F446463
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 449 | 304 | 898 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300046675|Ga0495657_0143425|Ga0495657_0143425_75_1001 |
| Length | 308 |
| Sequence | MLDGRTARWARAGRAWNGGSQGVRAPECSLCRARGLRTAELWRIAVFHRRFVVAALAAALAIAVTAPSAPAQDKVITVFAAASMKNALDDLDAAFTKKTGVKVLASYAASSALVKQIEQGAPADVYVSADLQWMDYGVEKKLVQDDTRVNLLGNRLVLIAPKDTKIGNVTIAPGFDLAGLAGKGRIAVGDVRAVPAGLYAKAALEKLGAWAAAEPKLAMTENVRAALLLVARGEAPLGIVYETDAKIEPAVKVVGVFPDDSHPPIIYPVALTVNAKPEAAQYLAFLRTQAARSIFEGYGFSFLIKPTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 65 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 104 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 105 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 187 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 188 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 189 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 233 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 240 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 241 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 263 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 276 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 280 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 281 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 284 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 285 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 286 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 287 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 288 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 289 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 290 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 291 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 292 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 293 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 294 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 295 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 296 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 297 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 298 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 299 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 300 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 301 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 302 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 303 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 304 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.88 |
| Metatranscriptomes | 0.45 |
| Isolates | 4.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.8 |
| Nodule | 0.67 |
| Rhizoplane | 3.34 |
| Rhizosphere | 81.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495657_0143425 | 3300046675 | Bacteria | 1487 |
| 2 | JGI25151J46595_10000063 | 3300003187 | Bacteria | 146046 |
| 3 | rootL2_10048151 | 3300003322 | Bacteria | 1646 |
| 4 | Ga0055526_1000091 | 3300003771 | Bacteria | 82891 |
| 5 | Ga0055526_1000126 | 3300003771 | Bacteria | 67619 |
| 6 | Ga0055537_1000088 | 3300003773 | Bacteria | 66713 |
| 7 | Ga0055524_1000074 | 3300003775 | Bacteria | 122843 |
| 8 | Ga0055536_1006649 | 3300003781 | Bacteria | 5326 |
| 9 | Ga0055534_1000097 | 3300003784 | Bacteria | 67619 |
| 10 | Ga0055528_1000028 | 3300003790 | Bacteria | 122843 |
| 11 | Ga0065704_10070834 | 3300005289 | Bacteria | 15592 |
| 12 | Ga0065715_10136940 | 3300005293 | Bacteria | 1912 |
| 13 | Ga0070658_10389527 | 3300005327 | Bacteria | 1196 |
| 14 | Ga0070676_10013817 | 3300005328 | Bacteria | 4428 |
| 15 | Ga0070670_100020961 | 3300005331 | Bacteria | 5620 |
| 16 | Ga0070670_100030754 | 3300005331 | Bacteria | 4624 |
| 17 | Ga0070677_10023445 | 3300005333 | Bacteria | 2285 |
| 18 | Ga0068869_100025986 | 3300005334 | Bacteria | 4072 |
| 19 | Ga0070666_10001770 | 3300005335 | Bacteria | 13158 |
| 20 | Ga0070680_100032493 | 3300005336 | Bacteria | 4201 |
| 21 | Ga0070682_100122118 | 3300005337 | Bacteria | 1751 |
| 22 | Ga0068868_100000251 | 3300005338 | Bacteria | 36463 |
| 23 | Ga0068868_100019112 | 3300005338 | Bacteria | 5131 |
| 24 | Ga0070660_100106762 | 3300005339 | Bacteria | 2224 |
| 25 | Ga0070661_100070755 | 3300005344 | Bacteria | 2566 |
| 26 | Ga0070692_10046142 | 3300005345 | Bacteria | 2251 |
| 27 | Ga0070668_100000931 | 3300005347 | Bacteria | 20414 |
| 28 | Ga0070668_100001991 | 3300005347 | Bacteria | 14936 |
| 29 | Ga0070668_100049556 | 3300005347 | Bacteria | 3232 |
| 30 | Ga0070675_100008689 | 3300005354 | Bacteria | 7888 |
| 31 | Ga0070671_100000147 | 3300005355 | Bacteria | 45831 |
| 32 | Ga0070671_100003860 | 3300005355 | Bacteria | 11782 |
| 33 | Ga0070671_100252472 | 3300005355 | Bacteria | 1498 |
| 34 | Ga0070674_100006852 | 3300005356 | Bacteria | 6679 |
| 35 | Ga0070673_100240471 | 3300005364 | Bacteria | 1574 |
| 36 | Ga0070659_100040441 | 3300005366 | Bacteria | 3643 |
| 37 | Ga0070659_100285179 | 3300005366 | Bacteria | 1374 |
| 38 | Ga0070667_100010651 | 3300005367 | Bacteria | 7594 |
| 39 | Ga0070667_100057923 | 3300005367 | Bacteria | 3275 |
| 40 | Ga0070667_100072788 | 3300005367 | Bacteria | 2929 |
| 41 | Ga0070714_100109857 | 3300005435 | Bacteria | 2440 |
| 42 | Ga0070714_100332491 | 3300005435 | Bacteria | 1423 |
| 43 | Ga0070713_100000043 | 3300005436 | Bacteria | 78780 |
| 44 | Ga0070713_100010169 | 3300005436 | Bacteria | 6786 |
| 45 | Ga0070713_100356658 | 3300005436 | Bacteria | 1358 |
| 46 | Ga0070663_100011253 | 3300005455 | Bacteria | 5609 |
| 47 | Ga0070663_100264158 | 3300005455 | Bacteria | 1366 |
| 48 | Ga0070681_10212081 | 3300005458 | Bacteria | 1852 |
| 49 | Ga0068867_100000931 | 3300005459 | Bacteria | 19919 |
| 50 | Ga0068867_100214255 | 3300005459 | Bacteria | 1549 |
