F446463

General Info

Members Datasets Scaffolds Average Seq Length
449 304 898 261

Family's Representative Sequence

Representative Sequence 3300046675|Ga0495657_0143425|Ga0495657_0143425_75_1001
Length 308
Sequence MLDGRTARWARAGRAWNGGSQGVRAPECSLCRARGLRTAELWRIAVFHRRFVVAALAAALAIAVTAPSAPAQDKVITVFAAASMKNALDDLDAAFTKKTGVKVLASYAASSALVKQIEQGAPADVYVSADLQWMDYGVEKKLVQDDTRVNLLGNRLVLIAPKDTKIGNVTIAPGFDLAGLAGKGRIAVGDVRAVPAGLYAKAALEKLGAWAAAEPKLAMTENVRAALLLVARGEAPLGIVYETDAKIEPAVKVVGVFPDDSHPPIIYPVALTVNAKPEAAQYLAFLRTQAARSIFEGYGFSFLIKPTS

Samples

Sample ID Description Type Environment
1 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
263 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
264 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
273 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
274 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
282 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
285 2643221559 Lysobacter sp. Root559 Isolate Unclassified
286 2643221573 Lysobacter sp. Root604 Isolate Unclassified
287 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
288 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
289 2643221586 Lysobacter sp. Root667 Isolate Unclassified
290 2643221612 Lysobacter sp. Root76 Isolate Unclassified
291 2643221727 Lysobacter sp. Root96 Isolate Unclassified
292 2643221728 Lysobacter sp. Root983 Isolate Unclassified
293 2773857925 Microvirga vignae BR3299 Isolate Unclassified
294 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
295 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
296 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
297 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
298 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
299 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
300 2919675420 Luteimonas terrae 4099 Isolate Unclassified
301 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
302 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
303 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
304 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.88
Metatranscriptomes 0.45
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.8
Nodule 0.67
Rhizoplane 3.34
Rhizosphere 81.07
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495657_0143425 3300046675 Bacteria 1487
2 JGI25151J46595_10000063 3300003187 Bacteria 146046
3 rootL2_10048151 3300003322 Bacteria 1646
4 Ga0055526_1000091 3300003771 Bacteria 82891
5 Ga0055526_1000126 3300003771 Bacteria 67619
6 Ga0055537_1000088 3300003773 Bacteria 66713
7 Ga0055524_1000074 3300003775 Bacteria 122843
8 Ga0055536_1006649 3300003781 Bacteria 5326
9 Ga0055534_1000097 3300003784 Bacteria 67619
10 Ga0055528_1000028 3300003790 Bacteria 122843
11 Ga0065704_10070834 3300005289 Bacteria 15592
12 Ga0065715_10136940 3300005293 Bacteria 1912
13 Ga0070658_10389527 3300005327 Bacteria 1196
14 Ga0070676_10013817 3300005328 Bacteria 4428
15 Ga0070670_100020961 3300005331 Bacteria 5620
16 Ga0070670_100030754 3300005331 Bacteria 4624
17 Ga0070677_10023445 3300005333 Bacteria 2285
18 Ga0068869_100025986 3300005334 Bacteria 4072
19 Ga0070666_10001770 3300005335 Bacteria 13158
20 Ga0070680_100032493 3300005336 Bacteria 4201
21 Ga0070682_100122118 3300005337 Bacteria 1751
22 Ga0068868_100000251 3300005338 Bacteria 36463
23 Ga0068868_100019112 3300005338 Bacteria 5131
24 Ga0070660_100106762 3300005339 Bacteria 2224
25 Ga0070661_100070755 3300005344 Bacteria 2566
26 Ga0070692_10046142 3300005345 Bacteria 2251
27 Ga0070668_100000931 3300005347 Bacteria 20414
28 Ga0070668_100001991 3300005347 Bacteria 14936
29 Ga0070668_100049556 3300005347 Bacteria 3232
30 Ga0070675_100008689 3300005354 Bacteria 7888
31 Ga0070671_100000147 3300005355 Bacteria 45831
32 Ga0070671_100003860 3300005355 Bacteria 11782
33 Ga0070671_100252472 3300005355 Bacteria 1498
34 Ga0070674_100006852 3300005356 Bacteria 6679
35 Ga0070673_100240471 3300005364 Bacteria 1574
36 Ga0070659_100040441 3300005366 Bacteria 3643
37 Ga0070659_100285179 3300005366 Bacteria 1374
38 Ga0070667_100010651 3300005367 Bacteria 7594
39 Ga0070667_100057923 3300005367 Bacteria 3275
40 Ga0070667_100072788 3300005367 Bacteria 2929
41 Ga0070714_100109857 3300005435 Bacteria 2440
42 Ga0070714_100332491 3300005435 Bacteria 1423
43 Ga0070713_100000043 3300005436 Bacteria 78780
44 Ga0070713_100010169 3300005436 Bacteria 6786
45 Ga0070713_100356658 3300005436 Bacteria 1358
