F446353

General Info

Members Datasets Scaffolds Average Seq Length
449 231 898 264

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100012745|Ga0075431_1000127459
Length 289
Sequence MGGGPPRPSDLSSVLSAPSRTVAGVATLVSFHAHPDDECIGTGGVMRKASDEGHRVVLVVATSGEQGEVPEGFLADGEQLWQRRVAETLASAEILGVHRTEFLGYRDSGMMGRPTNQAAGSFWTTPVEEAARRLAAILREERADVLTCYDDNGGYGHPDHIQVHRVGMRAAELAGTARVFQNTINRDHLLSGLQEYAAQAAEAGVEMPDIDTTGEGFGKPQSMITAAVDVSPYLKHKRAAMRAHASQIGEQSFFLSMPAEGFGHAFGTEWFIREGQGPGITETDLLAGL

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
70 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
71 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
72 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
78 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
79 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
80 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
81 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
82 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
83 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
93 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
106 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
107 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
108 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
109 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
110 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
222 2558860280 Kutzneria sp. 744 Isolate Unclassified
223 2582580736 Prauserella sp. Am3 Isolate Unclassified
224 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
225 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
226 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
227 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
228 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
229 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
230 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
231 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0.22
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 8.46
Rhizosphere 81.96
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100012745 3300006847 Bacteria 8487
2 JGI25406J46586_10046739 3300003203 Bacteria 1480
3 rootH2_10108510 3300003320 Bacteria 2015
4 JGI25404J52841_10049235 3300003659 Bacteria 887
5 Ga0068868_100274872 3300005338 Bacteria 1424
6 Ga0070671_100471839 3300005355 Bacteria 1078
7 Ga0070709_10000147 3300005434 Bacteria 47014
8 Ga0070709_10000914 3300005434 Bacteria 16346
9 Ga0070709_10003668 3300005434 Bacteria 8248
10 Ga0070714_100018893 3300005435 Bacteria 5608
11 Ga0070714_100029497 3300005435 Bacteria 4561
12 Ga0070714_100060395 3300005435 Bacteria 3253
13 Ga0070713_100013011 3300005436 Bacteria 6127
14 Ga0070713_100014866 3300005436 Bacteria 5794
15 Ga0070713_100192420 3300005436 Bacteria 1839
16 Ga0070710_10000071 3300005437 Bacteria 46381
17 Ga0070710_10016227 3300005437 Bacteria 3785
18 Ga0070710_10076994 3300005437 Bacteria 1937
19 Ga0070710_10085382 3300005437 Bacteria 1851
20 Ga0070710_10132658 3300005437 Bacteria 1520
21 Ga0070711_100002886 3300005439 Bacteria 9899
22 Ga0070708_100026390 3300005445 Bacteria 4972
23 Ga0070708_100541009 3300005445 Bacteria 1099
24 Ga0070663_100105983 3300005455 Bacteria 2105
25 Ga0070706_100003418 3300005467 Bacteria 15659
26 Ga0070706_100006263 3300005467 Bacteria 11257
27 Ga0070706_100024585 3300005467 Bacteria 5545
28 Ga0070706_100028650 3300005467 Bacteria 5128
29 Ga0070707_100002477 3300005468 Bacteria 17592