| 51 | Ga0070685_10080166 | 3300005466 | Bacteria | 1955 |
| 52 | Ga0070706_100068800 | 3300005467 | Bacteria | 3274 |
| 53 | Ga0070707_100032291 | 3300005468 | Bacteria | 4987 |
| 54 | Ga0070699_100074181 | 3300005518 | Bacteria | 2960 |
| 55 | Ga0070684_100085327 | 3300005535 | Bacteria | 2800 |
| 56 | Ga0070697_100000782 | 3300005536 | Bacteria | 23898 |
| 57 | Ga0070697_100030878 | 3300005536 | Bacteria | 4306 |
| 58 | Ga0068853_100010332 | 3300005539 | Bacteria | 7550 |
| 59 | Ga0068853_100199251 | 3300005539 | Bacteria | 1822 |
| 60 | Ga0070695_100069486 | 3300005545 | Bacteria | 2302 |
| 61 | Ga0070693_100004813 | 3300005547 | Bacteria | 6432 |
| 62 | Ga0070693_100010953 | 3300005547 | Bacteria | 4558 |
| 63 | Ga0070693_100017112 | 3300005547 | Bacteria | 3763 |
| 64 | Ga0070665_100000388 | 3300005548 | Bacteria | 64921 |
| 65 | Ga0068855_100232127 | 3300005563 | Bacteria | 2065 |
| 66 | Ga0068854_100116581 | 3300005578 | Bacteria | 2021 |
| 67 | Ga0070702_100017108 | 3300005615 | Bacteria | 3733 |
| 68 | Ga0070702_100188503 | 3300005615 | Bacteria | 1355 |
| 69 | Ga0068852_100000774 | 3300005616 | Bacteria | 21091 |
| 70 | Ga0068859_100309517 | 3300005617 | Bacteria | 1673 |
| 71 | Ga0068859_100636786 | 3300005617 | Bacteria | 1158 |
| 72 | Ga0068864_100002476 | 3300005618 | Bacteria | 15245 |
| 73 | Ga0068866_10319257 | 3300005718 | Bacteria | 976 |
| 74 | Ga0068861_100024143 | 3300005719 | Bacteria | 4393 |
| 75 | Ga0068870_10001213 | 3300005840 | Bacteria | 10363 |
| 76 | Ga0068863_100005160 | 3300005841 | Bacteria | 12884 |
| 77 | Ga0068863_100099187 | 3300005841 | Bacteria | 2767 |
| 78 | Ga0068858_100026645 | 3300005842 | Bacteria | 5369 |
| 79 | Ga0068858_100027896 | 3300005842 | Bacteria | 5245 |
| 80 | Ga0068860_100001999 | 3300005843 | Bacteria | 21493 |
| 81 | Ga0068860_100028864 | 3300005843 | Bacteria | 5338 |
| 82 | Ga0068860_100115271 | 3300005843 | Bacteria | 2569 |
| 83 | Ga0068860_100211754 | 3300005843 | Bacteria | 1880 |
| 84 | Ga0081455_10017896 | 3300005937 | Bacteria | 6772 |
| 85 | Ga0081455_10260591 | 3300005937 | Bacteria | 1263 |
| 86 | Ga0081540_1023948 | 3300005983 | Bacteria | 3554 |
| 87 | Ga0081540_1043030 | 3300005983 | Bacteria | 2322 |
| 88 | Ga0070717_10516028 | 3300006028 | Bacteria | 1081 |
| 89 | Ga0070717_10540527 | 3300006028 | Bacteria | 1055 |
| 90 | Ga0075364_10036703 | 3300006051 | Bacteria | 3169 |
| 91 | Ga0075364_10254293 | 3300006051 | Bacteria | 1194 |
| 92 | Ga0070716_100078610 | 3300006173 | Bacteria | 1962 |
| 93 | Ga0070712_100040774 | 3300006175 | Bacteria | 3184 |
| 94 | Ga0070712_100043951 | 3300006175 | Bacteria | 3078 |
| 95 | Ga0070712_100070045 | 3300006175 | Bacteria | 2504 |
| 96 | Ga0070712_100545381 | 3300006175 | Bacteria | 976 |
| 97 | Ga0075367_10104005 | 3300006178 | Bacteria | 1738 |
| 98 | Ga0075369_10029589 | 3300006186 | Bacteria | 2302 |
| 99 | Ga0075366_10064730 | 3300006195 | Bacteria | 2174 |
| 100 | Ga0097621_100004369 | 3300006237 | Bacteria | 9829 |
| 101 | Ga0097621_100008598 | 3300006237 | Bacteria | 7361 |
| 102 | Ga0097621_100018468 | 3300006237 | Bacteria | 5328 |
| 103 | Ga0097621_100028142 | 3300006237 | Bacteria | 4428 |
| 104 | Ga0097621_100661194 | 3300006237 | Bacteria | 959 |
| 105 | Ga0068871_100003397 | 3300006358 | Bacteria | 10939 |
| 106 | Ga0068871_100124296 | 3300006358 | Bacteria | 2182 |
| 107 | Ga0068871_100352839 | 3300006358 | Bacteria | 1301 |
| 108 | Ga0075428_100362884 | 3300006844 | Bacteria | 1554 |
| 109 | Ga0075430_100110956 | 3300006846 | Bacteria | 2287 |
| 110 | Ga0075431_100091380 | 3300006847 | Bacteria | 3142 |
| 111 | Ga0075431_100120795 | 3300006847 | Bacteria | 2703 |
| 112 | Ga0075431_100264213 | 3300006847 | Bacteria | 1746 |
| 113 | Ga0075434_100671115 | 3300006871 | Bacteria | 1054 |
| 114 | Ga0068865_100157594 | 3300006881 | Bacteria | 1728 |
| 115 | Ga0068865_100478553 | 3300006881 | Bacteria | 1034 |
| 116 | Ga0075436_100000569 | 3300006914 | Bacteria | 24112 |
| 117 | Ga0097620_100309527 | 3300006931 | Bacteria | 1673 |
| 118 | Ga0097620_100636773 | 3300006931 | Bacteria | 1158 |
| 119 | Ga0075435_100281318 | 3300007076 | Bacteria | 1420 |
| 120 | Ga0099794_10023221 | 3300007265 | Bacteria | 2834 |
| 121 | Ga0105251_10001297 | 3300009011 | Bacteria | 21587 |
| 122 | Ga0105240_11142168 | 3300009093 | Bacteria | 827 |
| 123 | Ga0111539_10084621 | 3300009094 | Bacteria | 3728 |
| 124 | Ga0111539_10167174 | 3300009094 | Bacteria | 2571 |
| 125 | Ga0105245_10014044 | 3300009098 | Bacteria | 6974 |
| 126 | Ga0105245_10044269 | 3300009098 | Bacteria | 3972 |
| 127 | Ga0105245_10380684 | 3300009098 | Bacteria | 1405 |
| 128 | Ga0105245_10830318 | 3300009098 | Bacteria | 963 |
| 129 | Ga0114129_10216619 | 3300009147 | Bacteria | 2585 |
| 130 | Ga0105243_10147783 | 3300009148 | Bacteria | 2013 |
| 131 | Ga0105243_10262403 | 3300009148 | Bacteria | 1547 |
| 132 | Ga0105241_10099435 | 3300009174 | Bacteria | 2310 |
| 133 | Ga0105242_10496122 | 3300009176 | Bacteria | 1160 |
| 134 | Ga0105248_10079767 | 3300009177 | Bacteria | 3678 |
| 135 | Ga0105248_10248921 | 3300009177 | Bacteria | 2001 |
| 136 | Ga0105248_10553795 | 3300009177 | Bacteria | 1297 |
| 137 | Ga0105237_10065844 | 3300009545 | Bacteria | 3618 |
| 138 | Ga0105238_10087333 | 3300009551 | Bacteria | 3106 |
| 139 | Ga0099796_10006826 | 3300010159 | Bacteria | 2946 |
| 140 | Ga0105239_10311742 | 3300010375 | Bacteria | 1773 |
| 141 | Ga0105246_10523884 | 3300011119 | Bacteria | 1011 |
| 142 | Ga0157373_10038548 | 3300013100 | Bacteria | 3425 |
| 143 | Ga0157373_10145482 | 3300013100 | Bacteria | 1667 |
| 144 | Ga0157373_10185511 | 3300013100 | Bacteria | 1465 |
| 145 | Ga0157370_10171993 | 3300013104 | Bacteria | 2013 |
| 146 | Ga0157370_10315463 | 3300013104 | Bacteria | 1443 |