46 Ga0070663_100011253 3300005455 Bacteria 5609
47 Ga0070663_100264158 3300005455 Bacteria 1366
48 Ga0070681_10212081 3300005458 Bacteria 1852
49 Ga0068867_100000931 3300005459 Bacteria 19919
50 Ga0068867_100214255 3300005459 Bacteria 1549
51 Ga0070685_10080166 3300005466 Bacteria 1955
52 Ga0070706_100068800 3300005467 Bacteria 3274
53 Ga0070707_100032291 3300005468 Bacteria 4987
54 Ga0070699_100074181 3300005518 Bacteria 2960
55 Ga0070684_100085327 3300005535 Bacteria 2800
56 Ga0070697_100000782 3300005536 Bacteria 23898
57 Ga0070697_100030878 3300005536 Bacteria 4306
58 Ga0068853_100010332 3300005539 Bacteria 7550
59 Ga0068853_100199251 3300005539 Bacteria 1822
60 Ga0070695_100069486 3300005545 Bacteria 2302
61 Ga0070693_100004813 3300005547 Bacteria 6432
62 Ga0070693_100010953 3300005547 Bacteria 4558
63 Ga0070693_100017112 3300005547 Bacteria 3763
64 Ga0070665_100000388 3300005548 Bacteria 64921
65 Ga0068855_100232127 3300005563 Bacteria 2065
66 Ga0068854_100116581 3300005578 Bacteria 2021
67 Ga0070702_100017108 3300005615 Bacteria 3733
68 Ga0070702_100188503 3300005615 Bacteria 1355
69 Ga0068852_100000774 3300005616 Bacteria 21091
70 Ga0068859_100309517 3300005617 Bacteria 1673
71 Ga0068859_100636786 3300005617 Bacteria 1158
72 Ga0068864_100002476 3300005618 Bacteria 15245
73 Ga0068866_10319257 3300005718 Bacteria 976
74 Ga0068861_100024143 3300005719 Bacteria 4393
75 Ga0068870_10001213 3300005840 Bacteria 10363
76 Ga0068863_100005160 3300005841 Bacteria 12884
77 Ga0068863_100099187 3300005841 Bacteria 2767
78 Ga0068858_100026645 3300005842 Bacteria 5369
79 Ga0068858_100027896 3300005842 Bacteria 5245
80 Ga0068860_100001999 3300005843 Bacteria 21493
81 Ga0068860_100028864 3300005843 Bacteria 5338
82 Ga0068860_100115271 3300005843 Bacteria 2569
83 Ga0068860_100211754 3300005843 Bacteria 1880
84 Ga0081455_10017896 3300005937 Bacteria 6772
85 Ga0081455_10260591 3300005937 Bacteria 1263
86 Ga0081540_1023948 3300005983 Bacteria 3554
87 Ga0081540_1043030 3300005983 Bacteria 2322
88 Ga0070717_10516028 3300006028 Bacteria 1081
89 Ga0070717_10540527 3300006028 Bacteria 1055
90 Ga0075364_10036703 3300006051 Bacteria 3169
91 Ga0075364_10254293 3300006051 Bacteria 1194
92 Ga0070716_100078610 3300006173 Bacteria 1962
93 Ga0070712_100040774 3300006175 Bacteria 3184
94 Ga0070712_100043951 3300006175 Bacteria 3078
95 Ga0070712_100070045 3300006175 Bacteria 2504
96 Ga0070712_100545381 3300006175 Bacteria 976
97 Ga0075367_10104005 3300006178 Bacteria 1738
98 Ga0075369_10029589 3300006186 Bacteria 2302
99 Ga0075366_10064730 3300006195 Bacteria 2174
100 Ga0097621_100004369 3300006237 Bacteria 9829
101 Ga0097621_100008598 3300006237 Bacteria 7361
102 Ga0097621_100018468 3300006237 Bacteria 5328
103 Ga0097621_100028142 3300006237 Bacteria 4428
104 Ga0097621_100661194 3300006237 Bacteria 959
105 Ga0068871_100003397 3300006358 Bacteria 10939
106 Ga0068871_100124296 3300006358 Bacteria 2182
107 Ga0068871_100352839 3300006358 Bacteria 1301
108 Ga0075428_100362884 3300006844 Bacteria 1554
109 Ga0075430_100110956 3300006846 Bacteria 2287
110 Ga0075431_100091380 3300006847 Bacteria 3142
111 Ga0075431_100120795 3300006847 Bacteria 2703
112 Ga0075431_100264213 3300006847 Bacteria 1746
113 Ga0075434_100671115 3300006871 Bacteria 1054
114 Ga0068865_100157594 3300006881 Bacteria 1728
115 Ga0068865_100478553 3300006881 Bacteria 1034
116 Ga0075436_100000569 3300006914 Bacteria 24112
117 Ga0097620_100309527 3300006931 Bacteria 1673
118 Ga0097620_100636773 3300006931 Bacteria 1158
119 Ga0075435_100281318 3300007076 Bacteria 1420
120 Ga0099794_10023221 3300007265 Bacteria 2834
121 Ga0105251_10001297 3300009011 Bacteria 21587
122 Ga0105240_11142168 3300009093 Bacteria 827
123 Ga0111539_10084621 3300009094 Bacteria 3728
124 Ga0111539_10167174 3300009094 Bacteria 2571
125 Ga0105245_10014044 3300009098 Bacteria 6974
126 Ga0105245_10044269 3300009098 Bacteria 3972
127 Ga0105245_10380684 3300009098 Bacteria 1405
128 Ga0105245_10830318 3300009098 Bacteria 963
129 Ga0114129_10216619 3300009147 Bacteria 2585
130 Ga0105243_10147783 3300009148 Bacteria 2013
131 Ga0105243_10262403 3300009148 Bacteria 1547
132 Ga0105241_10099435 3300009174 Bacteria 2310
133 Ga0105242_10496122 3300009176 Bacteria 1160
134 Ga0105248_10079767 3300009177 Bacteria 3678
135 Ga0105248_10248921 3300009177 Bacteria 2001
136 Ga0105248_10553795 3300009177 Bacteria 1297
137 Ga0105237_10065844 3300009545 Bacteria 3618
