025949 Bacteria 2032
161 Ga0207667_10325998 3300025949 Bacteria 1568
162 Ga0207677_10325047 3300026023 Bacteria 1280
163 Ga0207639_10157260 3300026041 Bacteria 1911
164 Ga0207708_10706514 3300026075 Bacteria 862
165 Ga0207702_10157253 3300026078 Bacteria 2073
166 Ga0207702_10340712 3300026078 Bacteria 1432
167 Ga0207702_10774037 3300026078 Bacteria 948
168 Ga0207641_10434938 3300026088 Bacteria 1266
169 Ga0207648_10883484 3300026089 Bacteria 834
170 Ga0207674_10023944 3300026116 Bacteria 6530
171 Ga0207674_10029757 3300026116 Bacteria 5747
172 Ga0207674_10119230 3300026116 Bacteria 2608
173 Ga0207674_10405015 3300026116 Bacteria 1318
174 Ga0207675_100175222 3300026118 Bacteria 2052
175 Ga0207675_101030143 3300026118 Bacteria 842
176 Ga0207683_10179137 3300026121 Bacteria 1921
177 Ga0207698_10110314 3300026142 Bacteria 2304
178 Ga0207698_10380687 3300026142 Bacteria 1342
179 Ga0268266_10156204 3300028379 Bacteria 2060
180 Ga0268265_10309108 3300028380 Bacteria 1427
181 Ga0265336_10027766 3300028666 Bacteria 1771
182 Ga0265330_10063849 3300031235 Bacteria 1600
183 Ga0265328_10221217 3300031239 Bacteria 721
184 Ga0265339_10078492 3300031249 Bacteria 1748
185 Ga0265327_10025401 3300031251 Bacteria 3454
186 Ga0265327_10033911 3300031251 Bacteria 2838
187 Ga0265316_10499247 3300031344 Bacteria 869
188 Ga0265313_10007653 3300031595 Bacteria 7323
189 Ga0265314_10023971 3300031711 Bacteria 4637
190 Ga0307405_10496491 3300031731 Bacteria 977
191 Ga0307407_10414865 3300031903 Bacteria 969
192 Ga0307412_10071679 3300031911 Bacteria 2366
193 Ga0307409_100322340 3300031995 Bacteria 1447
194 Ga0307416_100019004 3300032002 Bacteria 4860
195 Ga0307415_100294675 3300032126 Bacteria 1341
196 Ga0373926_0038543 3300035083 Bacteria 1703
197 Ga0373944_0073957 3300035089 Bacteria 1115
198 Ga0373945_0026849 3300035116 Bacteria 2008
199 Ga0373945_0106547 3300035116 Bacteria 1102
200 Ga0373943_0026410 3300035170 Bacteria 2720
201 Ga0373943_0154522 3300035170 Bacteria 1245
202 Ga0373943_0240226 3300035170 Bacteria 1015
203 Ga0373946_0014160 3300035171 Bacteria 3005
204 Ga0373946_0078444 3300035171 Unclassified 1441
205 Ga0373955_0103704 3300035172 Bacteria 1636
206 Ga0373962_0133430 3300035242 Bacteria 801
207 Ga0373931_0241428 3300035691 Bacteria 1095
208 Ga0373947_0001098 3300035725 Bacteria 16601
209 Ga0373947_0004671 3300035725 Bacteria 8028
210 Ga0373937_0027040 3300036401 Bacteria 5185
211 Ga0373937_1047217 3300036401 Bacteria 765
212 Ga0373925_0004312 3300037068 Bacteria 10773
213 Ga0395899_0010189 3300037312 Bacteria 7202
214 Ga0395899_0232659 3300037312 Bacteria 1272
215 Ga0395899_0342567 3300037312 Bacteria 1002
216 Ga0395900_0048457 3300037418 Bacteria 4377
217 Ga0395900_0082696 3300037418 Bacteria 3299
218 Ga0395900_0600909 3300037418 Bacteria 1041
219 Ga0395898_0041783 3300037466 Bacteria 4526
220 Ga0395898_0212033 3300037466 Bacteria 1847
221 Ga0395898_0217543 3300037466 Bacteria 1822
222 Ga0395898_0312646 3300037466 Bacteria 1499
223 Ga0395898_1104258 3300037466 Bacteria 726
224 Ga0395898_1132340 3300037466 Bacteria 715
225 Ga0395905_0016973 3300037471 Bacteria 6912
226 Ga0395905_0025852 3300037471 Bacteria 5533
227 Ga0395905_0097306 3300037471 Bacteria 2763