| 147 | Ga0157369_10079069 | 3300013105 | Bacteria | 3523 |
| 148 | Ga0157374_10065379 | 3300013296 | Bacteria | 3415 |
| 149 | Ga0157378_10141238 | 3300013297 | Bacteria | 2236 |
| 150 | Ga0157378_10197590 | 3300013297 | Bacteria | 1900 |
| 151 | Ga0157378_10250983 | 3300013297 | Bacteria | 1694 |
| 152 | Ga0163162_10084790 | 3300013306 | Bacteria | 3244 |
| 153 | Ga0157375_10000660 | 3300013308 | Bacteria | 30488 |
| 154 | Ga0157375_10144319 | 3300013308 | Bacteria | 2510 |
| 155 | Ga0157380_10490841 | 3300014326 | Bacteria | 1190 |
| 156 | Ga0157376_10118216 | 3300014969 | Bacteria | 2345 |
| 157 | Ga0157376_10129524 | 3300014969 | Bacteria | 2249 |
| 158 | Ga0157376_10290036 | 3300014969 | Bacteria | 1544 |
| 159 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 160 | Ga0163161_10034689 | 3300017792 | Bacteria | 3610 |
| 161 | Ga0163161_10140472 | 3300017792 | Unclassified | 1829 |
| 162 | Ga0213872_10037469 | 3300021361 | Bacteria | 2214 |
| 163 | Ga0224572_1003853 | 3300024225 | Bacteria | 2563 |
| 164 | Ga0209563_105632 | 3300025230 | Bacteria | 2242 |
| 165 | Ga0209565_1000034 | 3300025263 | Bacteria | 312950 |
| 166 | Ga0209673_1000039 | 3300025273 | Bacteria | 312950 |
| 167 | Ga0209675_1000023 | 3300025291 | Bacteria | 312950 |
| 168 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 169 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 170 | Ga0209564_1000017 | 3300025295 | Bacteria | 594063 |
| 171 | Ga0209564_1000066 | 3300025295 | Bacteria | 312899 |
| 172 | Ga0209256_1000048 | 3300025299 | Bacteria | 312899 |
| 173 | Ga0207697_10073902 | 3300025315 | Bacteria | 1431 |
| 174 | Ga0207656_10066721 | 3300025321 | Bacteria | 1591 |
| 175 | Ga0207713_1018959 | 3300025735 | Bacteria | 3386 |
| 176 | Ga0207682_10000208 | 3300025893 | Bacteria | 26659 |
| 177 | Ga0207692_10092655 | 3300025898 | Bacteria | 1642 |
| 178 | Ga0207680_10085646 | 3300025903 | Bacteria | 1991 |
| 179 | Ga0207680_10493866 | 3300025903 | Bacteria | 871 |
| 180 | Ga0207699_10208949 | 3300025906 | Bacteria | 1327 |
| 181 | Ga0207645_10003503 | 3300025907 | Bacteria | 11878 |
| 182 | Ga0207645_10074337 | 3300025907 | Bacteria | 2175 |
| 183 | Ga0207705_10089670 | 3300025909 | Bacteria | 2250 |
| 184 | Ga0207705_10238342 | 3300025909 | Bacteria | 1385 |
| 185 | Ga0207684_10097977 | 3300025910 | Bacteria | 2504 |
| 186 | Ga0207684_10557521 | 3300025910 | Bacteria | 980 |
| 187 | Ga0207654_10179669 | 3300025911 | Bacteria | 1380 |
| 188 | Ga0207671_10194163 | 3300025914 | Bacteria | 1584 |
| 189 | Ga0207693_10017710 | 3300025915 | Bacteria | 5681 |
| 190 | Ga0207693_10022692 | 3300025915 | Bacteria | 4987 |
| 191 | Ga0207693_10435697 | 3300025915 | Bacteria | 1025 |
| 192 | Ga0207657_10035857 | 3300025919 | Bacteria | 4443 |
| 193 | Ga0207657_10068236 | 3300025919 | Bacteria | 3021 |
| 194 | Ga0207649_10065003 | 3300025920 | Bacteria | 2308 |
| 195 | Ga0207646_10102481 | 3300025922 | Bacteria | 2566 |
| 196 | Ga0207681_10094152 | 3300025923 | Bacteria | 2146 |
| 197 | Ga0207694_10441020 | 3300025924 | Bacteria | 1086 |
| 198 | Ga0207650_10143635 | 3300025925 | Bacteria | 1878 |
| 199 | Ga0207659_10011009 | 3300025926 | Bacteria | 5699 |
| 200 | Ga0207687_10403184 | 3300025927 | Bacteria | 1125 |
| 201 | Ga0207700_10000018 | 3300025928 | Bacteria | 191007 |
| 202 | Ga0207700_10022336 | 3300025928 | Bacteria | 4340 |
| 203 | Ga0207664_10002752 | 3300025929 | Bacteria | 11671 |
| 204 | Ga0207644_10000260 | 3300025931 | Bacteria | 35523 |
| 205 | Ga0207644_10334758 | 3300025931 | Bacteria | 1226 |
| 206 | Ga0207690_10034562 | 3300025932 | Bacteria | 3258 |
| 207 | Ga0207706_10014497 | 3300025933 | Bacteria | 7145 |
| 208 | Ga0207706_10056431 | 3300025933 | Bacteria | 3462 |
| 209 | Ga0207706_10147721 | 3300025933 | Bacteria | 2068 |
| 210 | Ga0207686_10044890 | 3300025934 | Bacteria | 2716 |
| 211 | Ga0207686_10319463 | 3300025934 | Bacteria | 1159 |
| 212 | Ga0207709_10198666 | 3300025935 | Bacteria | 1430 |
| 213 | Ga0207669_10095763 | 3300025937 | Bacteria | 1946 |
| 214 | Ga0207669_10342892 | 3300025937 | Bacteria | 1151 |
| 215 | Ga0207704_10109764 | 3300025938 | Bacteria | 1862 |
| 216 | Ga0207665_10030754 | 3300025939 | Bacteria | 3550 |
| 217 | Ga0207665_10071706 | 3300025939 | Bacteria | 2365 |
| 218 | Ga0207691_10000003 | 3300025940 | Bacteria | 183620 |
| 219 | Ga0207711_10004213 | 3300025941 | Bacteria | 12314 |
| 220 | Ga0207711_10034255 | 3300025941 | Bacteria | 4301 |
| 221 | Ga0207689_10010187 | 3300025942 | Bacteria | 8100 |
| 222 | Ga0207689_10089668 | 3300025942 | Bacteria | 2526 |
| 223 | Ga0207667_10116248 | 3300025949 | Bacteria | 2756 |
| 224 | Ga0207651_10002123 | 3300025960 | Bacteria | 9360 |
| 225 | Ga0207651_10083531 | 3300025960 | Bacteria | 2310 |
| 226 | Ga0207668_10001184 | 3300025972 | Bacteria | 15496 |
| 227 | Ga0207668_10011621 | 3300025972 | Bacteria | 5356 |
| 228 | Ga0207668_10336821 | 3300025972 | Bacteria | 1257 |
| 229 | Ga0207640_10031863 | 3300025981 | Bacteria | 3263 |
| 230 | Ga0207658_10014111 | 3300025986 | Bacteria | 5472 |
| 231 | Ga0207658_10136198 | 3300025986 | Bacteria | 1980 |
| 232 | Ga0207658_10207661 | 3300025986 | Bacteria | 1639 |
| 233 | Ga0207703_10019876 | 3300026035 | Bacteria | 5249 |
| 234 | Ga0207703_10255638 | 3300026035 | Bacteria | 1581 |
| 235 | Ga0207703_10394643 | 3300026035 | Bacteria | 1283 |
| 236 | Ga0207639_10058414 | 3300026041 | Bacteria | 2967 |
| 237 | Ga0207639_10066412 | 3300026041 | Bacteria | 2803 |
| 238 | Ga0207639_10492069 | 3300026041 | Bacteria | 1119 |
| 239 | Ga0207678_10016230 | 3300026067 | Bacteria | 6535 |
| 240 | Ga0207678_10421230 | 3300026067 | Bacteria | 1158 |
| 241 | Ga0207702_10041574 | 3300026078 | Bacteria | 3855 |
| 242 | Ga0207641_10002524 | 3300026088 | Bacteria | 16859 |