138 Ga0105238_10087333 3300009551 Bacteria 3106
139 Ga0099796_10006826 3300010159 Bacteria 2946
140 Ga0105239_10311742 3300010375 Bacteria 1773
141 Ga0105246_10523884 3300011119 Bacteria 1011
142 Ga0157373_10038548 3300013100 Bacteria 3425
143 Ga0157373_10145482 3300013100 Bacteria 1667
144 Ga0157373_10185511 3300013100 Bacteria 1465
145 Ga0157370_10171993 3300013104 Bacteria 2013
146 Ga0157370_10315463 3300013104 Bacteria 1443
147 Ga0157369_10079069 3300013105 Bacteria 3523
148 Ga0157374_10065379 3300013296 Bacteria 3415
149 Ga0157378_10141238 3300013297 Bacteria 2236
150 Ga0157378_10197590 3300013297 Bacteria 1900
151 Ga0157378_10250983 3300013297 Bacteria 1694
152 Ga0163162_10084790 3300013306 Bacteria 3244
153 Ga0157375_10000660 3300013308 Bacteria 30488
154 Ga0157375_10144319 3300013308 Bacteria 2510
155 Ga0157380_10490841 3300014326 Bacteria 1190
156 Ga0157376_10118216 3300014969 Bacteria 2345
157 Ga0157376_10129524 3300014969 Bacteria 2249
158 Ga0157376_10290036 3300014969 Bacteria 1544
159 Ga0183360_10001 3300015689 Bacteria 3943671
160 Ga0163161_10034689 3300017792 Bacteria 3610
161 Ga0163161_10140472 3300017792 Unclassified 1829
162 Ga0213872_10037469 3300021361 Bacteria 2214
163 Ga0224572_1003853 3300024225 Bacteria 2563
164 Ga0209563_105632 3300025230 Bacteria 2242
165 Ga0209565_1000034 3300025263 Bacteria 312950
166 Ga0209673_1000039 3300025273 Bacteria 312950
167 Ga0209675_1000023 3300025291 Bacteria 312950
168 Ga0209676_1000027 3300025292 Bacteria 560222
169 Ga0209025_1000014 3300025294 Bacteria 865448
170 Ga0209564_1000017 3300025295 Bacteria 594063
171 Ga0209564_1000066 3300025295 Bacteria 312899
172 Ga0209256_1000048 3300025299 Bacteria 312899
173 Ga0207697_10073902 3300025315 Bacteria 1431
174 Ga0207656_10066721 3300025321 Bacteria 1591
175 Ga0207713_1018959 3300025735 Bacteria 3386
176 Ga0207682_10000208 3300025893 Bacteria 26659
177 Ga0207692_10092655 3300025898 Bacteria 1642
178 Ga0207680_10085646 3300025903 Bacteria 1991
179 Ga0207680_10493866 3300025903 Bacteria 871
180 Ga0207699_10208949 3300025906 Bacteria 1327
181 Ga0207645_10003503 3300025907 Bacteria 11878
182 Ga0207645_10074337 3300025907 Bacteria 2175
183 Ga0207705_10089670 3300025909 Bacteria 2250
184 Ga0207705_10238342 3300025909 Bacteria 1385
185 Ga0207684_10097977 3300025910 Bacteria 2504
186 Ga0207684_10557521 3300025910 Bacteria 980
187 Ga0207654_10179669 3300025911 Bacteria 1380
188 Ga0207671_10194163 3300025914 Bacteria 1584
189 Ga0207693_10017710 3300025915 Bacteria 5681
190 Ga0207693_10022692 3300025915 Bacteria 4987
191 Ga0207693_10435697 3300025915 Bacteria 1025
192 Ga0207657_10035857 3300025919 Bacteria 4443
193 Ga0207657_10068236 3300025919 Bacteria 3021
194 Ga0207649_10065003 3300025920 Bacteria 2308
195 Ga0207646_10102481 3300025922 Bacteria 2566
196 Ga0207681_10094152 3300025923 Bacteria 2146
197 Ga0207694_10441020 3300025924 Bacteria 1086
198 Ga0207650_10143635 3300025925 Bacteria 1878
199 Ga0207659_10011009 3300025926 Bacteria 5699
200 Ga0207687_10403184 3300025927 Bacteria 1125
201 Ga0207700_10000018 3300025928 Bacteria 191007
202 Ga0207700_10022336 3300025928 Bacteria 4340
203 Ga0207664_10002752 3300025929 Bacteria 11671
204 Ga0207644_10000260 3300025931 Bacteria 35523
205 Ga0207644_10334758 3300025931 Bacteria 1226
206 Ga0207690_10034562 3300025932 Bacteria 3258
207 Ga0207706_10014497 3300025933 Bacteria 7145
208 Ga0207706_10056431 3300025933 Bacteria 3462
209 Ga0207706_10147721 3300025933 Bacteria 2068
210 Ga0207686_10044890 3300025934 Bacteria 2716
211 Ga0207686_10319463 3300025934 Bacteria 1159
212 Ga0207709_10198666 3300025935 Bacteria 1430
213 Ga0207669_10095763 3300025937 Bacteria 1946
214 Ga0207669_10342892 3300025937 Bacteria 1151
215 Ga0207704_10109764 3300025938 Bacteria 1862
216 Ga0207665_10030754 3300025939 Bacteria 3550
217 Ga0207665_10071706 3300025939 Bacteria 2365
218 Ga0207691_10000003 3300025940 Bacteria 183620
219 Ga0207711_10004213 3300025941 Bacteria 12314
220 Ga0207711_10034255 3300025941 Bacteria 4301
221 Ga0207689_10010187 3300025942 Bacteria 8100
222 Ga0207689_10089668 3300025942 Bacteria 2526
223 Ga0207667_10116248 3300025949 Bacteria 2756
224 Ga0207651_10002123 3300025960 Bacteria 9360
225 Ga0207651_10083531 3300025960 Bacteria 2310
226 Ga0207668_10001184 3300025972 Bacteria 15496
227 Ga0207668_10011621 3300025972 Bacteria 5356
228 Ga0207668_10336821 3300025972 Bacteria 1257
229 Ga0207640_10031863 3300025981 Bacteria 3263