30 Ga0070707_100004798 3300005468 Bacteria 12657
31 Ga0070707_100020611 3300005468 Bacteria 6221
32 Ga0070698_100004095 3300005471 Bacteria 16015
33 Ga0070698_100022092 3300005471 Bacteria 6661
34 Ga0070698_100116106 3300005471 Bacteria 2640
35 Ga0070698_100142048 3300005471 Bacteria 2351
36 Ga0070697_100007859 3300005536 Bacteria 8306
37 Ga0070697_100250211 3300005536 Bacteria 1515
38 Ga0068853_100094214 3300005539 Bacteria 2638
39 Ga0068857_100448975 3300005577 Bacteria 1205
40 Ga0068856_100088185 3300005614 Bacteria 3085
41 Ga0068856_100160375 3300005614 Bacteria 2259
42 Ga0068863_100239879 3300005841 Bacteria 1750
43 Ga0081540_1027577 3300005983 Bacteria 3213
44 Ga0081539_10000769 3300005985 Bacteria 63034
45 Ga0070717_10023174 3300006028 Bacteria 4915
46 Ga0070717_10027304 3300006028 Bacteria 4562
47 Ga0070717_10033220 3300006028 Bacteria 4162
48 Ga0070717_10042046 3300006028 Bacteria 3728
49 Ga0070717_10056675 3300006028 Bacteria 3238
50 Ga0070717_10140445 3300006028 Bacteria 2083
51 Ga0070717_10146855 3300006028 Bacteria 2037
52 Ga0075365_10036619 3300006038 Bacteria 3180
53 Ga0075368_10030125 3300006042 Bacteria 2100
54 Ga0075363_100026457 3300006048 Bacteria 2968
55 Ga0075363_100038612 3300006048 Bacteria 2511
56 Ga0075363_100040893 3300006048 Bacteria 2444
57 Ga0075364_10004048 3300006051 Bacteria 8419
58 Ga0075364_10067596 3300006051 Bacteria 2349
59 Ga0075364_10291097 3300006051 Unclassified 1111
60 Ga0075432_10014272 3300006058 Bacteria 2705
61 Ga0070715_10008989 3300006163 Bacteria 3505
62 Ga0070715_10089452 3300006163 Bacteria 1413
63 Ga0070716_100000400 3300006173 Bacteria 17791
64 Ga0070712_100169970 3300006175 Bacteria 1691
65 Ga0097621_100134182 3300006237 Bacteria 2110
66 Ga0075428_100127756 3300006844 Bacteria 2766
67 Ga0075428_100419293 3300006844 Bacteria 1434
68 Ga0075430_100002176 3300006846 Bacteria 16226
69 Ga0075430_100245825 3300006846 Bacteria 1483
70 Ga0075431_100000366 3300006847 Bacteria 35887
71 Ga0075431_100049895 3300006847 Bacteria 4315
72 Ga0075433_10055245 3300006852 Bacteria 3466
73 Ga0075434_100008309 3300006871 Bacteria 9642
74 Ga0075429_100077345 3300006880 Bacteria 2899
75 Ga0075436_100082921 3300006914 Bacteria 2224
76 Ga0075435_100006106 3300007076 Bacteria 8490
77 Ga0075435_100022570 3300007076 Bacteria 4855
78 Ga0111539_10021442 3300009094 Bacteria 7950
79 Ga0111539_10161779 3300009094 Bacteria 2618
80 Ga0105245_10273275 3300009098 Bacteria 1649
81 Ga0105245_10600765 3300009098 Bacteria 1127
82 Ga0114129_10001706 3300009147 Bacteria 29983
83 Ga0114129_10498339 3300009147 Bacteria 1591
84 Ga0105243_10776121 3300009148 Bacteria 942
85 Ga0105238_10079746 3300009551 Bacteria 3263
86 Ga0157378_10162294 3300013297 Bacteria 2091
87 Ga0157378_10318471 3300013297 Bacteria 1510
88 Ga0213874_10066247 3300021377 Bacteria 1143
89 Ga0207692_10000068 3300025898 Bacteria 30322
90 Ga0207692_10026305 3300025898 Bacteria 2728
91 Ga0207685_10002433 3300025905 Bacteria 4266
92 Ga0207699_10001361 3300025906 Bacteria 11626
93 Ga0207699_10001576 3300025906 Bacteria 10829
94 Ga0207699_10027315 3300025906 Bacteria 3158
95 Ga0207684_10000654 3300025910 Bacteria 40954
96 Ga0207684_10001686 3300025910 Bacteria 23486
97 Ga0207684_10050858 3300025910 Bacteria 3516
98 Ga0207684_10231288 3300025910 Bacteria 1595
99 Ga0207693_10097364 3300025915 Bacteria 2307
100 Ga0207693_10121183 3300025915 Bacteria 2054
101 Ga0207693_10166216 3300025915 Bacteria 1737