228 Ga0395905_0114942 3300037471 Bacteria 2529
229 Ga0395905_0637393 3300037471 Bacteria 968
230 Ga0436364_0355082 3300037853 Bacteria 870
231 Ga0395901_0001204 3300038443 Bacteria 27493
232 Ga0395901_0041442 3300038443 Bacteria 4772
233 Ga0395901_0054444 3300038443 Bacteria 4159
234 Ga0395901_0055147 3300038443 Bacteria 4132
235 Ga0395901_0070235 3300038443 Bacteria 3648
236 Ga0395901_0097554 3300038443 Bacteria 3081
237 Ga0395901_0258428 3300038443 Bacteria 1813
238 Ga0395901_1868920 3300038443 Bacteria 549
239 Ga0436365_0119942 3300039437 Unclassified 1027
240 Ga0436365_0810320 3300039437 Bacteria 947
241 Ga0436360_0185129 3300039438 Bacteria 644
242 Ga0436360_0600265 3300039438 Bacteria 1217
243 Ga0451800_1043410 3300041459 Bacteria 1277
244 Ga0451853_2434713 3300041512 Bacteria 814
245 Ga0439454_114437 3300042011 Bacteria 517
246 Ga0450915_000166 3300042119 Bacteria 1839
247 Ga0450920_025112 3300042122 Bacteria 1159
248 Ga0450908_023562 3300042184 Bacteria 1077
249 Ga0439460_0102692 3300042461 Bacteria 920
250 Ga0450918_015562 3300042531 Bacteria 1322
251 Ga0466963_0006939 3300044694 Bacteria 6738
252 Ga0466963_0078327 3300044694 Bacteria 2234
253 Ga0466963_0157232 3300044694 Bacteria 1581
254 Ga0466963_0287851 3300044694 Bacteria 1155
255 Ga0466971_0028337 3300044719 Bacteria 2506
256 Ga0466958_0209573 3300045836 Bacteria 1241
257 Ga0466967_0006265 3300045976 Bacteria 8391
258 Ga0466967_0053233 3300045976 Bacteria 3556
259 Ga0466967_0078859 3300045976 Bacteria 2967
260 Ga0466967_0129801 3300045976 Bacteria 2338
261 Ga0466967_1875727 3300045976 Bacteria 596
262 Ga0495592_0037872 3300046454 Bacteria 3629
263 Ga0495603_0249939 3300046455 Bacteria 1021
264 Ga0495629_0001157 3300046459 Bacteria 20835
265 Ga0495629_0056414 3300046459 Bacteria 2747
266 Ga0495629_0452275 3300046459 Bacteria 869
267 Ga0495641_0002322 3300046461 Bacteria 15128
268 Ga0495651_0041099 3300046462 Bacteria 3592
269 Ga0495651_0154367 3300046462 Bacteria 1651
270 Ga0495653_0056834 3300046463 Bacteria 2981
271 Ga0495582_0000808 3300046473 Bacteria 17389
272 Ga0495582_0014320 3300046473 Bacteria 4361
273 Ga0495582_0255581 3300046473 Bacteria 1005
274 Ga0495639_0000429 3300046475 Bacteria 20027
275 Ga0495662_0011133 3300046476 Bacteria 4395
276 Ga0495664_0042312 3300046477 Bacteria 2697
277 Ga0495664_0257151 3300046477 Bacteria 1056
278 Ga0495585_0464742 3300046492 Bacteria 604
279 Ga0495594_0013822 3300046499 Bacteria 4221
280 Ga0495608_0018480 3300046511 Bacteria 4808
281 Ga0495618_0437553 3300046514 Unclassified 795
282 Ga0495628_0135048 3300046516 Bacteria 1886
283 Ga0495628_0259474 3300046516 Bacteria 1295
284 Ga0495630_0022775 3300046517 Bacteria 4627
285 Ga0495630_0055067 3300046517 Bacteria 2980
286 Ga0495663_0154799 3300046525 Bacteria 784
287 Ga0495642_0353408 3300046528 Bacteria 646
288 Ga0495652_0053666 3300046529 Bacteria 3435
289 Ga0495652_0545313 3300046529 Bacteria 798
290 Ga0495586_0000744 3300046535 Bacteria 18696
291 Ga0495587_0021953 3300046536 Bacteria 3934
292 Ga0495587_0217833 3300046536 Bacteria 1077
293 Ga0495609_0207918 3300046538 Bacteria 816
294 Ga0495645_0188922 3300046543 Bacteria 1405
295 Ga0495667_0012097 3300046559 Bacteria 5845