| 243 | Ga0207641_10348751 | 3300026088 | Bacteria | 1410 |
| 244 | Ga0207648_10001803 | 3300026089 | Bacteria | 23470 |
| 245 | Ga0207676_10432787 | 3300026095 | Bacteria | 1236 |
| 246 | Ga0207674_10015506 | 3300026116 | Bacteria | 8370 |
| 247 | Ga0207683_10000008 | 3300026121 | Bacteria | 164709 |
| 248 | Ga0207698_10011811 | 3300026142 | Bacteria | 5683 |
| 249 | Ga0207698_10039523 | 3300026142 | Bacteria | 3496 |
| 250 | Ga0207698_10599434 | 3300026142 | Bacteria | 1086 |
| 251 | Ga0268266_10000795 | 3300028379 | Bacteria | 42021 |
| 252 | Ga0268266_10009638 | 3300028379 | Bacteria | 8494 |
| 253 | Ga0268264_10002501 | 3300028381 | Bacteria | 16156 |
| 254 | Ga0268264_10132059 | 3300028381 | Bacteria | 2215 |
| 255 | Ga0268264_10187121 | 3300028381 | Unclassified | 1885 |
| 256 | Ga0268264_10284757 | 3300028381 | Bacteria | 1550 |
| 257 | Ga0265763_1000746 | 3300030763 | Bacteria | 2120 |
| 258 | Ga0265760_10010834 | 3300031090 | Bacteria | 2604 |
| 259 | Ga0265331_10011145 | 3300031250 | Bacteria | 4931 |
| 260 | Ga0307408_100030411 | 3300031548 | Bacteria | 3750 |
| 261 | Ga0307413_10143754 | 3300031824 | Bacteria | 1652 |
| 262 | Ga0307410_10291032 | 3300031852 | Bacteria | 1285 |
| 263 | Ga0307407_10049079 | 3300031903 | Bacteria | 2407 |
| 264 | Ga0307414_10030069 | 3300032004 | Bacteria | 3544 |
| 265 | Ga0373940_0053914 | 3300035088 | Bacteria | 1136 |
| 266 | Ga0373944_0001621 | 3300035089 | Bacteria | 5691 |
| 267 | Ga0373943_0000716 | 3300035170 | Bacteria | 14508 |
| 268 | Ga0373946_0000131 | 3300035171 | Bacteria | 22392 |
| 269 | Ga0373946_0027473 | 3300035171 | Bacteria | 2251 |
| 270 | Ga0373931_0067149 | 3300035691 | Bacteria | 1948 |
| 271 | Ga0373935_0000624 | 3300035692 | Bacteria | 18568 |
| 272 | Ga0373927_0001029 | 3300035695 | Bacteria | 21244 |
| 273 | Ga0373927_0004312 | 3300035695 | Bacteria | 9981 |
| 274 | Ga0373927_0019249 | 3300035695 | Bacteria | 4477 |
| 275 | Ga0373933_0086195 | 3300035724 | Bacteria | 1932 |
| 276 | Ga0373947_0002242 | 3300035725 | Bacteria | 11693 |
| 277 | Ga0373947_0028312 | 3300035725 | Bacteria | 3284 |
| 278 | Ga0373947_0052255 | 3300035725 | Bacteria | 2461 |
| 279 | Ga0373937_0012793 | 3300036401 | Bacteria | 7388 |
| 280 | Ga0373925_0003204 | 3300037068 | Bacteria | 12797 |
| 281 | Ga0373925_0530904 | 3300037068 | Bacteria | 967 |
| 282 | Ga0436365_1223105 | 3300039437 | Bacteria | 1714 |
| 283 | Ga0436361_1133989 | 3300039447 | Bacteria | 3440 |
| 284 | Ga0436363_0725099 | 3300039450 | Bacteria | 5008 |
| 285 | Ga0439436_0000942 | 3300041404 | Bacteria | 8012 |
| 286 | Ga0439465_0005308 | 3300041413 | Bacteria | 4117 |
| 287 | Ga0439465_0064249 | 3300041413 | Bacteria | 1221 |
| 288 | Ga0439449_0014950 | 3300042007 | Bacteria | 2917 |
| 289 | Ga0439449_0015004 | 3300042007 | Bacteria | 2911 |
| 290 | Ga0439457_056694 | 3300042014 | Bacteria | 884 |
| 291 | Ga0466963_0148029 | 3300044694 | Bacteria | 1630 |
| 292 | Ga0466957_0123636 | 3300044842 | Bacteria | 1651 |
| 293 | Ga0495592_0069599 | 3300046454 | Bacteria | 2565 |
| 294 | Ga0495592_0170046 | 3300046454 | Bacteria | 1493 |
| 295 | Ga0495629_0073345 | 3300046459 | Bacteria | 2390 |
| 296 | Ga0495638_0029756 | 3300046460 | Bacteria | 3522 |
| 297 | Ga0495651_0313544 | 3300046462 | Bacteria | 1048 |
| 298 | Ga0495653_0023473 | 3300046463 | Bacteria | 4982 |
| 299 | Ga0495582_0318409 | 3300046473 | Bacteria | 895 |
| 300 | Ga0495662_0003849 | 3300046476 | Bacteria | 7566 |
| 301 | Ga0495664_0000558 | 3300046477 | Bacteria | 18752 |
| 302 | Ga0495664_0032338 | 3300046477 | Bacteria | 3069 |
| 303 | Ga0495618_0001619 | 3300046514 | Bacteria | 15047 |
| 304 | Ga0495628_0033791 | 3300046516 | Bacteria | 4119 |
| 305 | Ga0495630_0069801 | 3300046517 | Bacteria | 2643 |
| 306 | Ga0495630_0245119 | 3300046517 | Bacteria | 1369 |
| 307 | Ga0495666_0013713 | 3300046526 | Bacteria | 4041 |
| 308 | Ga0495652_0020027 | 3300046529 | Bacteria | 5950 |
| 309 | Ga0495652_0165928 | 3300046529 | Bacteria | 1709 |
| 310 | Ga0495665_0004325 | 3300046531 | Bacteria | 7665 |
| 311 | Ga0495665_0026915 | 3300046531 | Bacteria | 3087 |
| 312 | Ga0495640_0002309 | 3300046533 | Bacteria | 15307 |
| 313 | Ga0495640_0063749 | 3300046533 | Bacteria | 2494 |
| 314 | Ga0495640_0135297 | 3300046533 | Bacteria | 1592 |
| 315 | Ga0495586_0038656 | 3300046535 | Bacteria | 2564 |
| 316 | Ga0495587_0219863 | 3300046536 | Bacteria | 1071 |
| 317 | Ga0495621_0120009 | 3300046539 | Bacteria | 1015 |
| 318 | Ga0495645_0003820 | 3300046543 | Bacteria | 10243 |
| 319 | Ga0495645_0009215 | 3300046543 | Bacteria | 6899 |
| 320 | Ga0495667_0206157 | 3300046559 | Bacteria | 1257 |
| 321 | Ga0495656_0002880 | 3300046615 | Bacteria | 5764 |
| 322 | Ga0495668_0276963 | 3300046616 | Bacteria | 919 |
| 323 | Ga0495634_0002929 | 3300046642 | Bacteria | 13950 |
| 324 | Ga0495634_0155826 | 3300046642 | Bacteria | 1442 |
| 325 | Ga0495635_0000394 | 3300046663 | Bacteria | 27871 |
| 326 | Ga0495635_0199247 | 3300046663 | Bacteria | 1358 |
| 327 | Ga0495635_0316892 | 3300046663 | Bacteria | 1044 |
| 328 | Ga0495657_0250581 | 3300046675 | Bacteria | 1066 |
| 329 | Ga0495599_0007699 | 3300046678 | Bacteria | 6539 |
| 330 | Ga0495599_0024127 | 3300046678 | Bacteria | 3803 |
| 331 | Ga0495599_0090712 | 3300046678 | Bacteria | 1907 |
| 332 | Ga0495623_0033838 | 3300046679 | Bacteria | 3279 |
| 333 | Ga0495646_0077507 | 3300046680 | Bacteria | 1944 |
| 334 | Ga0495658_0058919 | 3300046683 | Bacteria | 2198 |
| 335 | Ga0495613_0059932 | 3300046689 | Bacteria | 2788 |
| 336 | Ga0495613_0165034 | 3300046689 | Bacteria | 1574 |
| 337 | Ga0495624_0004695 | 3300046690 | Bacteria | 9946 |
| 338 | Ga0495624_0013086 | 3300046690 | Bacteria | 5659 |