102 Ga0207663_10124783 3300025916 Bacteria 1769
103 Ga0207646_10000062 3300025922 Bacteria 151179
104 Ga0207646_10040177 3300025922 Bacteria 4207
105 Ga0207694_10046388 3300025924 Bacteria 3359
106 Ga0207700_10002032 3300025928 Bacteria 11562
107 Ga0207700_10025238 3300025928 Bacteria 4125
108 Ga0207700_10092153 3300025928 Bacteria 2395
109 Ga0207700_10182318 3300025928 Bacteria 1759
110 Ga0207700_10382892 3300025928 Bacteria 1230
111 Ga0207664_10002701 3300025929 Bacteria 11770
112 Ga0207664_10011499 3300025929 Bacteria 6296
113 Ga0207664_10021802 3300025929 Bacteria 4773
114 Ga0207664_10165102 3300025929 Bacteria 1891
115 Ga0207665_10002780 3300025939 Bacteria 11727
116 Ga0207665_10013277 3300025939 Bacteria 5415
117 Ga0207665_10014106 3300025939 Bacteria 5258
118 Ga0207658_10403695 3300025986 Bacteria 1202
119 Ga0207703_10301409 3300026035 Bacteria 1462
120 Ga0207639_10128740 3300026041 Bacteria 2092
121 Ga0207678_10126683 3300026067 Bacteria 2178
122 Ga0207702_10058111 3300026078 Bacteria 3291
123 Ga0207702_10230622 3300026078 Bacteria 1730
124 Ga0207641_10111024 3300026088 Bacteria 2431
125 Ga0207676_10526796 3300026095 Bacteria 1126
126 Ga0207683_10091172 3300026121 Bacteria 2715
127 Ga0207683_10743035 3300026121 Bacteria 910
128 Ga0207428_10038371 3300027907 Bacteria 3894
129 Ga0207428_10061492 3300027907 Bacteria 2973
130 Ga0307515_10043208 3300028794 Bacteria 7016
131 Ga0307515_10046604 3300028794 Bacteria 6620
132 Ga0307511_10000256 3300030521 Bacteria 54739
133 Ga0316177_1039698 3300030731 Bacteria 5855
134 Ga0314311_1093379 3300030733 Bacteria 7628
135 Ga0265760_10043520 3300031090 Bacteria 1342
136 Ga0307513_10163714 3300031456 Bacteria 2112
137 Ga0307509_10069787 3300031507 Bacteria 3672
138 Ga0307518_10000863 3300031838 Bacteria 22658
139 Ga0307518_10041785 3300031838 Bacteria 3338
140 Ga0307411_10011356 3300032005 Bacteria 4804
141 Ga0307507_10058236 3300033179 Bacteria 3630
142 Ga0307507_10173030 3300033179 Bacteria 1563
143 Ga0373958_0042891 3300034819 Bacteria 931
144 Ga0373929_0008200 3300035085 Bacteria 1924
145 Ga0373934_0000004 3300035086 Bacteria 87334
146 Ga0373934_0013637 3300035086 Bacteria 3076
147 Ga0373949_0042539 3300035090 Bacteria 1121
148 Ga0373951_0007194 3300035091 Bacteria 2532
149 Ga0373936_0001659 3300035113 Bacteria 8158
150 Ga0373936_0008625 3300035113 Bacteria 3840
151 Ga0373941_0055691 3300035115 Bacteria 1272
152 Ga0373945_0010235 3300035116 Bacteria 3086
153 Ga0373953_0017686 3300035117 Bacteria 2625
154 Ga0373954_0002885 3300035118 Bacteria 7254
155 Ga0373954_0013444 3300035118 Bacteria 3647
156 Ga0373954_0021572 3300035118 Bacteria 2917
157 Ga0373954_0136271 3300035118 Bacteria 1196
158 Ga0373956_0000601 3300035119 Bacteria 14759
159 Ga0373956_0005238 3300035119 Bacteria 5191
160 Ga0373956_0008578 3300035119 Bacteria 4139
161 Ga0373957_0001123 3300035120 Bacteria 7102
162 Ga0373957_0011856 3300035120 Bacteria 2920
163 Ga0373943_0097526 3300035170 Bacteria 1532
164 Ga0373955_0000025 3300035172 Bacteria 58341
165 Ga0373955_0003650 3300035172 Bacteria 6775
166 Ga0373955_0041618 3300035172 Bacteria 2463
167 Ga0373955_0070251 3300035172 Bacteria 1956
168 Ga0373962_0008769 3300035242 Bacteria 2496
169 Ga0373924_0001226 3300035410 Bacteria 8220
170 Ga0373924_0010732 3300035410 Bacteria 3388
171 Ga0373924_0039045 3300035410 Bacteria 1938
172 Ga0373931_0099739 3300035691 Bacteria 1631
173 Ga0373935_0067229 3300035692 Bacteria 2304
174 Ga0373935_0167174 3300035692 Bacteria 1502