296 Ga0495667_0053544 3300046559 Bacteria 2657
297 Ga0495634_0207468 3300046642 Bacteria 1214
298 Ga0495635_0067129 3300046663 Bacteria 2460
299 Ga0495635_0157202 3300046663 Bacteria 1547
300 Ga0495659_0523119 3300046664 Bacteria 521
301 Ga0495657_0028235 3300046675 Bacteria 3949
302 Ga0495657_0330163 3300046675 Bacteria 905
303 Ga0495623_0012946 3300046679 Bacteria 5399
304 Ga0495646_0323826 3300046680 Bacteria 811
305 Ga0495647_0197010 3300046681 Bacteria 882
306 Ga0495658_0000300 3300046683 Bacteria 28107
307 Ga0495613_0001388 3300046689 Bacteria 18420
308 Ga0495613_0253333 3300046689 Bacteria 1228
309 Ga0495613_0386675 3300046689 Bacteria 956
310 Ga0495624_0018081 3300046690 Bacteria 4719
311 Ga0495600_0064135 3300046809 Bacteria 2401
312 Ga0495600_0087754 3300046809 Bacteria 2029
313 Ga0495581_0001143 3300047315 Bacteria 14507
314 Ga0495604_0135487 3300047317 Bacteria 1765
315 Ga0495674_0094679 3300047319 Bacteria 2547
316 Ga0495674_0812634 3300047319 Bacteria 726
317 Ga0495676_0011971 3300047321 Bacteria 7826
318 Ga0495680_0016542 3300047322 Bacteria 6332
319 Ga0495680_0042111 3300047322 Bacteria 3626
320 Ga0495680_0091421 3300047322 Bacteria 2281
321 Ga0495684_0006532 3300047471 Bacteria 9051
322 Ga0495684_0016275 3300047471 Bacteria 5726
323 Ga0495593_0013485 3300047673 Bacteria 4661
324 Ga0495602_0049222 3300048088 Bacteria 3777
325 Ga0495602_0152057 3300048088 Bacteria 1818
326 Ga0495602_0293627 3300048088 Unclassified 1192
327 Ga0495614_0028081 3300048089 Bacteria 2425
328 Ga0496100_0038887 3300048903 Bacteria 3017
329 Ga0496100_0083147 3300048903 Bacteria 2166
330 Ga0496101_0005743 3300048904 Bacteria 7927
331 Ga0496101_0023822 3300048904 Bacteria 4232
332 Ga0496101_0115207 3300048904 Bacteria 2027
333 Ga0496102_1236637 3300048905 Bacteria 666
334 Ga0496103_0115969 3300048906 Bacteria 1704
335 Ga0496104_0042593 3300048907 Bacteria 4261
336 Ga0496105_0001009 3300048908 Bacteria 19456
337 Ga0496106_0004985 3300048909 Bacteria 9829
338 Ga0496106_0633380 3300048909 Bacteria 855
339 Ga0496107_0014643 3300048910 Bacteria 5491
340 Ga0496107_0057985 3300048910 Bacteria 2799
341 Ga0496108_0062726 3300048911 Bacteria 3129
342 Ga0496108_0357140 3300048911 Bacteria 1275
343 Ga0496108_1080311 3300048911 Bacteria 683
344 Ga0496109_0001990 3300048912 Bacteria 16940
345 Ga0496109_0031591 3300048912 Bacteria 4754
346 Ga0496109_1944990 3300048912 Bacteria 520
347 Ga0496110_0055427 3300048913 Bacteria 3488
348 Ga0496110_0270347 3300048913 Bacteria 1547
349 Ga0496110_0547764 3300048913 Bacteria 1051
350 Ga0496111_0038259 3300048914 Bacteria 3437
351 Ga0496111_0071624 3300048914 Bacteria 2523
352 Ga0496111_0405459 3300048914 Bacteria 1007
353 Ga0496112_0086573 3300048915 Bacteria 3100
354 Ga0496113_0037016 3300048916 Bacteria 3578
355 Ga0496113_0138574 3300048916 Bacteria 1913
356 Ga0496113_0250578 3300048916 Bacteria 1414
357 Ga0496114_0015173 3300048917 Bacteria 6197
358 Ga0496114_0097329 3300048917 Bacteria 2506
359 Ga0496114_0119328 3300048917 Bacteria 2267
360 Ga0496114_0604154 3300048917 Bacteria 967
361 Ga0496115_0001699 3300048918 Bacteria 15776
362 Ga0496115_0047476 3300048918 Bacteria 3434
363 Ga0496115_0059418 3300048918 Bacteria 3079