| 339 | Ga0495581_0000954 | 3300047315 | Bacteria | 15546 |
| 340 | Ga0495604_0017089 | 3300047317 | Bacteria | 5804 |
| 341 | Ga0495604_0154447 | 3300047317 | Bacteria | 1627 |
| 342 | Ga0495636_0014483 | 3300047318 | Bacteria | 3136 |
| 343 | Ga0495674_0207611 | 3300047319 | Bacteria | 1623 |
| 344 | Ga0495680_0050198 | 3300047322 | Bacteria | 3263 |
| 345 | Ga0495677_0027705 | 3300047445 | Bacteria | 2056 |
| 346 | Ga0495684_0004039 | 3300047471 | Bacteria | 11449 |
| 347 | Ga0495684_0007879 | 3300047471 | Bacteria | 8244 |
| 348 | Ga0495684_0020398 | 3300047471 | Bacteria | 5107 |
| 349 | Ga0495593_0026808 | 3300047673 | Bacteria | 3178 |
| 350 | Ga0495602_0034664 | 3300048088 | Bacteria | 4718 |
| 351 | Ga0496101_0529407 | 3300048904 | Bacteria | 932 |
| 352 | Ga0496102_0058395 | 3300048905 | Bacteria | 3525 |
| 353 | Ga0496102_0636208 | 3300048905 | Bacteria | 990 |
| 354 | Ga0496103_0020169 | 3300048906 | Bacteria | 4003 |
| 355 | Ga0496103_0024306 | 3300048906 | Bacteria | 3656 |
| 356 | Ga0496104_0118835 | 3300048907 | Bacteria | 2538 |
| 357 | Ga0496106_0083830 | 3300048909 | Bacteria | 2452 |
| 358 | Ga0496109_0118615 | 3300048912 | Bacteria | 2463 |
| 359 | Ga0496110_0037635 | 3300048913 | Bacteria | 4205 |
| 360 | Ga0496111_0145892 | 3300048914 | Bacteria | 1754 |
| 361 | Ga0496111_0223115 | 3300048914 | Bacteria | 1400 |
| 362 | Ga0496113_0215184 | 3300048916 | Bacteria | 1530 |
| 363 | Ga0496114_0011749 | 3300048917 | Bacteria | 7004 |
| 364 | Ga0496114_0090810 | 3300048917 | Bacteria | 2593 |
| 365 | Ga0496114_0599192 | 3300048917 | Bacteria | 972 |
| 366 | Ga0496116_0024272 | 3300048919 | Bacteria | 4489 |
| 367 | Ga0496117_0075984 | 3300048920 | Bacteria | 2229 |
| 368 | Ga0496121_0005669 | 3300048924 | Bacteria | 15881 |
| 369 | Ga0496121_0016490 | 3300048924 | Bacteria | 7625 |
| 370 | Ga0496122_0071162 | 3300048925 | Bacteria | 2480 |
| 371 | Ga0496123_0026152 | 3300048926 | Bacteria | 4381 |
| 372 | Ga0496123_0037472 | 3300048926 | Bacteria | 3423 |
| 373 | Ga0496124_0027479 | 3300048927 | Bacteria | 5106 |
| 374 | Ga0496124_0140281 | 3300048927 | Bacteria | 1908 |
| 375 | Ga0496124_0240454 | 3300048927 | Bacteria | 1347 |
| 376 | Ga0496124_0257205 | 3300048927 | Bacteria | 1287 |
| 377 | Ga0496125_0045459 | 3300048928 | Bacteria | 3694 |
| 378 | Ga0496126_0008044 | 3300048929 | Bacteria | 11438 |
| 379 | Ga0496126_0015023 | 3300048929 | Bacteria | 7805 |
| 380 | Ga0501032_0204007 | 3300049569 | Bacteria | 1290 |
| 381 | Ga0501033_0000971 | 3300049570 | Bacteria | 26029 |
| 382 | Ga0501034_0001242 | 3300049571 | Bacteria | 34633 |
| 383 | Ga0501034_0061039 | 3300049571 | Bacteria | 3787 |
| 384 | Ga0501047_0377488 | 3300049581 | Bacteria | 1252 |
| 385 | Ga0501067_0085073 | 3300049583 | Bacteria | 1755 |
| 386 | Ga0501067_0136505 | 3300049583 | Bacteria | 1366 |
| 387 | Ga0501069_0077539 | 3300049585 | Bacteria | 1868 |
| 388 | Ga0501070_0007457 | 3300049586 | Bacteria | 9292 |
| 389 | Ga0501072_0314083 | 3300049588 | Bacteria | 1245 |
| 390 | Ga0501073_0078525 | 3300049589 | Bacteria | 2297 |
| 391 | Ga0501238_001394 | 3300049671 | Bacteria | 2800 |
| 392 | Ga0501083_0378993 | 3300049744 | Bacteria | 920 |
| 393 | Ga0501035_0019717 | 3300049822 | Bacteria | 6195 |
| 394 | Ga0501044_0029392 | 3300049823 | Bacteria | 5796 |
| 395 | nmdc:mga03n38_180498_c1 | 3300050490 | Bacteria | 1081 |
| 396 | nmdc:mga00v17_41732_c1 | 3300050491 | Bacteria | 2757 |
| 397 | nmdc:mga0k408_15360_c1 | 3300050493 | Bacteria | 4233 |
| 398 | nmdc:mga05p37_117601_c1 | 3300050507 | Bacteria | 3266 |
| 399 | nmdc:mga05p37_37783_c1 | 3300050507 | Bacteria | 5923 |
| 400 | nmdc:mga05p37_507137_c1 | 3300050507 | Bacteria | 1383 |
| 401 | nmdc:mga09592_309030_c1 | 3300050508 | Bacteria | 1370 |
| 402 | nmdc:mga06r32_105908_c1 | 3300050510 | Bacteria | 2763 |
| 403 | nmdc:mga06r32_27457_c1 | 3300050510 | Bacteria | 5317 |
| 404 | nmdc:mga0n895_40572_c1 | 3300050512 | Bacteria | 4521 |
| 405 | nmdc:mga0rr50_4389_c1 | 3300050513 | Bacteria | 8285 |
| 406 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 407 | Ga0495601_0005339 | 3300053077 | Bacteria | 7483 |
| 408 | Ga0495601_0045857 | 3300053077 | Bacteria | 2750 |
| 409 | Ga0495601_0125131 | 3300053077 | Bacteria | 1672 |
| 410 | Ga0495601_0195176 | 3300053077 | Bacteria | 1323 |
| 411 | Ga0495612_0000175 | 3300053078 | Bacteria | 26975 |
| 412 | Ga0495595_0027058 | 3300053084 | Bacteria | 2552 |
| 413 | Ga0495619_0005780 | 3300053085 | Bacteria | 7837 |
| 414 | Ga0495619_0046594 | 3300053085 | Bacteria | 2851 |
| 415 | Ga0495619_0103109 | 3300053085 | Bacteria | 1943 |
| 416 | Ga0495619_0234551 | 3300053085 | Bacteria | 1271 |
| 417 | Ga0495619_0357237 | 3300053085 | Bacteria | 1010 |
| 418 | Ga0500643_002023 | 3300053087 | Bacteria | 10898 |
| 419 | Ga0500644_0005103 | 3300053088 | Bacteria | 3308 |
| 420 | Ga0500651_0019316 | 3300053093 | Bacteria | 4233 |
| 421 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 422 | Ga0500595_066675 | 3300053119 | Bacteria | 1076 |
| 423 | Ga0500616_0083045 | 3300053153 | Bacteria | 1605 |
| 424 | Ga0500616_0137592 | 3300053153 | Bacteria | 1145 |
| 425 | Ga0500622_0056458 | 3300053156 | Bacteria | 2010 |
| 426 | Ga0500627_0005141 | 3300053158 | Bacteria | 4307 |
| 427 | Ga0500636_0000722 | 3300053177 | Bacteria | 17777 |
| 428 | Ga0530510_0102131 | 3300061734 | Bacteria | 2097 |
| 429 | 2545673823 | 2545555834 | Bacteria | 8130841 |
| 430 | 2643816744 | 2643221559 | Bacteria | 4424915 |
| 431 | 2643880879 | 2643221573 | Bacteria | 4784121 |
| 432 | 2643905261 | 2643221579 | Bacteria | 4443405 |
| 433 | 2643914943 | 2643221581 | Bacteria | 3893603 |
| 434 | 2643938576 | 2643221586 | Bacteria | 4446529 |
| 435 | 2644077677 | 2643221612 | Bacteria | 4361984 |