175 Ga0373927_0053558 3300035695 Bacteria 2610
176 Ga0373933_0000119 3300035724 Bacteria 51009
177 Ga0373933_0004173 3300035724 Bacteria 7959
178 Ga0373933_0190905 3300035724 Bacteria 1308
179 Ga0373947_0043587 3300035725 Bacteria 2680
180 Ga0373937_0000306 3300036401 Bacteria 46226
181 Ga0373937_0010502 3300036401 Bacteria 8085
182 Ga0373925_0003597 3300037068 Bacteria 11945
183 Ga0373925_0062947 3300037068 Bacteria 2790
184 Ga0373925_0067504 3300037068 Bacteria 2697
185 Ga0373925_0314443 3300037068 Bacteria 1266
186 Ga0436364_0224546 3300037853 Bacteria 955
187 Ga0436361_0801166 3300039447 Bacteria 1389
188 Ga0436363_0438373 3300039450 Bacteria 1961
189 Ga0451793_0992231 3300041452 Bacteria 2637
190 Ga0451797_0553572 3300041453 Bacteria 2509
191 Ga0451800_0440619 3300041459 Bacteria 2204
192 Ga0451807_1759940 3300041486 Bacteria 2353
193 Ga0451833_0622181 3300041491 Bacteria 3336
194 Ga0451841_0491167 3300041498 Bacteria 1597
195 Ga0451843_0624484 3300041509 Bacteria 1723
196 Ga0466969_0002315 3300044656 Bacteria 10172
197 Ga0466969_0025517 3300044656 Bacteria 3037
198 Ga0466972_0002306 3300044658 Bacteria 9389
199 Ga0466972_0059919 3300044658 Bacteria 1826
200 Ga0466965_0025562 3300044683 Bacteria 2858
201 Ga0466965_0058120 3300044683 Bacteria 1928
202 Ga0466965_0069852 3300044683 Bacteria 1765
203 Ga0466963_0125223 3300044694 Bacteria 1771
204 Ga0466971_0079293 3300044719 Bacteria 1496
205 Ga0466957_0284237 3300044842 Bacteria 1108
206 Ga0466960_0009086 3300044901 Bacteria 4087
207 Ga0466959_0024010 3300045049 Bacteria 4514
208 Ga0466967_0256727 3300045976 Bacteria 1671
209 Ga0495592_0000200 3300046454 Bacteria 51023
210 Ga0495592_0041720 3300046454 Bacteria 3438
211 Ga0495592_0207679 3300046454 Bacteria 1317
212 Ga0495629_0002479 3300046459 Bacteria 14154
213 Ga0495629_0003058 3300046459 Bacteria 12714
214 Ga0495629_0140358 3300046459 Bacteria 1681
215 Ga0495641_0004811 3300046461 Bacteria 9388
216 Ga0495651_0000151 3300046462 Bacteria 51025
217 Ga0495651_0009665 3300046462 Bacteria 7416
218 Ga0495651_0063791 3300046462 Bacteria 2815
219 Ga0495653_0006911 3300046463 Bacteria 9323
220 Ga0495653_0011082 3300046463 Bacteria 7370
221 Ga0495653_0043068 3300046463 Bacteria 3512
222 Ga0495582_0007220 3300046473 Bacteria 6162
223 Ga0495582_0026156 3300046473 Bacteria 3198
224 Ga0495582_0090993 3300046473 Bacteria 1701
225 Ga0495639_0027744 3300046475 Bacteria 2507
226 Ga0495662_0002767 3300046476 Bacteria 8873
227 Ga0495662_0007668 3300046476 Bacteria 5319
228 Ga0495662_0029797 3300046476 Bacteria 2633
229 Ga0495664_0042836 3300046477 Bacteria 2682
230 Ga0495664_0070836 3300046477 Bacteria 2082
231 Ga0495664_0139120 3300046477 Bacteria 1471
232 Ga0495664_0172039 3300046477 Bacteria 1314
233 Ga0495664_0226166 3300046477 Bacteria 1132
234 Ga0495608_0000147 3300046511 Bacteria 50943
235 Ga0495608_0010300 3300046511 Bacteria 6523
236 Ga0495618_0038593 3300046514 Bacteria 3002
237 Ga0495618_0090047 3300046514 Bacteria 1962
238 Ga0495618_0345643 3300046514 Bacteria 917
239 Ga0495628_0000753 3300046516 Bacteria 29919
240 Ga0495628_0017241 3300046516 Bacteria 6014
241 Ga0495628_0034053 3300046516 Bacteria 4101
242 Ga0495628_0230954 3300046516 Bacteria 1387
243 Ga0495630_0003733 3300046517 Bacteria 10620
244 Ga0495630_0071190 3300046517 Bacteria 2616
245 Ga0495630_0091052 3300046517 Bacteria 2304
246 Ga0495630_0348215 3300046517 Bacteria 1134
247 Ga0495652_0000276 3300046529 Bacteria 60614