364 Ga0496115_0125089 3300048918 Bacteria 2118
365 Ga0496115_0186938 3300048918 Bacteria 1712
366 Ga0496115_0708074 3300048918 Bacteria 791
367 Ga0501031_0017300 3300049568 Bacteria 4683
368 Ga0501032_0016799 3300049569 Bacteria 5143
369 Ga0501033_0257604 3300049570 Bacteria 1235
370 Ga0501036_0736557 3300049572 Bacteria 813
371 Ga0501037_0015928 3300049573 Bacteria 5536
372 Ga0501038_0002839 3300049574 Bacteria 16117
373 Ga0501038_0436297 3300049574 Bacteria 1009
374 Ga0501040_0031029 3300049576 Bacteria 3611
375 Ga0501040_0060134 3300049576 Bacteria 2611
376 Ga0501040_0284396 3300049576 Bacteria 1181
377 Ga0501041_0065106 3300049577 Bacteria 2232
378 Ga0501042_0223468 3300049578 Bacteria 1358
379 Ga0501042_0289753 3300049578 Bacteria 1182
380 Ga0501043_0010312 3300049579 Bacteria 7326
381 Ga0501046_0465984 3300049580 Bacteria 907
382 Ga0501047_0059298 3300049581 Bacteria 3695
383 Ga0501047_0902721 3300049581 Bacteria 697
384 Ga0501048_0091655 3300049582 Bacteria 2143
385 Ga0501048_0314146 3300049582 Bacteria 1116
386 Ga0501067_0003763 3300049583 Bacteria 8362
387 Ga0501067_0410330 3300049583 Bacteria 755
388 Ga0501068_0033678 3300049584 Bacteria 3051
389 Ga0501068_0163649 3300049584 Bacteria 1402
390 Ga0501068_0171724 3300049584 Bacteria 1369
391 Ga0501068_0537425 3300049584 Bacteria 759
392 Ga0501069_0117208 3300049585 Bacteria 1519
393 Ga0501069_0459538 3300049585 Bacteria 757
394 Ga0501070_0004074 3300049586 Bacteria 12558
395 Ga0501071_0989425 3300049587 Bacteria 649
396 Ga0501072_0233949 3300049588 Bacteria 1463
397 Ga0501073_0028117 3300049589 Bacteria 4017
398 Ga0501074_0043974 3300049590 Bacteria 3233
399 Ga0501075_0202571 3300049591 Bacteria 1513
400 Ga0501075_0402580 3300049591 Bacteria 1043
401 Ga0501075_1067682 3300049591 Bacteria 613
402 Ga0501076_0097234 3300049592 Bacteria 2371
403 Ga0501076_1766372 3300049592 Bacteria 507
404 Ga0501079_0087082 3300049741 Bacteria 2418
405 Ga0501079_0138071 3300049741 Bacteria 1898
406 Ga0501079_1393806 3300049741 Bacteria 552
407 Ga0501080_0078933 3300049742 Bacteria 3060
408 Ga0501080_0578927 3300049742 Bacteria 998
409 Ga0501080_0774084 3300049742 Bacteria 843
410 Ga0501081_0087463 3300049743 Bacteria 2189
411 Ga0501081_0317479 3300049743 Bacteria 1144
412 Ga0501083_0005904 3300049744 Bacteria 8663
413 Ga0501035_0005051 3300049822 Bacteria 12497
414 Ga0501044_0580610 3300049823 Bacteria 1015
415 Ga0501044_0833424 3300049823 Unclassified 800
416 Ga0501045_0025733 3300049824 Bacteria 4231
417 nmdc:mga07m45_698860_c1 3300050496 Bacteria 583
418 nmdc:mga05p37_126960_c1 3300050507 Bacteria 3132
419 nmdc:mga05p37_306540_c1 3300050507 Bacteria 1884
420 nmdc:mga05p37_915897_c1 3300050507 Bacteria 943
421 nmdc:mga09592_214629_c1 3300050508 Bacteria 1667
422 nmdc:mga09592_726787_c1 3300050508 Bacteria 844
423 nmdc:mga0qj67_116776_c1 3300050509 Bacteria 2156
424 nmdc:mga0n895_189206_c1 3300050512 Bacteria 2089
425 nmdc:mga0n895_354769_c1 3300050512 Bacteria 1485
426 nmdc:mga0n895_847818_c1 3300050512 Bacteria 902
427 nmdc:mga0rr50_377292_c1 3300050513 Bacteria 1195
428 nmdc:mga0a205_130829_c1 3300050515 Bacteria 2410
429 nmdc:mga0a205_149965_c1 3300050515 Bacteria 2232
430 Ga0495601_0031648 3300053077 Bacteria 3289