230 Ga0207658_10014111 3300025986 Bacteria 5472
231 Ga0207658_10136198 3300025986 Bacteria 1980
232 Ga0207658_10207661 3300025986 Bacteria 1639
233 Ga0207703_10019876 3300026035 Bacteria 5249
234 Ga0207703_10255638 3300026035 Bacteria 1581
235 Ga0207703_10394643 3300026035 Bacteria 1283
236 Ga0207639_10058414 3300026041 Bacteria 2967
237 Ga0207639_10066412 3300026041 Bacteria 2803
238 Ga0207639_10492069 3300026041 Bacteria 1119
239 Ga0207678_10016230 3300026067 Bacteria 6535
240 Ga0207678_10421230 3300026067 Bacteria 1158
241 Ga0207702_10041574 3300026078 Bacteria 3855
242 Ga0207641_10002524 3300026088 Bacteria 16859
243 Ga0207641_10348751 3300026088 Bacteria 1410
244 Ga0207648_10001803 3300026089 Bacteria 23470
245 Ga0207676_10432787 3300026095 Bacteria 1236
246 Ga0207674_10015506 3300026116 Bacteria 8370
247 Ga0207683_10000008 3300026121 Bacteria 164709
248 Ga0207698_10011811 3300026142 Bacteria 5683
249 Ga0207698_10039523 3300026142 Bacteria 3496
250 Ga0207698_10599434 3300026142 Bacteria 1086
251 Ga0268266_10000795 3300028379 Bacteria 42021
252 Ga0268266_10009638 3300028379 Bacteria 8494
253 Ga0268264_10002501 3300028381 Bacteria 16156
254 Ga0268264_10132059 3300028381 Bacteria 2215
255 Ga0268264_10187121 3300028381 Unclassified 1885
256 Ga0268264_10284757 3300028381 Bacteria 1550
257 Ga0265763_1000746 3300030763 Bacteria 2120
258 Ga0265760_10010834 3300031090 Bacteria 2604
259 Ga0265331_10011145 3300031250 Bacteria 4931
260 Ga0307408_100030411 3300031548 Bacteria 3750
261 Ga0307413_10143754 3300031824 Bacteria 1652
262 Ga0307410_10291032 3300031852 Bacteria 1285
263 Ga0307407_10049079 3300031903 Bacteria 2407
264 Ga0307414_10030069 3300032004 Bacteria 3544
265 Ga0373940_0053914 3300035088 Bacteria 1136
266 Ga0373944_0001621 3300035089 Bacteria 5691
267 Ga0373943_0000716 3300035170 Bacteria 14508
268 Ga0373946_0000131 3300035171 Bacteria 22392
269 Ga0373946_0027473 3300035171 Bacteria 2251
270 Ga0373931_0067149 3300035691 Bacteria 1948
271 Ga0373935_0000624 3300035692 Bacteria 18568
272 Ga0373927_0001029 3300035695 Bacteria 21244
273 Ga0373927_0004312 3300035695 Bacteria 9981
274 Ga0373927_0019249 3300035695 Bacteria 4477
275 Ga0373933_0086195 3300035724 Bacteria 1932
276 Ga0373947_0002242 3300035725 Bacteria 11693
277 Ga0373947_0028312 3300035725 Bacteria 3284
278 Ga0373947_0052255 3300035725 Bacteria 2461
279 Ga0373937_0012793 3300036401 Bacteria 7388
280 Ga0373925_0003204 3300037068 Bacteria 12797
281 Ga0373925_0530904 3300037068 Bacteria 967
282 Ga0436365_1223105 3300039437 Bacteria 1714
283 Ga0436361_1133989 3300039447 Bacteria 3440
284 Ga0436363_0725099 3300039450 Bacteria 5008
285 Ga0439436_0000942 3300041404 Bacteria 8012
286 Ga0439465_0005308 3300041413 Bacteria 4117
287 Ga0439465_0064249 3300041413 Bacteria 1221
288 Ga0439449_0014950 3300042007 Bacteria 2917
289 Ga0439449_0015004 3300042007 Bacteria 2911
290 Ga0439457_056694 3300042014 Bacteria 884
291 Ga0466963_0148029 3300044694 Bacteria 1630
292 Ga0466957_0123636 3300044842 Bacteria 1651
293 Ga0495592_0069599 3300046454 Bacteria 2565
294 Ga0495592_0170046 3300046454 Bacteria 1493
295 Ga0495629_0073345 3300046459 Bacteria 2390
296 Ga0495638_0029756 3300046460 Bacteria 3522
297 Ga0495651_0313544 3300046462 Bacteria 1048
298 Ga0495653_0023473 3300046463 Bacteria 4982
299 Ga0495582_0318409 3300046473 Bacteria 895
300 Ga0495662_0003849 3300046476 Bacteria 7566
301 Ga0495664_0000558 3300046477 Bacteria 18752
302 Ga0495664_0032338 3300046477 Bacteria 3069
303 Ga0495618_0001619 3300046514 Bacteria 15047
304 Ga0495628_0033791 3300046516 Bacteria 4119
305 Ga0495630_0069801 3300046517 Bacteria 2643
306 Ga0495630_0245119 3300046517 Bacteria 1369
307 Ga0495666_0013713 3300046526 Bacteria 4041
308 Ga0495652_0020027 3300046529 Bacteria 5950
309 Ga0495652_0165928 3300046529 Bacteria 1709
310 Ga0495665_0004325 3300046531 Bacteria 7665
311 Ga0495665_0026915 3300046531 Bacteria 3087
312 Ga0495640_0002309 3300046533 Bacteria 15307
313 Ga0495640_0063749 3300046533 Bacteria 2494
314 Ga0495640_0135297 3300046533 Bacteria 1592
315 Ga0495586_0038656 3300046535 Bacteria 2564
316 Ga0495587_0219863 3300046536 Bacteria 1071
317 Ga0495621_0120009 3300046539 Bacteria 1015
318 Ga0495645_0003820 3300046543 Bacteria 10243
319 Ga0495645_0009215 3300046543 Bacteria 6899
320 Ga0495667_0206157 3300046559 Bacteria 1257
321 Ga0495656_0002880 3300046615 Bacteria 5764
322 Ga0495668_0276963 3300046616 Bacteria 919