| 436 | 2644694008 | 2643221727 | Bacteria | 4415595 |
| 437 | 2644699530 | 2643221728 | Bacteria | 4797149 |
| 438 | 2774872903 | 2773857925 | Bacteria | 6472445 |
| 439 | 2776271017 | 2775506902 | Bacteria | 6208009 |
| 440 | 2776282909 | 2775506904 | Bacteria | 5954060 |
| 441 | 2821445742 | 2821443989 | Bacteria | 7658172 |
| 442 | 2882457941 | 2882456835 | Bacteria | 6863978 |
| 443 | 2894232887 | 2894232714 | Bacteria | 8834183 |
| 444 | 2917557026 | 2917554339 | Bacteria | 4987857 |
| 445 | 2919675835 | 2919675420 | Bacteria | 3969095 |
| 446 | 2923517372 | 2923516293 | Bacteria | 3716336 |
| 447 | 2941493102 | 2941489479 | Bacteria | 6313767 |
| 448 | 2995953152 | 2995948881 | Bacteria | 6358104 |
| 449 | 642486816 | 641522639 | Bacteria | 7737025 |
| 450 | Ga0495657_0143425 | |||
| 451 | JGI25151J46595_10000063 | |||
| 452 | rootL2_10048151 | |||
| 453 | Ga0055526_1000091 | |||
| 454 | Ga0055526_1000126 | |||
| 455 | Ga0055537_1000088 | |||
| 456 | Ga0055524_1000074 | |||
| 457 | Ga0055536_1006649 | |||
| 458 | Ga0055534_1000097 | |||
| 459 | Ga0055528_1000028 | |||
| 460 | Ga0065704_10070834 | |||
| 461 | Ga0065715_10136940 | |||
| 462 | Ga0070658_10389527 | |||
| 463 | Ga0070676_10013817 | |||
| 464 | Ga0070670_100020961 | |||
| 465 | Ga0070670_100030754 | |||
| 466 | Ga0070677_10023445 | |||
| 467 | Ga0068869_100025986 | |||
| 468 | Ga0070666_10001770 | |||
| 469 | Ga0070680_100032493 | |||
| 470 | Ga0070682_100122118 | |||
| 471 | Ga0068868_100000251 | |||
| 472 | Ga0068868_100019112 | |||
| 473 | Ga0070660_100106762 | |||
| 474 | Ga0070661_100070755 | |||
| 475 | Ga0070692_10046142 | |||
| 476 | Ga0070668_100000931 | |||
| 477 | Ga0070668_100001991 | |||
| 478 | Ga0070668_100049556 | |||
| 479 | Ga0070675_100008689 | |||
| 480 | Ga0070671_100000147 | |||
| 481 | Ga0070671_100003860 | |||
| 482 | Ga0070671_100252472 | |||
| 483 | Ga0070674_100006852 | |||
| 484 | Ga0070673_100240471 | |||
| 485 | Ga0070659_100040441 | |||
| 486 | Ga0070659_100285179 | |||
| 487 | Ga0070667_100010651 | |||
| 488 | Ga0070667_100057923 | |||
| 489 | Ga0070667_100072788 | |||
| 490 | Ga0070714_100109857 | |||
| 491 | Ga0070714_100332491 | |||
| 492 | Ga0070713_100000043 | |||
| 493 | Ga0070713_100010169 | |||
| 494 | Ga0070713_100356658 | |||
| 495 | Ga0070663_100011253 | |||
| 496 | Ga0070663_100264158 | |||
| 497 | Ga0070681_10212081 | |||
| 498 | Ga0068867_100000931 | |||
| 499 | Ga0068867_100214255 | |||
| 500 | Ga0070685_10080166 | |||
| 501 | Ga0070706_100068800 | |||
| 502 | Ga0070707_100032291 | |||
| 503 | Ga0070699_100074181 | |||
| 504 | Ga0070684_100085327 | |||
| 505 | Ga0070697_100000782 | |||
| 506 | Ga0070697_100030878 | |||
| 507 | Ga0068853_100010332 | |||
| 508 | Ga0068853_100199251 | |||
| 509 | Ga0070695_100069486 | |||
| 510 | Ga0070693_100004813 | |||
| 511 | Ga0070693_100010953 | |||
| 512 | Ga0070693_100017112 | |||
| 513 | Ga0070665_100000388 | |||
| 514 | Ga0068855_100232127 | |||
| 515 | Ga0068854_100116581 | |||
| 516 | Ga0070702_100017108 | |||
| 517 | Ga0070702_100188503 | |||
| 518 | Ga0068852_100000774 | |||
| 519 | Ga0068859_100309517 | |||
| 520 | Ga0068859_100636786 | |||
| 521 | Ga0068864_100002476 | |||
| 522 | Ga0068866_10319257 | |||
| 523 | Ga0068861_100024143 | |||
| 524 | Ga0068870_10001213 | |||
| 525 | Ga0068863_100005160 | |||
| 526 | Ga0068863_100099187 | |||
| 527 | Ga0068858_100026645 | |||
| 528 | Ga0068858_100027896 | |||
| 529 | Ga0068860_100001999 | |||
| 530 | Ga0068860_100028864 | |||
| 531 | Ga0068860_100115271 | |||
| 532 | Ga0068860_100211754 | |||
| 533 | Ga0081455_10017896 | |||
| 534 | Ga0081455_10260591 | |||
| 535 | Ga0081540_1023948 | |||
| 536 | Ga0081540_1043030 | |||
| 537 | Ga0070717_10516028 | |||
| 538 | Ga0070717_10540527 | |||
| 539 | Ga0075364_10036703 | |||
| 540 | Ga0075364_10254293 | |||
| 541 | Ga0070716_100078610 | |||
| 542 | Ga0070712_100040774 | |||
| 543 | Ga0070712_100043951 | |||
| 544 | Ga0070712_100070045 | |||
| 545 | Ga0070712_100545381 | |||
| 546 | Ga0075367_10104005 | |||
| 547 | Ga0075369_10029589 | |||
| 548 | Ga0075366_10064730 | |||
| 549 | Ga0097621_100004369 | |||
| 550 | Ga0097621_100008598 | |||
| 551 | Ga0097621_100018468 | |||
| 552 | Ga0097621_100028142 | |||
| 553 | Ga0097621_100661194 | |||
| 554 | Ga0068871_100003397 | |||
| 555 | Ga0068871_100124296 | |||
| 556 | Ga0068871_100352839 | |||
| 557 | Ga0075428_100362884 | |||
| 558 | Ga0075430_100110956 | |||
| 559 | Ga0075431_100091380 | |||
| 560 | Ga0075431_100120795 | |||
| 561 | Ga0075431_100264213 | |||
| 562 | Ga0075434_100671115 | |||
| 563 | Ga0068865_100157594 | |||
| 564 | Ga0068865_100478553 | |||
| 565 | Ga0075436_100000569 | |||
| 566 | Ga0097620_100309527 | |||
| 567 | Ga0097620_100636773 | |||
| 568 | Ga0075435_100281318 | |||
| 569 | Ga0099794_10023221 | |||
| 570 | Ga0105251_10001297 | |||
| 571 | Ga0105240_11142168 | |||
| 572 | Ga0111539_10084621 | |||
| 573 | Ga0111539_10167174 | |||
| 574 | Ga0105245_10014044 | |||
| 575 | Ga0105245_10044269 | |||
| 576 | Ga0105245_10380684 | |||
| 577 | Ga0105245_10830318 | |||
| 578 | Ga0114129_10216619 | |||
| 579 | Ga0105243_10147783 | |||
| 580 | Ga0105243_10262403 | |||
| 581 | Ga0105241_10099435 | |||
| 582 | Ga0105242_10496122 | |||
| 583 | Ga0105248_10079767 | |||
| 584 | Ga0105248_10248921 | |||
| 585 | Ga0105248_10553795 | |||
| 586 | Ga0105237_10065844 | |||
| 587 | Ga0105238_10087333 | |||
| 588 | Ga0099796_10006826 | |||
| 589 | Ga0105239_10311742 | |||
| 590 | Ga0105246_10523884 | |||
| 591 | Ga0157373_10038548 | |||
| 592 | Ga0157373_10145482 | |||
| 593 | Ga0157373_10185511 | |||
| 594 | Ga0157370_10171993 | |||
| 595 | Ga0157370_10315463 | |||
| 596 | Ga0157369_10079069 | |||
| 597 | Ga0157374_10065379 | |||
| 598 | Ga0157378_10141238 | |||