431 Ga0495601_0198994 3300053077 Bacteria 1309
432 Ga0495612_0030980 3300053078 Bacteria 2156
433 Ga0495612_0036382 3300053078 Bacteria 1998
434 Ga0495595_0008195 3300053084 Bacteria 4288
435 Ga0495595_0108038 3300053084 Bacteria 1347
436 Ga0495619_0004483 3300053085 Bacteria 8917
437 Ga0495619_0005003 3300053085 Bacteria 8418
438 Ga0495619_0013521 3300053085 Bacteria 5142
439 Ga0501084_0091513 3300054114 Bacteria 2553
440 Ga0587080_059028 3300059503 Bacteria 743
441 Ga0587088_049599 3300059508 Bacteria 818
442 Ga0501082_0073285 3300060353 Bacteria 2949
443 Ga0501082_0260225 3300060353 Bacteria 1509
444 Ga0501082_0822968 3300060353 Bacteria 812
445 Ga0466962_0003534 3300061719 Bacteria 7448
446 Ga0530510_0117938 3300061734 Bacteria 1947
447 Ga0530510_0292756 3300061734 Bacteria 1217
448 Ga0530510_0469345 3300061734 Bacteria 952
449 Ga0530510_0691518 3300061734 Bacteria 777
450 Ga0496100_0131724
451 JGI24751J29686_10015183
452 Ga0058863_10019711
453 Ga0058863_11928444
454 Ga0058862_12856590
455 Ga0070658_10067938
456 Ga0070658_10118394
457 Ga0070658_10178738
458 Ga0070683_100113355
459 Ga0070683_100232102
460 Ga0070670_100022554
461 Ga0070680_100018745
462 Ga0070660_100008860
463 Ga0070660_100058037
464 Ga0070660_100256053
465 Ga0070660_100308025
466 Ga0070660_100382793
467 Ga0070661_100071207
468 Ga0070661_100072329
469 Ga0070668_101579998
470 Ga0070671_100156764
471 Ga0070671_100520148
472 Ga0070673_101007385
473 Ga0070688_101374195
474 Ga0070659_100274877
475 Ga0070659_100603407
476 Ga0070714_100553326
477 Ga0070710_10092303
478 Ga0070710_10357269
479 Ga0070711_100027002
480 Ga0070711_100331859
481 Ga0070708_100421640
482 Ga0070678_100757502
483 Ga0070681_10094788
484 Ga0070681_10095572
485 Ga0070681_10124950
486 Ga0070681_10293572
487 Ga0070685_10290166
488 Ga0070707_100545547
489 Ga0070707_100624851
490 Ga0070698_100117502
491 Ga0070698_100298937
492 Ga0070679_100057486
493 Ga0070679_100354539
494 Ga0070679_100937127
495 Ga0070684_100060538
496 Ga0070684_100195298
497 Ga0070684_101045752
498 Ga0068853_100246219
499 Ga0070665_100068379
500 Ga0068855_100132521
501 Ga0068855_100303036
502 Ga0068855_100357173
503 Ga0068855_100380182
504 Ga0068855_100634968
505 Ga0068857_100013272
506 Ga0068857_100078809
507 Ga0068857_100098335
508 Ga0068857_100169780
509 Ga0068856_100043278
510 Ga0068852_100219032
511 Ga0068852_100405746
512 Ga0068870_10004578
513 Ga0068862_100593235
514 Ga0068862_101248530
515 Ga0081455_10006229
516 Ga0081455_10042179
517 Ga0081538_10000458
518 Ga0081538_10104917
519 Ga0081538_10135446
520 Ga0081540_1006702
521 Ga0075370_10799570
522 Ga0075431_100180066
523 Ga0075429_100186647
524 Ga0075435_100408935
525 Ga0075435_100471632
526 Ga0105240_10078072
527 Ga0105245_10308762
528 Ga0105245_10418663
529 Ga0105245_11675535
530 Ga0114129_10161568
531 Ga0105243_10732534
532 Ga0105243_11504440
533 Ga0105243_11849276
534 Ga0105242_10027312
535 Ga0105242_10937596
536 Ga0105237_10888043
537 Ga0105238_10980539
538 Ga0105249_11890434
539 Ga0105239_10515223
540 Ga0105239_11060632
541 Ga0105239_12170221
542 Ga0157370_10034894
543 Ga0157369_10021723
544 Ga0157369_10087505
545 Ga0157374_10432255
546 Ga0157374_10868035
547 Ga0157372_10566348