323 Ga0495634_0002929 3300046642 Bacteria 13950
324 Ga0495634_0155826 3300046642 Bacteria 1442
325 Ga0495635_0000394 3300046663 Bacteria 27871
326 Ga0495635_0199247 3300046663 Bacteria 1358
327 Ga0495635_0316892 3300046663 Bacteria 1044
328 Ga0495657_0250581 3300046675 Bacteria 1066
329 Ga0495599_0007699 3300046678 Bacteria 6539
330 Ga0495599_0024127 3300046678 Bacteria 3803
331 Ga0495599_0090712 3300046678 Bacteria 1907
332 Ga0495623_0033838 3300046679 Bacteria 3279
333 Ga0495646_0077507 3300046680 Bacteria 1944
334 Ga0495658_0058919 3300046683 Bacteria 2198
335 Ga0495613_0059932 3300046689 Bacteria 2788
336 Ga0495613_0165034 3300046689 Bacteria 1574
337 Ga0495624_0004695 3300046690 Bacteria 9946
338 Ga0495624_0013086 3300046690 Bacteria 5659
339 Ga0495581_0000954 3300047315 Bacteria 15546
340 Ga0495604_0017089 3300047317 Bacteria 5804
341 Ga0495604_0154447 3300047317 Bacteria 1627
342 Ga0495636_0014483 3300047318 Bacteria 3136
343 Ga0495674_0207611 3300047319 Bacteria 1623
344 Ga0495680_0050198 3300047322 Bacteria 3263
345 Ga0495677_0027705 3300047445 Bacteria 2056
346 Ga0495684_0004039 3300047471 Bacteria 11449
347 Ga0495684_0007879 3300047471 Bacteria 8244
348 Ga0495684_0020398 3300047471 Bacteria 5107
349 Ga0495593_0026808 3300047673 Bacteria 3178
350 Ga0495602_0034664 3300048088 Bacteria 4718
351 Ga0496101_0529407 3300048904 Bacteria 932
352 Ga0496102_0058395 3300048905 Bacteria 3525
353 Ga0496102_0636208 3300048905 Bacteria 990
354 Ga0496103_0020169 3300048906 Bacteria 4003
355 Ga0496103_0024306 3300048906 Bacteria 3656
356 Ga0496104_0118835 3300048907 Bacteria 2538
357 Ga0496106_0083830 3300048909 Bacteria 2452
358 Ga0496109_0118615 3300048912 Bacteria 2463
359 Ga0496110_0037635 3300048913 Bacteria 4205
360 Ga0496111_0145892 3300048914 Bacteria 1754
361 Ga0496111_0223115 3300048914 Bacteria 1400
362 Ga0496113_0215184 3300048916 Bacteria 1530
363 Ga0496114_0011749 3300048917 Bacteria 7004
364 Ga0496114_0090810 3300048917 Bacteria 2593
365 Ga0496114_0599192 3300048917 Bacteria 972
366 Ga0496116_0024272 3300048919 Bacteria 4489
367 Ga0496117_0075984 3300048920 Bacteria 2229
368 Ga0496121_0005669 3300048924 Bacteria 15881
369 Ga0496121_0016490 3300048924 Bacteria 7625
370 Ga0496122_0071162 3300048925 Bacteria 2480
371 Ga0496123_0026152 3300048926 Bacteria 4381
372 Ga0496123_0037472 3300048926 Bacteria 3423
373 Ga0496124_0027479 3300048927 Bacteria 5106
374 Ga0496124_0140281 3300048927 Bacteria 1908
375 Ga0496124_0240454 3300048927 Bacteria 1347
376 Ga0496124_0257205 3300048927 Bacteria 1287
377 Ga0496125_0045459 3300048928 Bacteria 3694
378 Ga0496126_0008044 3300048929 Bacteria 11438
379 Ga0496126_0015023 3300048929 Bacteria 7805
380 Ga0501032_0204007 3300049569 Bacteria 1290
381 Ga0501033_0000971 3300049570 Bacteria 26029
382 Ga0501034_0001242 3300049571 Bacteria 34633
383 Ga0501034_0061039 3300049571 Bacteria 3787
384 Ga0501047_0377488 3300049581 Bacteria 1252
385 Ga0501067_0085073 3300049583 Bacteria 1755
386 Ga0501067_0136505 3300049583 Bacteria 1366
387 Ga0501069_0077539 3300049585 Bacteria 1868
388 Ga0501070_0007457 3300049586 Bacteria 9292
389 Ga0501072_0314083 3300049588 Bacteria 1245
390 Ga0501073_0078525 3300049589 Bacteria 2297
391 Ga0501238_001394 3300049671 Bacteria 2800
392 Ga0501083_0378993 3300049744 Bacteria 920
393 Ga0501035_0019717 3300049822 Bacteria 6195
394 Ga0501044_0029392 3300049823 Bacteria 5796
395 nmdc:mga03n38_180498_c1 3300050490 Bacteria 1081
396 nmdc:mga00v17_41732_c1 3300050491 Bacteria 2757
397 nmdc:mga0k408_15360_c1 3300050493 Bacteria 4233
398 nmdc:mga05p37_117601_c1 3300050507 Bacteria 3266
399 nmdc:mga05p37_37783_c1 3300050507 Bacteria 5923
400 nmdc:mga05p37_507137_c1 3300050507 Bacteria 1383
401 nmdc:mga09592_309030_c1 3300050508 Bacteria 1370
402 nmdc:mga06r32_105908_c1 3300050510 Bacteria 2763
403 nmdc:mga06r32_27457_c1 3300050510 Bacteria 5317
404 nmdc:mga0n895_40572_c1 3300050512 Bacteria 4521
405 nmdc:mga0rr50_4389_c1 3300050513 Bacteria 8285
406 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
407 Ga0495601_0005339 3300053077 Bacteria 7483
408 Ga0495601_0045857 3300053077 Bacteria 2750
409 Ga0495601_0125131 3300053077 Bacteria 1672
410 Ga0495601_0195176 3300053077 Bacteria 1323
411 Ga0495612_0000175 3300053078 Bacteria 26975
412 Ga0495595_0027058 3300053084 Bacteria 2552
413 Ga0495619_0005780 3300053085 Bacteria 7837
414 Ga0495619_0046594 3300053085 Bacteria 2851
415 Ga0495619_0103109 3300053085 Bacteria 1943