248 Ga0495652_0010975 3300046529 Bacteria 8208
249 Ga0495652_0045539 3300046529 Bacteria 3770
250 Ga0495652_0103797 3300046529 Bacteria 2300
251 Ga0495665_0002626 3300046531 Bacteria 9692
252 Ga0495665_0004283 3300046531 Bacteria 7713
253 Ga0495640_0028266 3300046533 Bacteria 4038
254 Ga0495640_0033642 3300046533 Bacteria 3640
255 Ga0495586_0011245 3300046535 Bacteria 4758
256 Ga0495586_0014824 3300046535 Bacteria 4142
257 Ga0495586_0021363 3300046535 Bacteria 3449
258 Ga0495587_0000045 3300046536 Bacteria 108362
259 Ga0495587_0024000 3300046536 Bacteria 3742
260 Ga0495587_0190453 3300046536 Bacteria 1161
261 Ga0495645_0059834 3300046543 Bacteria 2761
262 Ga0495645_0085497 3300046543 Bacteria 2258
263 Ga0495645_0104331 3300046543 Bacteria 2013
264 Ga0495645_0105234 3300046543 Bacteria 2002
265 Ga0495645_0114802 3300046543 Bacteria 1902
266 Ga0495667_0000051 3300046559 Bacteria 109277
267 Ga0495667_0008153 3300046559 Bacteria 7108
268 Ga0495667_0109098 3300046559 Bacteria 1788
269 Ga0495634_0004218 3300046642 Bacteria 11346
270 Ga0495635_0031178 3300046663 Bacteria 3703
271 Ga0495635_0096216 3300046663 Bacteria 2024
272 Ga0495635_0341213 3300046663 Bacteria 1000
273 Ga0495657_0000044 3300046675 Bacteria 108383
274 Ga0495657_0018429 3300046675 Bacteria 5053
275 Ga0495657_0034298 3300046675 Bacteria 3525
276 Ga0495657_0046703 3300046675 Bacteria 2930
277 Ga0495599_0000101 3300046678 Bacteria 60499
278 Ga0495599_0026352 3300046678 Bacteria 3642
279 Ga0495599_0110380 3300046678 Bacteria 1713
280 Ga0495599_0115958 3300046678 Bacteria 1666
281 Ga0495599_0151229 3300046678 Bacteria 1437
282 Ga0495623_0001529 3300046679 Bacteria 15620
283 Ga0495623_0011274 3300046679 Bacteria 5782
284 Ga0495623_0020079 3300046679 Bacteria 4319
285 Ga0495623_0075806 3300046679 Bacteria 2087
286 Ga0495646_0007263 3300046680 Bacteria 7038
287 Ga0495646_0060322 3300046680 Bacteria 2262
288 Ga0495646_0062512 3300046680 Bacteria 2213
289 Ga0495646_0102533 3300046680 Bacteria 1639
290 Ga0495658_0003103 3300046683 Bacteria 8305
291 Ga0495658_0041846 3300046683 Bacteria 2555
292 Ga0495658_0042703 3300046683 Bacteria 2532
293 Ga0495658_0313454 3300046683 Bacteria 993
294 Ga0495613_0012973 3300046689 Bacteria 6190
295 Ga0495613_0110822 3300046689 Bacteria 1977
296 Ga0495613_0186285 3300046689 Bacteria 1468
297 Ga0495624_0022702 3300046690 Bacteria 4143
298 Ga0495624_0038097 3300046690 Bacteria 3090
299 Ga0495600_0003438 3300046809 Bacteria 9308
300 Ga0495600_0011473 3300046809 Bacteria 5522
301 Ga0495600_0028588 3300046809 Bacteria 3607
302 Ga0495600_0063300 3300046809 Bacteria 2417
303 Ga0495600_0180488 3300046809 Bacteria 1360
304 Ga0495581_0002856 3300047315 Bacteria 9862
305 Ga0495581_0003056 3300047315 Bacteria 9582
306 Ga0495581_0008812 3300047315 Bacteria 5839
307 Ga0495581_0025193 3300047315 Bacteria 3450
308 Ga0495581_0252921 3300047315 Bacteria 1030
309 Ga0495604_0000046 3300047317 Bacteria 110553
310 Ga0495604_0010113 3300047317 Bacteria 7474
311 Ga0495604_0029293 3300047317 Bacteria 4379
312 Ga0495604_0093608 3300047317 Bacteria 2223
313 Ga0495674_0020387 3300047319 Bacteria 6138
314 Ga0495674_0022544 3300047319 Bacteria 5808
315 Ga0495674_0153409 3300047319 Bacteria 1931
316 Ga0495674_0183840 3300047319 Bacteria 1739
317 Ga0495674_0439766 3300047319 Bacteria 1049
318 Ga0495680_0000108 3300047322 Bacteria 77095
319 Ga0495680_0010102 3300047322 Bacteria 8440
320 Ga0495680_0048420 3300047322 Bacteria 3337