548 Ga0157376_10288775
549 Ga0197907_10303067
550 Ga0197907_10637036
551 Ga0197907_10734533
552 Ga0197907_10830350
553 Ga0206356_10721937
554 Ga0206356_10786472
555 Ga0206356_10794487
556 Ga0206356_11897130
557 Ga0206350_10176318
558 Ga0206354_10644336
559 Ga0206354_11110297
560 Ga0206354_11313892
561 Ga0206353_10167500
562 Ga0206353_10291253
563 Ga0154015_1283306
564 Ga0207692_10326301
565 Ga0207643_10007361
566 Ga0207705_10031486
567 Ga0207705_10087956
568 Ga0207654_10701960
569 Ga0207707_10023859
570 Ga0207707_10093711
571 Ga0207707_10107584
572 Ga0207707_10241424
573 Ga0207695_10099742
574 Ga0207695_10537608
575 Ga0207693_10196340
576 Ga0207663_10153617
577 Ga0207663_10478050
578 Ga0207660_10030615
579 Ga0207660_10133853
580 Ga0207660_10303458
581 Ga0207657_10020324
582 Ga0207657_10029814
583 Ga0207657_10045506
584 Ga0207657_10156439
585 Ga0207657_10200766
586 Ga0207649_10059925
587 Ga0207649_10474065
588 Ga0207652_10134117
589 Ga0207652_10749640
590 Ga0207646_10239338
591 Ga0207646_10332676
592 Ga0207646_10435616
593 Ga0207646_10723291
594 Ga0207687_10334818
595 Ga0207687_10401368
596 Ga0207687_11058238
597 Ga0207664_10248885
598 Ga0207690_10058997
599 Ga0207690_10102639
600 Ga0207686_10089559
601 Ga0207686_10496523
602 Ga0207669_11306250
603 Ga0207661_10087903
604 Ga0207661_10098100
605 Ga0207679_10894884
606 Ga0207667_10070908
607 Ga0207667_10083868
608 Ga0207667_10150305
609 Ga0207667_10203280
610 Ga0207667_10325998
611 Ga0207677_10325047
612 Ga0207639_10157260
613 Ga0207708_10706514
614 Ga0207702_10157253
615 Ga0207702_10340712
616 Ga0207702_10774037
617 Ga0207641_10434938
618 Ga0207648_10883484
619 Ga0207674_10023944
620 Ga0207674_10029757
621 Ga0207674_10119230
622 Ga0207674_10405015
623 Ga0207675_100175222
624 Ga0207675_101030143
625 Ga0207683_10179137
626 Ga0207698_10110314
627 Ga0207698_10380687
628 Ga0268266_10156204
629 Ga0268265_10309108
630 Ga0265336_10027766
631 Ga0265330_10063849
632 Ga0265328_10221217
633 Ga0265339_10078492
634 Ga0265327_10025401
635 Ga0265327_10033911
636 Ga0265316_10499247
637 Ga0265313_10007653
638 Ga0265314_10023971
639 Ga0307405_10496491
640 Ga0307407_10414865
641 Ga0307412_10071679
642 Ga0307409_100322340
643 Ga0307416_100019004
644 Ga0307415_100294675
645 Ga0373926_0038543
646 Ga0373944_0073957
647 Ga0373945_0026849
648 Ga0373945_0106547
649 Ga0373943_0026410
650 Ga0373943_0154522
651 Ga0373943_0240226
652 Ga0373946_0014160
653 Ga0373946_0078444
654 Ga0373955_0103704
655 Ga0373962_0133430
656 Ga0373931_0241428
657 Ga0373947_0001098
658 Ga0373947_0004671
659 Ga0373937_0027040
660 Ga0373937_1047217
661 Ga0373925_0004312
662 Ga0395899_0010189
663 Ga0395899_0232659
664 Ga0395899_0342567
665 Ga0395900_0048457
666 Ga0395900_0082696
667 Ga0395900_0600909
668 Ga0395898_0041783
669 Ga0395898_0212033
670 Ga0395898_0217543
671 Ga0395898_0312646
672 Ga0395898_1104258
673 Ga0395898_1132340
674 Ga0395905_0016973
675 Ga0395905_0025852
676 Ga0395905_0097306
677 Ga0395905_0114942
678 Ga0395905_0637393
679 Ga0436364_0355082
680 Ga0395901_0001204
681 Ga0395901_0041442
682 Ga0395901_0054444
683 Ga0395901_0055147
684 Ga0395901_0070235
685 Ga0395901_0097554
686 Ga0395901_0258428
687 Ga0395901_1868920
688 Ga0436365_0119942