| 599 | Ga0157378_10197590 | |||
| 600 | Ga0157378_10250983 | |||
| 601 | Ga0163162_10084790 | |||
| 602 | Ga0157375_10000660 | |||
| 603 | Ga0157375_10144319 | |||
| 604 | Ga0157380_10490841 | |||
| 605 | Ga0157376_10118216 | |||
| 606 | Ga0157376_10129524 | |||
| 607 | Ga0157376_10290036 | |||
| 608 | Ga0183360_10001 | |||
| 609 | Ga0163161_10034689 | |||
| 610 | Ga0163161_10140472 | |||
| 611 | Ga0213872_10037469 | |||
| 612 | Ga0224572_1003853 | |||
| 613 | Ga0209563_105632 | |||
| 614 | Ga0209565_1000034 | |||
| 615 | Ga0209673_1000039 | |||
| 616 | Ga0209675_1000023 | |||
| 617 | Ga0209676_1000027 | |||
| 618 | Ga0209025_1000014 | |||
| 619 | Ga0209564_1000017 | |||
| 620 | Ga0209564_1000066 | |||
| 621 | Ga0209256_1000048 | |||
| 622 | Ga0207697_10073902 | |||
| 623 | Ga0207656_10066721 | |||
| 624 | Ga0207713_1018959 | |||
| 625 | Ga0207682_10000208 | |||
| 626 | Ga0207692_10092655 | |||
| 627 | Ga0207680_10085646 | |||
| 628 | Ga0207680_10493866 | |||
| 629 | Ga0207699_10208949 | |||
| 630 | Ga0207645_10003503 | |||
| 631 | Ga0207645_10074337 | |||
| 632 | Ga0207705_10089670 | |||
| 633 | Ga0207705_10238342 | |||
| 634 | Ga0207684_10097977 | |||
| 635 | Ga0207684_10557521 | |||
| 636 | Ga0207654_10179669 | |||
| 637 | Ga0207671_10194163 | |||
| 638 | Ga0207693_10017710 | |||
| 639 | Ga0207693_10022692 | |||
| 640 | Ga0207693_10435697 | |||
| 641 | Ga0207657_10035857 | |||
| 642 | Ga0207657_10068236 | |||
| 643 | Ga0207649_10065003 | |||
| 644 | Ga0207646_10102481 | |||
| 645 | Ga0207681_10094152 | |||
| 646 | Ga0207694_10441020 | |||
| 647 | Ga0207650_10143635 | |||
| 648 | Ga0207659_10011009 | |||
| 649 | Ga0207687_10403184 | |||
| 650 | Ga0207700_10000018 | |||
| 651 | Ga0207700_10022336 | |||
| 652 | Ga0207664_10002752 | |||
| 653 | Ga0207644_10000260 | |||
| 654 | Ga0207644_10334758 | |||
| 655 | Ga0207690_10034562 | |||
| 656 | Ga0207706_10014497 | |||
| 657 | Ga0207706_10056431 | |||
| 658 | Ga0207706_10147721 | |||
| 659 | Ga0207686_10044890 | |||
| 660 | Ga0207686_10319463 | |||
| 661 | Ga0207709_10198666 | |||
| 662 | Ga0207669_10095763 | |||
| 663 | Ga0207669_10342892 | |||
| 664 | Ga0207704_10109764 | |||
| 665 | Ga0207665_10030754 | |||
| 666 | Ga0207665_10071706 | |||
| 667 | Ga0207691_10000003 | |||
| 668 | Ga0207711_10004213 | |||
| 669 | Ga0207711_10034255 | |||
| 670 | Ga0207689_10010187 | |||
| 671 | Ga0207689_10089668 | |||
| 672 | Ga0207667_10116248 | |||
| 673 | Ga0207651_10002123 | |||
| 674 | Ga0207651_10083531 | |||
| 675 | Ga0207668_10001184 | |||
| 676 | Ga0207668_10011621 | |||
| 677 | Ga0207668_10336821 | |||
| 678 | Ga0207640_10031863 | |||
| 679 | Ga0207658_10014111 | |||
| 680 | Ga0207658_10136198 | |||
| 681 | Ga0207658_10207661 | |||
| 682 | Ga0207703_10019876 | |||
| 683 | Ga0207703_10255638 | |||
| 684 | Ga0207703_10394643 | |||
| 685 | Ga0207639_10058414 | |||
| 686 | Ga0207639_10066412 | |||
| 687 | Ga0207639_10492069 | |||
| 688 | Ga0207678_10016230 | |||
| 689 | Ga0207678_10421230 | |||
| 690 | Ga0207702_10041574 | |||
| 691 | Ga0207641_10002524 | |||
| 692 | Ga0207641_10348751 | |||
| 693 | Ga0207648_10001803 | |||
| 694 | Ga0207676_10432787 | |||
| 695 | Ga0207674_10015506 | |||
| 696 | Ga0207683_10000008 | |||
| 697 | Ga0207698_10011811 | |||
| 698 | Ga0207698_10039523 | |||
| 699 | Ga0207698_10599434 | |||
| 700 | Ga0268266_10000795 | |||
| 701 | Ga0268266_10009638 | |||
| 702 | Ga0268264_10002501 | |||
| 703 | Ga0268264_10132059 | |||
| 704 | Ga0268264_10187121 | |||
| 705 | Ga0268264_10284757 | |||
| 706 | Ga0265763_1000746 | |||
| 707 | Ga0265760_10010834 | |||
| 708 | Ga0265331_10011145 | |||
| 709 | Ga0307408_100030411 | |||
| 710 | Ga0307413_10143754 | |||
| 711 | Ga0307410_10291032 | |||
| 712 | Ga0307407_10049079 | |||
| 713 | Ga0307414_10030069 | |||
| 714 | Ga0373940_0053914 | |||
| 715 | Ga0373944_0001621 | |||
| 716 | Ga0373943_0000716 | |||
| 717 | Ga0373946_0000131 | |||
| 718 | Ga0373946_0027473 | |||
| 719 | Ga0373931_0067149 | |||
| 720 | Ga0373935_0000624 | |||
| 721 | Ga0373927_0001029 | |||
| 722 | Ga0373927_0004312 | |||
| 723 | Ga0373927_0019249 | |||
| 724 | Ga0373933_0086195 | |||
| 725 | Ga0373947_0002242 | |||
| 726 | Ga0373947_0028312 | |||
| 727 | Ga0373947_0052255 | |||
| 728 | Ga0373937_0012793 | |||
| 729 | Ga0373925_0003204 | |||
| 730 | Ga0373925_0530904 | |||
| 731 | Ga0436365_1223105 | |||
| 732 | Ga0436361_1133989 | |||
| 733 | Ga0436363_0725099 | |||
| 734 | Ga0439436_0000942 | |||
| 735 | Ga0439465_0005308 | |||
| 736 | Ga0439465_0064249 | |||
| 737 | Ga0439449_0014950 | |||
| 738 | Ga0439449_0015004 | |||
| 739 | Ga0439457_056694 | |||
| 740 | Ga0466963_0148029 | |||
| 741 | Ga0466957_0123636 | |||
| 742 | Ga0495592_0069599 | |||
| 743 | Ga0495592_0170046 | |||
| 744 | Ga0495629_0073345 | |||
| 745 | Ga0495638_0029756 | |||
| 746 | Ga0495651_0313544 | |||
| 747 | Ga0495653_0023473 | |||
| 748 | Ga0495582_0318409 | |||
| 749 | Ga0495662_0003849 | |||
| 750 | Ga0495664_0000558 | |||
| 751 | Ga0495664_0032338 | |||
| 752 | Ga0495618_0001619 | |||
| 753 | Ga0495628_0033791 | |||
| 754 | Ga0495630_0069801 | |||
| 755 | Ga0495630_0245119 | |||
| 756 | Ga0495666_0013713 | |||
| 757 | Ga0495652_0020027 | |||
| 758 | Ga0495652_0165928 | |||
| 759 | Ga0495665_0004325 | |||
| 760 | Ga0495665_0026915 | |||
| 761 | Ga0495640_0002309 | |||
| 762 | Ga0495640_0063749 | |||
| 763 | Ga0495640_0135297 | |||
| 764 | Ga0495586_0038656 | |||
| 765 | Ga0495587_0219863 | |||
| 766 | Ga0495621_0120009 | |||
| 767 | Ga0495645_0003820 | |||
| 768 | Ga0495645_0009215 | |||
| 769 | Ga0495667_0206157 | |||
| 770 | Ga0495656_0002880 | |||
| 771 | Ga0495668_0276963 | |||
| 772 | Ga0495634_0002929 | |||
| 773 | Ga0495634_0155826 | |||
| 774 | Ga0495635_0000394 | |||
| 775 | Ga0495635_0199247 | |||