321 Ga0495680_0149693 3300047322 Bacteria 1702
322 Ga0495675_0000119 3300047444 Bacteria 57079
323 Ga0495675_0039220 3300047444 Bacteria 3016
324 Ga0495675_0185867 3300047444 Bacteria 1270
325 Ga0495684_0006104 3300047471 Bacteria 9375
326 Ga0495684_0049204 3300047471 Bacteria 3221
327 Ga0495593_0004694 3300047673 Bacteria 8127
328 Ga0495593_0021015 3300047673 Bacteria 3649
329 Ga0495593_0052120 3300047673 Bacteria 2163
330 Ga0495602_0000167 3300048088 Bacteria 61216
331 Ga0495602_0065731 3300048088 Bacteria 3128
332 Ga0495602_0101472 3300048088 Bacteria 2360
333 Ga0496100_0029463 3300048903 Bacteria 3396
334 Ga0496101_0091124 3300048904 Bacteria 2268
335 Ga0496101_0388516 3300048904 Bacteria 1098
336 Ga0496102_0002055 3300048905 Bacteria 17349
337 Ga0496103_0023923 3300048906 Bacteria 3685
338 Ga0496104_0004190 3300048907 Bacteria 12525
339 Ga0496104_0023763 3300048907 Bacteria 5636
340 Ga0496105_0001901 3300048908 Bacteria 14989
341 Ga0496105_0011165 3300048908 Bacteria 7085
342 Ga0496105_0065064 3300048908 Bacteria 3009
343 Ga0496106_0012056 3300048909 Bacteria 6378
344 Ga0496106_0250163 3300048909 Bacteria 1417
345 Ga0496107_0091730 3300048910 Bacteria 2221
346 Ga0496108_0002448 3300048911 Bacteria 14844
347 Ga0496108_0143268 3300048911 Bacteria 2059
348 Ga0496108_0162687 3300048911 Bacteria 1929
349 Ga0496109_0002062 3300048912 Bacteria 16675
350 Ga0496109_0082139 3300048912 Bacteria 2969
351 Ga0496110_0000649 3300048913 Bacteria 23779
352 Ga0496110_0064629 3300048913 Bacteria 3234
353 Ga0496111_0000119 3300048914 Bacteria 34223
354 Ga0496111_0038261 3300048914 Bacteria 3437
355 Ga0496112_0032245 3300048915 Bacteria 5087
356 Ga0496112_0086219 3300048915 Bacteria 3107
357 Ga0496112_0174837 3300048915 Bacteria 2112
358 Ga0496113_0071975 3300048916 Bacteria 2630
359 Ga0496113_0076659 3300048916 Bacteria 2554
360 Ga0496114_0008833 3300048917 Bacteria 7987
361 Ga0496114_0015102 3300048917 Bacteria 6209
362 Ga0496114_0114891 3300048917 Bacteria 2309
363 Ga0496114_0699469 3300048917 Bacteria 889
364 Ga0496115_0165732 3300048918 Bacteria 1827
365 Ga0496115_0176770 3300048918 Bacteria 1765
366 Ga0496115_0214889 3300048918 Bacteria 1588
367 Ga0501031_0021674 3300049568 Bacteria 4188
368 Ga0501032_0066582 3300049569 Bacteria 2407
369 Ga0501033_0068180 3300049570 Bacteria 2616
370 Ga0501036_0009793 3300049572 Bacteria 7892
371 Ga0501038_0054624 3300049574 Bacteria 3435
372 Ga0501039_0008520 3300049575 Bacteria 7817
373 Ga0501040_0002977 3300049576 Bacteria 10960
374 Ga0501040_0027636 3300049576 Bacteria 3821
375 Ga0501041_0020341 3300049577 Bacteria 3968
376 Ga0501042_0010071 3300049578 Bacteria 6320
377 Ga0501042_0023422 3300049578 Bacteria 4321
378 Ga0501043_0039938 3300049579 Bacteria 3689
379 Ga0501046_0062320 3300049580 Bacteria 2914
380 Ga0501048_0050440 3300049582 Bacteria 2964
381 Ga0501048_0087565 3300049582 Bacteria 2197
382 Ga0501068_0037328 3300049584 Bacteria 2909
383 Ga0501069_0071552 3300049585 Bacteria 1944
384 Ga0501071_0005594 3300049587 Bacteria 8099
385 Ga0501071_0054592 3300049587 Bacteria 2882
386 Ga0501072_0019802 3300049588 Bacteria 5206
387 Ga0501072_0092899 3300049588 Bacteria 2396
388 Ga0501074_0086370 3300049590 Bacteria 2247
389 Ga0501075_0007849 3300049591 Bacteria 7410
390 Ga0501076_0035097 3300049592 Bacteria 3923
391 Ga0501076_0063055 3300049592 Bacteria 2952
392 Ga0501077_0041477 3300049593 Bacteria 2929
393 Ga0501079_0004788 3300049741 Bacteria 10032
394 Ga0501079_0021803 3300049741 Bacteria 4904