416 Ga0495619_0234551 3300053085 Bacteria 1271
417 Ga0495619_0357237 3300053085 Bacteria 1010
418 Ga0500643_002023 3300053087 Bacteria 10898
419 Ga0500644_0005103 3300053088 Bacteria 3308
420 Ga0500651_0019316 3300053093 Bacteria 4233
421 Ga0500595_000010 3300053119 Bacteria 275806
422 Ga0500595_066675 3300053119 Bacteria 1076
423 Ga0500616_0083045 3300053153 Bacteria 1605
424 Ga0500616_0137592 3300053153 Bacteria 1145
425 Ga0500622_0056458 3300053156 Bacteria 2010
426 Ga0500627_0005141 3300053158 Bacteria 4307
427 Ga0500636_0000722 3300053177 Bacteria 17777
428 Ga0530510_0102131 3300061734 Bacteria 2097
429 2545673823 2545555834 Bacteria 8130841
430 2643816744 2643221559 Bacteria 4424915
431 2643880879 2643221573 Bacteria 4784121
432 2643905261 2643221579 Bacteria 4443405
433 2643914943 2643221581 Bacteria 3893603
434 2643938576 2643221586 Bacteria 4446529
435 2644077677 2643221612 Bacteria 4361984
436 2644694008 2643221727 Bacteria 4415595
437 2644699530 2643221728 Bacteria 4797149
438 2774872903 2773857925 Bacteria 6472445
439 2776271017 2775506902 Bacteria 6208009
440 2776282909 2775506904 Bacteria 5954060
441 2821445742 2821443989 Bacteria 7658172
442 2882457941 2882456835 Bacteria 6863978
443 2894232887 2894232714 Bacteria 8834183
444 2917557026 2917554339 Bacteria 4987857
445 2919675835 2919675420 Bacteria 3969095
446 2923517372 2923516293 Bacteria 3716336
447 2941493102 2941489479 Bacteria 6313767
448 2995953152 2995948881 Bacteria 6358104
449 642486816 641522639 Bacteria 7737025
450 Ga0495657_0143425
451 JGI25151J46595_10000063
452 rootL2_10048151
453 Ga0055526_1000091
454 Ga0055526_1000126
455 Ga0055537_1000088
456 Ga0055524_1000074
457 Ga0055536_1006649
458 Ga0055534_1000097
459 Ga0055528_1000028
460 Ga0065704_10070834
461 Ga0065715_10136940
462 Ga0070658_10389527
463 Ga0070676_10013817
464 Ga0070670_100020961
465 Ga0070670_100030754
466 Ga0070677_10023445
467 Ga0068869_100025986
468 Ga0070666_10001770
469 Ga0070680_100032493
470 Ga0070682_100122118
471 Ga0068868_100000251
472 Ga0068868_100019112
473 Ga0070660_100106762
474 Ga0070661_100070755
475 Ga0070692_10046142
476 Ga0070668_100000931
477 Ga0070668_100001991
478 Ga0070668_100049556
479 Ga0070675_100008689
480 Ga0070671_100000147
481 Ga0070671_100003860
482 Ga0070671_100252472
483 Ga0070674_100006852
484 Ga0070673_100240471
485 Ga0070659_100040441
486 Ga0070659_100285179
487 Ga0070667_100010651
488 Ga0070667_100057923
489 Ga0070667_100072788
490 Ga0070714_100109857
491 Ga0070714_100332491
492 Ga0070713_100000043
493 Ga0070713_100010169
494 Ga0070713_100356658
495 Ga0070663_100011253
496 Ga0070663_100264158
497 Ga0070681_10212081
498 Ga0068867_100000931
499 Ga0068867_100214255
500 Ga0070685_10080166
501 Ga0070706_100068800
502 Ga0070707_100032291
503 Ga0070699_100074181
504 Ga0070684_100085327
505 Ga0070697_100000782
506 Ga0070697_100030878
507 Ga0068853_100010332
508 Ga0068853_100199251
509 Ga0070695_100069486
510 Ga0070693_100004813
511 Ga0070693_100010953
512 Ga0070693_100017112
513 Ga0070665_100000388
514 Ga0068855_100232127
515 Ga0068854_100116581
516 Ga0070702_100017108
517 Ga0070702_100188503
518 Ga0068852_100000774
519 Ga0068859_100309517
520 Ga0068859_100636786
521 Ga0068864_100002476
522 Ga0068866_10319257
523 Ga0068861_100024143
524 Ga0068870_10001213
525 Ga0068863_100005160
526 Ga0068863_100099187
527 Ga0068858_100026645
528 Ga0068858_100027896
529 Ga0068860_100001999
530 Ga0068860_100028864
531 Ga0068860_100115271
532 Ga0068860_100211754
533 Ga0081455_10017896
534 Ga0081455_10260591
535 Ga0081540_1023948
536 Ga0081540_1043030
537 Ga0070717_10516028
538 Ga0070717_10540527
539 Ga0075364_10036703
540 Ga0075364_10254293
541 Ga0070716_100078610
542 Ga0070712_100040774
543 Ga0070712_100043951
544 Ga0070712_100070045
545 Ga0070712_100545381
546 Ga0075367_10104005
547 Ga0075369_10029589
548 Ga0075366_10064730
549 Ga0097621_100004369
550 Ga0097621_100008598
551 Ga0097621_100018468
552 Ga0097621_100028142
553 Ga0097621_100661194
554 Ga0068871_100003397
555 Ga0068871_100124296
556 Ga0068871_100352839
557 Ga0075428_100362884
558 Ga0075430_100110956
559 Ga0075431_100091380
560 Ga0075431_100120795
561 Ga0075431_100264213
562 Ga0075434_100671115
563 Ga0068865_100157594
564 Ga0068865_100478553
565 Ga0075436_100000569
566 Ga0097620_100309527
567 Ga0097620_100636773
568 Ga0075435_100281318
569 Ga0099794_10023221
570 Ga0105251_10001297
571 Ga0105240_11142168