| 776 | Ga0495635_0316892 | |||
| 777 | Ga0495657_0250581 | |||
| 778 | Ga0495599_0007699 | |||
| 779 | Ga0495599_0024127 | |||
| 780 | Ga0495599_0090712 | |||
| 781 | Ga0495623_0033838 | |||
| 782 | Ga0495646_0077507 | |||
| 783 | Ga0495658_0058919 | |||
| 784 | Ga0495613_0059932 | |||
| 785 | Ga0495613_0165034 | |||
| 786 | Ga0495624_0004695 | |||
| 787 | Ga0495624_0013086 | |||
| 788 | Ga0495581_0000954 | |||
| 789 | Ga0495604_0017089 | |||
| 790 | Ga0495604_0154447 | |||
| 791 | Ga0495636_0014483 | |||
| 792 | Ga0495674_0207611 | |||
| 793 | Ga0495680_0050198 | |||
| 794 | Ga0495677_0027705 | |||
| 795 | Ga0495684_0004039 | |||
| 796 | Ga0495684_0007879 | |||
| 797 | Ga0495684_0020398 | |||
| 798 | Ga0495593_0026808 | |||
| 799 | Ga0495602_0034664 | |||
| 800 | Ga0496101_0529407 | |||
| 801 | Ga0496102_0058395 | |||
| 802 | Ga0496102_0636208 | |||
| 803 | Ga0496103_0020169 | |||
| 804 | Ga0496103_0024306 | |||
| 805 | Ga0496104_0118835 | |||
| 806 | Ga0496106_0083830 | |||
| 807 | Ga0496109_0118615 | |||
| 808 | Ga0496110_0037635 | |||
| 809 | Ga0496111_0145892 | |||
| 810 | Ga0496111_0223115 | |||
| 811 | Ga0496113_0215184 | |||
| 812 | Ga0496114_0011749 | |||
| 813 | Ga0496114_0090810 | |||
| 814 | Ga0496114_0599192 | |||
| 815 | Ga0496116_0024272 | |||
| 816 | Ga0496117_0075984 | |||
| 817 | Ga0496121_0005669 | |||
| 818 | Ga0496121_0016490 | |||
| 819 | Ga0496122_0071162 | |||
| 820 | Ga0496123_0026152 | |||
| 821 | Ga0496123_0037472 | |||
| 822 | Ga0496124_0027479 | |||
| 823 | Ga0496124_0140281 | |||
| 824 | Ga0496124_0240454 | |||
| 825 | Ga0496124_0257205 | |||
| 826 | Ga0496125_0045459 | |||
| 827 | Ga0496126_0008044 | |||
| 828 | Ga0496126_0015023 | |||
| 829 | Ga0501032_0204007 | |||
| 830 | Ga0501033_0000971 | |||
| 831 | Ga0501034_0001242 | |||
| 832 | Ga0501034_0061039 | |||
| 833 | Ga0501047_0377488 | |||
| 834 | Ga0501067_0085073 | |||
| 835 | Ga0501067_0136505 | |||
| 836 | Ga0501069_0077539 | |||
| 837 | Ga0501070_0007457 | |||
| 838 | Ga0501072_0314083 | |||
| 839 | Ga0501073_0078525 | |||
| 840 | Ga0501238_001394 | |||
| 841 | Ga0501083_0378993 | |||
| 842 | Ga0501035_0019717 | |||
| 843 | Ga0501044_0029392 | |||
| 844 | nmdc:mga03n38_180498_c1 | |||
| 845 | nmdc:mga00v17_41732_c1 | |||
| 846 | nmdc:mga0k408_15360_c1 | |||
| 847 | nmdc:mga05p37_117601_c1 | |||
| 848 | nmdc:mga05p37_37783_c1 | |||
| 849 | nmdc:mga05p37_507137_c1 | |||
| 850 | nmdc:mga09592_309030_c1 | |||
| 851 | nmdc:mga06r32_105908_c1 | |||
| 852 | nmdc:mga06r32_27457_c1 | |||
| 853 | nmdc:mga0n895_40572_c1 | |||
| 854 | nmdc:mga0rr50_4389_c1 | |||
| 855 | nmdc:mga08x19_6_c1 | |||
| 856 | Ga0495601_0005339 | |||
| 857 | Ga0495601_0045857 | |||
| 858 | Ga0495601_0125131 | |||
| 859 | Ga0495601_0195176 | |||
| 860 | Ga0495612_0000175 | |||
| 861 | Ga0495595_0027058 | |||
| 862 | Ga0495619_0005780 | |||
| 863 | Ga0495619_0046594 | |||
| 864 | Ga0495619_0103109 | |||
| 865 | Ga0495619_0234551 | |||
| 866 | Ga0495619_0357237 | |||
| 867 | Ga0500643_002023 | |||
| 868 | Ga0500644_0005103 | |||
| 869 | Ga0500651_0019316 | |||
| 870 | Ga0500595_000010 | |||
| 871 | Ga0500595_066675 | |||
| 872 | Ga0500616_0083045 | |||
| 873 | Ga0500616_0137592 | |||
| 874 | Ga0500622_0056458 | |||
| 875 | Ga0500627_0005141 | |||
| 876 | Ga0500636_0000722 | |||
| 877 | Ga0530510_0102131 | |||
| 878 | 2545673823 | |||
| 879 | 2643816744 | |||
| 880 | 2643880879 | |||
| 881 | 2643905261 | |||
| 882 | 2643914943 | |||
| 883 | 2643938576 | |||
| 884 | 2644077677 | |||
| 885 | 2644694008 | |||
| 886 | 2644699530 | |||
| 887 | 2774872903 | |||
| 888 | 2776271017 | |||
| 889 | 2776282909 | |||
| 890 | 2821445742 | |||
| 891 | 2882457941 | |||
| 892 | 2894232887 | |||
| 893 | 2917557026 | |||
| 894 | 2919675835 | |||
| 895 | 2923517372 | |||
| 896 | 2941493102 | |||
| 897 | 2995953152 | |||
| 898 | 642486816 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8k8k-assembly1.cif.gz_A | structure of klebsiella pneumonia moda | 0.967 | 31 | 260 |
| 8k8k-assembly1.cif.gz_A | structure of klebsiella pneumonia moda | 0.9629 | 31 | 260 |
| 6nio-assembly1.cif.gz_A | crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis | 0.9458 | 31 | 260 |
| 6nio-assembly1.cif.gz_A | crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis | 0.9379 | 31 | 260 |
| 4kd5-assembly1.cif.gz_C | substrate binding domain of putative molybdenum abc transporter from clostridium difficile | 0.9377 | 31 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGU3_42_110_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9719 | 34 | 101 | 3.40.190.10 |
| af_P37329_30_103_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9699 | 34 | 97 | 3.40.190.10 |
| 6nioA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9651 | 111 | 221 | 3.40.190.10 |
| 2h5yB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9648 | 31 | 260 | 3.40.190.10 |
| 6nioA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9599 | 31 | 260 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G2GXH0-F1-model_v4 | Molybdenum ABC transporter, periplasmic molybdate-binding protein | 0.9763 | 35 | 262 |
GO:0015689
GO:0030288 GO:0030973 GO:0046872 |
| AF-A0A376YDG5-F1-model_v4 | Molybdate transporter periplasmic protein | 0.9659 | 72 | 260 |
GO:0015689
GO:0030288 GO:0030973 GO:0046872 |
| AF-G2GXH0-F1-model_v4 | Molybdenum ABC transporter, periplasmic molybdate-binding protein | 0.9638 | 35 | 262 |
GO:0015689
GO:0030288 GO:0030973 GO:0046872 |
| AF-I5BYI5-F1-model_v4 | Molybdenum ABC transporter periplasmic molybdenum-binding protein | 0.9578 | 40 | 258 |
GO:0015689
GO:0030288 GO:0030973 GO:0046872 |
| AF-A0A5M4AET4-F1-model_v4 | Molybdate ABC transporter substrate-binding protein | 0.9428 | 45 | 260 |
GO:0015689
GO:0030288 GO:0030973 GO:0046872 |