395 Ga0501080_0027443 3300049742 Bacteria 5294
396 Ga0501080_0294033 3300049742 Bacteria 1474
397 Ga0501083_0001175 3300049744 Bacteria 17642
398 Ga0501035_0118956 3300049822 Bacteria 2311
399 Ga0501045_0017777 3300049824 Bacteria 5049
400 Ga0501045_0025947 3300049824 Bacteria 4213
401 nmdc:mga03683_53797_c1 3300050489 Bacteria 1686
402 nmdc:mga03n38_72090_c1 3300050490 Bacteria 1601
403 nmdc:mga03n38_78186_c1 3300050490 Bacteria 1548
404 nmdc:mga00v17_151597_c1 3300050491 Bacteria 1490
405 nmdc:mga00v17_36984_c1 3300050491 Bacteria 2912
406 nmdc:mga0yw44_18723_c1 3300050492 Bacteria 3801
407 nmdc:mga0yw44_22630_c1 3300050492 Bacteria 3527
408 nmdc:mga0yw44_34824_c1 3300050492 Bacteria 2953
409 nmdc:mga06z11_154858_c1 3300050494 Bacteria 1306
410 nmdc:mga06z11_72636_c1 3300050494 Bacteria 1824
411 nmdc:mga05p37_15523_c1 3300050507 Bacteria 9156
412 nmdc:mga05p37_308325_c1 3300050507 Bacteria 1877
413 nmdc:mga09592_72661_c1 3300050508 Bacteria 2921
414 nmdc:mga09592_8591_c1 3300050508 Bacteria 8308
415 nmdc:mga0qj67_204030_c1 3300050509 Bacteria 1606
416 nmdc:mga0qj67_2717_c1 3300050509 Bacteria 12681
417 nmdc:mga06r32_115561_c1 3300050510 Bacteria 2643
418 nmdc:mga06r32_323_c7 3300050510 Bacteria 16457
419 nmdc:mga06r32_9817_c1 3300050510 Bacteria 8636
420 nmdc:mga08y16_205074_c1 3300050511 Bacteria 2043
421 nmdc:mga08y16_43352_c1 3300050511 Bacteria 4715
422 nmdc:mga0n895_16343_c1 3300050512 Bacteria 6805
423 nmdc:mga0rr50_61671_c1 3300050513 Bacteria 2826
424 nmdc:mga08x19_63052_c1 3300050514 Bacteria 2404
425 nmdc:mga0a205_111472_c1 3300050515 Bacteria 2635
426 Ga0495601_0083826 3300053077 Bacteria 2047
427 Ga0495612_0056232 3300053078 Bacteria 1623
428 Ga0495612_0056777 3300053078 Bacteria 1616
429 Ga0495595_0000441 3300053084 Bacteria 15723
430 Ga0495619_0109128 3300053085 Bacteria 1889
431 Ga0495619_0226420 3300053085 Bacteria 1295
432 Ga0500577_0043563 3300053142 Bacteria 1649
433 Ga0501084_0005504 3300054114 Bacteria 10398
434 Ga0501084_0246124 3300054114 Bacteria 1509
435 Ga0501082_0117970 3300060353 Bacteria 2298
436 Ga0501082_0170355 3300060353 Bacteria 1893
437 Ga0466962_0041022 3300061719 Bacteria 2215
438 Ga0530510_0011080 3300061734 Bacteria 6325
439 Ga0530510_0016038 3300061734 Bacteria 5295
440 2559430396 2558860280 Bacteria 11429938
441 2583153053 2582580736 Bacteria 5325865
442 2586063469 2585427649 Bacteria 9053857
443 2791912452 2791354901 Bacteria 8322202
444 2795787292 2795385470 Bacteria 8317180
445 2809587378 2808606522 Bacteria 9488490
446 2866615170 2866612099 Bacteria 7543886
447 2899362552 2899359706 Bacteria 10940472
448 2915774889 2915768154 Bacteria 8424322
449 8047716752 8047710418 Bacteria 11023148
450 Ga0075431_100012745
451 JGI25406J46586_10046739
452 rootH2_10108510
453 JGI25404J52841_10049235
454 Ga0068868_100274872
455 Ga0070671_100471839
456 Ga0070709_10000147
457 Ga0070709_10000914
458 Ga0070709_10003668
459 Ga0070714_100018893
460 Ga0070714_100029497
461 Ga0070714_100060395
462 Ga0070713_100013011
463 Ga0070713_100014866
464 Ga0070713_100192420
465 Ga0070710_10000071
466 Ga0070710_10016227
467 Ga0070710_10076994
468 Ga0070710_10085382
469 Ga0070710_10132658
470 Ga0070711_100002886
471 Ga0070708_100026390
472 Ga0070708_100541009
473 Ga0070663_100105983
474 Ga0070706_100003418
475 Ga0070706_100006263
476 Ga0070706_100024585
477 Ga0070706_100028650
478 Ga0070707_100002477
479 Ga0070707_100004798
480 Ga0070707_100020611
481 Ga0070698_100004095