572 Ga0111539_10084621
573 Ga0111539_10167174
574 Ga0105245_10014044
575 Ga0105245_10044269
576 Ga0105245_10380684
577 Ga0105245_10830318
578 Ga0114129_10216619
579 Ga0105243_10147783
580 Ga0105243_10262403
581 Ga0105241_10099435
582 Ga0105242_10496122
583 Ga0105248_10079767
584 Ga0105248_10248921
585 Ga0105248_10553795
586 Ga0105237_10065844
587 Ga0105238_10087333
588 Ga0099796_10006826
589 Ga0105239_10311742
590 Ga0105246_10523884
591 Ga0157373_10038548
592 Ga0157373_10145482
593 Ga0157373_10185511
594 Ga0157370_10171993
595 Ga0157370_10315463
596 Ga0157369_10079069
597 Ga0157374_10065379
598 Ga0157378_10141238
599 Ga0157378_10197590
600 Ga0157378_10250983
601 Ga0163162_10084790
602 Ga0157375_10000660
603 Ga0157375_10144319
604 Ga0157380_10490841
605 Ga0157376_10118216
606 Ga0157376_10129524
607 Ga0157376_10290036
608 Ga0183360_10001
609 Ga0163161_10034689
610 Ga0163161_10140472
611 Ga0213872_10037469
612 Ga0224572_1003853
613 Ga0209563_105632
614 Ga0209565_1000034
615 Ga0209673_1000039
616 Ga0209675_1000023
617 Ga0209676_1000027
618 Ga0209025_1000014
619 Ga0209564_1000017
620 Ga0209564_1000066
621 Ga0209256_1000048
622 Ga0207697_10073902
623 Ga0207656_10066721
624 Ga0207713_1018959
625 Ga0207682_10000208
626 Ga0207692_10092655
627 Ga0207680_10085646
628 Ga0207680_10493866
629 Ga0207699_10208949
630 Ga0207645_10003503
631 Ga0207645_10074337
632 Ga0207705_10089670
633 Ga0207705_10238342
634 Ga0207684_10097977
635 Ga0207684_10557521
636 Ga0207654_10179669
637 Ga0207671_10194163
638 Ga0207693_10017710
639 Ga0207693_10022692
640 Ga0207693_10435697
641 Ga0207657_10035857
642 Ga0207657_10068236
643 Ga0207649_10065003
644 Ga0207646_10102481
645 Ga0207681_10094152
646 Ga0207694_10441020
647 Ga0207650_10143635
648 Ga0207659_10011009
649 Ga0207687_10403184
650 Ga0207700_10000018
651 Ga0207700_10022336
652 Ga0207664_10002752
653 Ga0207644_10000260
654 Ga0207644_10334758
655 Ga0207690_10034562
656 Ga0207706_10014497
657 Ga0207706_10056431
658 Ga0207706_10147721
659 Ga0207686_10044890
660 Ga0207686_10319463
661 Ga0207709_10198666
662 Ga0207669_10095763
663 Ga0207669_10342892
664 Ga0207704_10109764
665 Ga0207665_10030754
666 Ga0207665_10071706
667 Ga0207691_10000003
668 Ga0207711_10004213
669 Ga0207711_10034255
670 Ga0207689_10010187
671 Ga0207689_10089668
672 Ga0207667_10116248
673 Ga0207651_10002123
674 Ga0207651_10083531
675 Ga0207668_10001184
676 Ga0207668_10011621
677 Ga0207668_10336821
678 Ga0207640_10031863
679 Ga0207658_10014111
680 Ga0207658_10136198
681 Ga0207658_10207661
682 Ga0207703_10019876
683 Ga0207703_10255638
684 Ga0207703_10394643
685 Ga0207639_10058414
686 Ga0207639_10066412
687 Ga0207639_10492069
688 Ga0207678_10016230
689 Ga0207678_10421230
690 Ga0207702_10041574
691 Ga0207641_10002524
692 Ga0207641_10348751
693 Ga0207648_10001803
694 Ga0207676_10432787
695 Ga0207674_10015506
696 Ga0207683_10000008
697 Ga0207698_10011811
698 Ga0207698_10039523
699 Ga0207698_10599434
700 Ga0268266_10000795
701 Ga0268266_10009638
702 Ga0268264_10002501
703 Ga0268264_10132059
704 Ga0268264_10187121
705 Ga0268264_10284757
706 Ga0265763_1000746
707 Ga0265760_10010834
708 Ga0265331_10011145
709 Ga0307408_100030411
710 Ga0307413_10143754
711 Ga0307410_10291032
712 Ga0307407_10049079
713 Ga0307414_10030069
714 Ga0373940_0053914
715 Ga0373944_0001621
716 Ga0373943_0000716
717 Ga0373946_0000131
718 Ga0373946_0027473
719 Ga0373931_0067149
720 Ga0373935_0000624
721 Ga0373927_0001029
722 Ga0373927_0004312
723 Ga0373927_0019249
724 Ga0373933_0086195
725 Ga0373947_0002242
726 Ga0373947_0028312
727 Ga0373947_0052255
728 Ga0373937_0012793
729 Ga0373925_0003204
730 Ga0373925_0530904
731 Ga0436365_1223105
732 Ga0436361_1133989
733 Ga0436363_0725099
734 Ga0439436_0000942
735 Ga0439465_0005308
736 Ga0439465_0064249
737 Ga0439449_0014950
738 Ga0439449_0015004
739 Ga0439457_056694
740 Ga0466963_0148029
741 Ga0466957_0123636
742 Ga0495592_0069599
743 Ga0495592_0170046
744 Ga0495629_0073345
745 Ga0495638_0029756
746 Ga0495651_0313544
747 Ga0495653_0023473
748 Ga0495582_0318409
749 Ga0495662_0003849
750 Ga0495664_0000558
751 Ga0495664_0032338
752 Ga0495618_0001619
753 Ga0495628_0033791
754 Ga0495630_0069801
755 Ga0495630_0245119
756 Ga0495666_0013713
757 Ga0495652_0020027
758 Ga0495652_0165928
759 Ga0495665_0004325
760 Ga0495665_0026915
761 Ga0495640_0002309
762 Ga0495640_0063749
763 Ga0495640_0135297
764 Ga0495586_0038656
765 Ga0495587_0219863
766 Ga0495621_0120009
767 Ga0495645_0003820