689 Ga0436365_0810320
690 Ga0436360_0185129
691 Ga0436360_0600265
692 Ga0451800_1043410
693 Ga0451853_2434713
694 Ga0439454_114437
695 Ga0450915_000166
696 Ga0450920_025112
697 Ga0450908_023562
698 Ga0439460_0102692
699 Ga0450918_015562
700 Ga0466963_0006939
701 Ga0466963_0078327
702 Ga0466963_0157232
703 Ga0466963_0287851
704 Ga0466971_0028337
705 Ga0466958_0209573
706 Ga0466967_0006265
707 Ga0466967_0053233
708 Ga0466967_0078859
709 Ga0466967_0129801
710 Ga0466967_1875727
711 Ga0495592_0037872
712 Ga0495603_0249939
713 Ga0495629_0001157
714 Ga0495629_0056414
715 Ga0495629_0452275
716 Ga0495641_0002322
717 Ga0495651_0041099
718 Ga0495651_0154367
719 Ga0495653_0056834
720 Ga0495582_0000808
721 Ga0495582_0014320
722 Ga0495582_0255581
723 Ga0495639_0000429
724 Ga0495662_0011133
725 Ga0495664_0042312
726 Ga0495664_0257151
727 Ga0495585_0464742
728 Ga0495594_0013822
729 Ga0495608_0018480
730 Ga0495618_0437553
731 Ga0495628_0135048
732 Ga0495628_0259474
733 Ga0495630_0022775
734 Ga0495630_0055067
735 Ga0495663_0154799
736 Ga0495642_0353408
737 Ga0495652_0053666
738 Ga0495652_0545313
739 Ga0495586_0000744
740 Ga0495587_0021953
741 Ga0495587_0217833
742 Ga0495609_0207918
743 Ga0495645_0188922
744 Ga0495667_0012097
745 Ga0495667_0053544
746 Ga0495634_0207468
747 Ga0495635_0067129
748 Ga0495635_0157202
749 Ga0495659_0523119
750 Ga0495657_0028235
751 Ga0495657_0330163
752 Ga0495623_0012946
753 Ga0495646_0323826
754 Ga0495647_0197010
755 Ga0495658_0000300
756 Ga0495613_0001388
757 Ga0495613_0253333
758 Ga0495613_0386675
759 Ga0495624_0018081
760 Ga0495600_0064135
761 Ga0495600_0087754
762 Ga0495581_0001143
763 Ga0495604_0135487
764 Ga0495674_0094679
765 Ga0495674_0812634
766 Ga0495676_0011971
767 Ga0495680_0016542
768 Ga0495680_0042111
769 Ga0495680_0091421
770 Ga0495684_0006532
771 Ga0495684_0016275
772 Ga0495593_0013485
773 Ga0495602_0049222
774 Ga0495602_0152057
775 Ga0495602_0293627
776 Ga0495614_0028081
777 Ga0496100_0038887
778 Ga0496100_0083147
779 Ga0496101_0005743
780 Ga0496101_0023822
781 Ga0496101_0115207
782 Ga0496102_1236637
783 Ga0496103_0115969
784 Ga0496104_0042593
785 Ga0496105_0001009
786 Ga0496106_0004985
787 Ga0496106_0633380
788 Ga0496107_0014643
789 Ga0496107_0057985
790 Ga0496108_0062726
791 Ga0496108_0357140
792 Ga0496108_1080311
793 Ga0496109_0001990
794 Ga0496109_0031591
795 Ga0496109_1944990
796 Ga0496110_0055427
797 Ga0496110_0270347
798 Ga0496110_0547764
799 Ga0496111_0038259
800 Ga0496111_0071624
801 Ga0496111_0405459
802 Ga0496112_0086573
803 Ga0496113_0037016
804 Ga0496113_0138574
805 Ga0496113_0250578
806 Ga0496114_0015173
807 Ga0496114_0097329
808 Ga0496114_0119328
809 Ga0496114_0604154
810 Ga0496115_0001699
811 Ga0496115_0047476
812 Ga0496115_0059418
813 Ga0496115_0125089
814 Ga0496115_0186938
815 Ga0496115_0708074
816 Ga0501031_0017300
817 Ga0501032_0016799
818 Ga0501033_0257604
819 Ga0501036_0736557
820 Ga0501037_0015928
821 Ga0501038_0002839
822 Ga0501038_0436297
823 Ga0501040_0031029
824 Ga0501040_0060134
825 Ga0501040_0284396
826 Ga0501041_0065106
827 Ga0501042_0223468
828 Ga0501042_0289753
829 Ga0501043_0010312
830 Ga0501046_0465984
831 Ga0501047_0059298
832 Ga0501047_0902721
833 Ga0501048_0091655
834 Ga0501048_0314146
835 Ga0501067_0003763
836 Ga0501067_0410330
837 Ga0501068_0033678
838 Ga0501068_0163649
839 Ga0501068_0171724
840 Ga0501068_0537425
841 Ga0501069_0117208
842 Ga0501069_0459538
843 Ga0501070_0004074
844 Ga0501071_0989425
845 Ga0501072_0233949
846 Ga0501073_0028117
847 Ga0501074_0043974
848 Ga0501075_0202571
849 Ga0501075_0402580
850 Ga0501075_1067682
851 Ga0501076_0097234
852 Ga0501076_1766372
853 Ga0501079_0087082
854 Ga0501079_0138071
855 Ga0501079_1393806
856 Ga0501080_0078933
857 Ga0501080_0578927
858 Ga0501080_0774084
859 Ga0501081_0087463
860 Ga0501081_0317479
861 Ga0501083_0005904
862 Ga0501035_0005051
863 Ga0501044_0580610
864 Ga0501044_0833424
865 Ga0501045_0025733
866 nmdc:mga07m45_698860_c1
867 nmdc:mga05p37_126960_c1
868 nmdc:mga05p37_306540_c1
869 nmdc:mga05p37_915897_c1
870 nmdc:mga09592_214629_c1
871 nmdc:mga09592_726787_c1
872 nmdc:mga0qj67_116776_c1
873 nmdc:mga0n895_189206_c1
874 nmdc:mga0n895_354769_c1
875 nmdc:mga0n895_847818_c1
876 nmdc:mga0rr50_377292_c1
877 nmdc:mga0a205_130829_c1
878 nmdc:mga0a205_149965_c1
879 Ga0495601_0031648
880 Ga0495601_0198994
881 Ga0495612_0030980
882 Ga0495612_0036382
883 Ga0495595_0008195
884 Ga0495595_0108038
885 Ga0495619_0004483
886 Ga0495619_0005003
887 Ga0495619_0013521
888 Ga0501084_0091513
889 Ga0587080_059028
890 Ga0587088_049599
891 Ga0501082_0073285
892 Ga0501082_0260225
893 Ga0501082_0822968
894 Ga0466962_0003534
895 Ga0530510_0117938
896 Ga0530510_0292756
897 Ga0530510_0469345
898 Ga0530510_0691518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01196

Ribosomal_L17

Ribosomal protein L17

20

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sfr-assembly1.cif.gz_N unmethylated mtb ribosome 50s with seq-9 0.9588 10 116
4v4p-assembly1.cif.gz_A0 crystal structure of 70s ribosome with thrs operator and trnas. 0.9465 14 117
6yxy-assembly1.cif.gz_AR state b of the trypanosoma brucei mitoribosomal large subunit assembly intermediate 0.9329 11 115
6ddd-assembly1.cif.gz_Z structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-5 0.9327 9 116
5xym-assembly1.cif.gz_N large subunit of mycobacterium smegmatis 0.9321 7 116
ID Description Score Start End Superfamily
5v7qN00 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9592 10 116 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9501 13 115 3.90.1030.10
1vs8N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9433 13 115 3.90.1030.10
1vt2N01 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.9413 13 115 3.90.1030.10
af_Q8ILF5_8_129_3.90.1030.10 Alpha Beta;Alpha-Beta Complex;50s Ribosomal Protein L17; Chain: A,;Ribosomal protein L17 0.941 11 116 3.90.1030.10
ID Description Score Start End GO Terms
AF-A0A1Q5ZSH3-F1-model_v4 50S ribosomal protein L17 0.9595 21 121 GO:0003735
GO:0006412
GO:0022625
AF-A0A1G1IKY8-F1-model_v4 50S ribosomal protein L17 0.9535 13 121 GO:0003735
GO:0006412
GO:0022625
AF-A0A7V3VKY6-F1-model_v4 Large ribosomal subunit protein bL17 0.948 9 124 GO:0003735
GO:0006412
GO:0022625
AF-A0A1H9S4W1-F1-model_v4 Large ribosomal subunit protein bL17 0.9245 10 124 GO:0003735
GO:0006412
GO:0022625
AF-R1BJT4-F1-model_v4 Mitochondrial ribosomal protein L17 0.9243 9 124 GO:0003735
GO:0006412
GO:0022625

Map