768 Ga0495645_0009215
769 Ga0495667_0206157
770 Ga0495656_0002880
771 Ga0495668_0276963
772 Ga0495634_0002929
773 Ga0495634_0155826
774 Ga0495635_0000394
775 Ga0495635_0199247
776 Ga0495635_0316892
777 Ga0495657_0250581
778 Ga0495599_0007699
779 Ga0495599_0024127
780 Ga0495599_0090712
781 Ga0495623_0033838
782 Ga0495646_0077507
783 Ga0495658_0058919
784 Ga0495613_0059932
785 Ga0495613_0165034
786 Ga0495624_0004695
787 Ga0495624_0013086
788 Ga0495581_0000954
789 Ga0495604_0017089
790 Ga0495604_0154447
791 Ga0495636_0014483
792 Ga0495674_0207611
793 Ga0495680_0050198
794 Ga0495677_0027705
795 Ga0495684_0004039
796 Ga0495684_0007879
797 Ga0495684_0020398
798 Ga0495593_0026808
799 Ga0495602_0034664
800 Ga0496101_0529407
801 Ga0496102_0058395
802 Ga0496102_0636208
803 Ga0496103_0020169
804 Ga0496103_0024306
805 Ga0496104_0118835
806 Ga0496106_0083830
807 Ga0496109_0118615
808 Ga0496110_0037635
809 Ga0496111_0145892
810 Ga0496111_0223115
811 Ga0496113_0215184
812 Ga0496114_0011749
813 Ga0496114_0090810
814 Ga0496114_0599192
815 Ga0496116_0024272
816 Ga0496117_0075984
817 Ga0496121_0005669
818 Ga0496121_0016490
819 Ga0496122_0071162
820 Ga0496123_0026152
821 Ga0496123_0037472
822 Ga0496124_0027479
823 Ga0496124_0140281
824 Ga0496124_0240454
825 Ga0496124_0257205
826 Ga0496125_0045459
827 Ga0496126_0008044
828 Ga0496126_0015023
829 Ga0501032_0204007
830 Ga0501033_0000971
831 Ga0501034_0001242
832 Ga0501034_0061039
833 Ga0501047_0377488
834 Ga0501067_0085073
835 Ga0501067_0136505
836 Ga0501069_0077539
837 Ga0501070_0007457
838 Ga0501072_0314083
839 Ga0501073_0078525
840 Ga0501238_001394
841 Ga0501083_0378993
842 Ga0501035_0019717
843 Ga0501044_0029392
844 nmdc:mga03n38_180498_c1
845 nmdc:mga00v17_41732_c1
846 nmdc:mga0k408_15360_c1
847 nmdc:mga05p37_117601_c1
848 nmdc:mga05p37_37783_c1
849 nmdc:mga05p37_507137_c1
850 nmdc:mga09592_309030_c1
851 nmdc:mga06r32_105908_c1
852 nmdc:mga06r32_27457_c1
853 nmdc:mga0n895_40572_c1
854 nmdc:mga0rr50_4389_c1
855 nmdc:mga08x19_6_c1
856 Ga0495601_0005339
857 Ga0495601_0045857
858 Ga0495601_0125131
859 Ga0495601_0195176
860 Ga0495612_0000175
861 Ga0495595_0027058
862 Ga0495619_0005780
863 Ga0495619_0046594
864 Ga0495619_0103109
865 Ga0495619_0234551
866 Ga0495619_0357237
867 Ga0500643_002023
868 Ga0500644_0005103
869 Ga0500651_0019316
870 Ga0500595_000010
871 Ga0500595_066675
872 Ga0500616_0083045
873 Ga0500616_0137592
874 Ga0500622_0056458
875 Ga0500627_0005141
876 Ga0500636_0000722
877 Ga0530510_0102131
878 2545673823
879 2643816744
880 2643880879
881 2643905261
882 2643914943
883 2643938576
884 2644077677
885 2644694008
886 2644699530
887 2774872903
888 2776271017
889 2776282909
890 2821445742
891 2882457941
892 2894232887
893 2917557026
894 2919675835
895 2923517372
896 2941493102
897 2995953152
898 642486816

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

76

301

0.94

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

81

293

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.967 31 260
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.9629 31 260
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.9458 31 260
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.9379 31 260
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.9377 31 261
ID Description Score Start End Superfamily
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9719 34 101 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9699 34 97 3.40.190.10
6nioA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9651 111 221 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9648 31 260 3.40.190.10
6nioA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9599 31 260 3.40.190.10
ID Description Score Start End GO Terms
AF-G2GXH0-F1-model_v4 Molybdenum ABC transporter, periplasmic molybdate-binding protein 0.9763 35 262 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-A0A376YDG5-F1-model_v4 Molybdate transporter periplasmic protein 0.9659 72 260 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-G2GXH0-F1-model_v4 Molybdenum ABC transporter, periplasmic molybdate-binding protein 0.9638 35 262 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-I5BYI5-F1-model_v4 Molybdenum ABC transporter periplasmic molybdenum-binding protein 0.9578 40 258 GO:0015689
GO:0030288
GO:0030973
GO:0046872
AF-A0A5M4AET4-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9428 45 260 GO:0015689
GO:0030288
GO:0030973
GO:0046872

Map