482 Ga0070698_100022092
483 Ga0070698_100116106
484 Ga0070698_100142048
485 Ga0070697_100007859
486 Ga0070697_100250211
487 Ga0068853_100094214
488 Ga0068857_100448975
489 Ga0068856_100088185
490 Ga0068856_100160375
491 Ga0068863_100239879
492 Ga0081540_1027577
493 Ga0081539_10000769
494 Ga0070717_10023174
495 Ga0070717_10027304
496 Ga0070717_10033220
497 Ga0070717_10042046
498 Ga0070717_10056675
499 Ga0070717_10140445
500 Ga0070717_10146855
501 Ga0075365_10036619
502 Ga0075368_10030125
503 Ga0075363_100026457
504 Ga0075363_100038612
505 Ga0075363_100040893
506 Ga0075364_10004048
507 Ga0075364_10067596
508 Ga0075364_10291097
509 Ga0075432_10014272
510 Ga0070715_10008989
511 Ga0070715_10089452
512 Ga0070716_100000400
513 Ga0070712_100169970
514 Ga0097621_100134182
515 Ga0075428_100127756
516 Ga0075428_100419293
517 Ga0075430_100002176
518 Ga0075430_100245825
519 Ga0075431_100000366
520 Ga0075431_100049895
521 Ga0075433_10055245
522 Ga0075434_100008309
523 Ga0075429_100077345
524 Ga0075436_100082921
525 Ga0075435_100006106
526 Ga0075435_100022570
527 Ga0111539_10021442
528 Ga0111539_10161779
529 Ga0105245_10273275
530 Ga0105245_10600765
531 Ga0114129_10001706
532 Ga0114129_10498339
533 Ga0105243_10776121
534 Ga0105238_10079746
535 Ga0157378_10162294
536 Ga0157378_10318471
537 Ga0213874_10066247
538 Ga0207692_10000068
539 Ga0207692_10026305
540 Ga0207685_10002433
541 Ga0207699_10001361
542 Ga0207699_10001576
543 Ga0207699_10027315
544 Ga0207684_10000654
545 Ga0207684_10001686
546 Ga0207684_10050858
547 Ga0207684_10231288
548 Ga0207693_10097364
549 Ga0207693_10121183
550 Ga0207693_10166216
551 Ga0207663_10124783
552 Ga0207646_10000062
553 Ga0207646_10040177
554 Ga0207694_10046388
555 Ga0207700_10002032
556 Ga0207700_10025238
557 Ga0207700_10092153
558 Ga0207700_10182318
559 Ga0207700_10382892
560 Ga0207664_10002701
561 Ga0207664_10011499
562 Ga0207664_10021802
563 Ga0207664_10165102
564 Ga0207665_10002780
565 Ga0207665_10013277
566 Ga0207665_10014106
567 Ga0207658_10403695
568 Ga0207703_10301409
569 Ga0207639_10128740
570 Ga0207678_10126683
571 Ga0207702_10058111
572 Ga0207702_10230622
573 Ga0207641_10111024
574 Ga0207676_10526796
575 Ga0207683_10091172
576 Ga0207683_10743035
577 Ga0207428_10038371
578 Ga0207428_10061492
579 Ga0307515_10043208
580 Ga0307515_10046604
581 Ga0307511_10000256
582 Ga0316177_1039698
583 Ga0314311_1093379
584 Ga0265760_10043520
585 Ga0307513_10163714
586 Ga0307509_10069787
587 Ga0307518_10000863
588 Ga0307518_10041785
589 Ga0307411_10011356
590 Ga0307507_10058236
591 Ga0307507_10173030
592 Ga0373958_0042891
593 Ga0373929_0008200
594 Ga0373934_0000004
595 Ga0373934_0013637
596 Ga0373949_0042539
597 Ga0373951_0007194
598 Ga0373936_0001659
599 Ga0373936_0008625
600 Ga0373941_0055691
601 Ga0373945_0010235
602 Ga0373953_0017686
603 Ga0373954_0002885
604 Ga0373954_0013444
605 Ga0373954_0021572
606 Ga0373954_0136271
607 Ga0373956_0000601
608 Ga0373956_0005238
609 Ga0373956_0008578
610 Ga0373957_0001123
611 Ga0373957_0011856
612 Ga0373943_0097526
613 Ga0373955_0000025
614 Ga0373955_0003650
615 Ga0373955_0041618
616 Ga0373955_0070251
617 Ga0373962_0008769
618 Ga0373924_0001226
619 Ga0373924_0010732
620 Ga0373924_0039045
621 Ga0373931_0099739
622 Ga0373935_0067229
623 Ga0373935_0167174
624 Ga0373927_0053558
625 Ga0373933_0000119
626 Ga0373933_0004173
627 Ga0373933_0190905
628 Ga0373947_0043587
629 Ga0373937_0000306
630 Ga0373937_0010502
631 Ga0373925_0003597
632 Ga0373925_0062947
633 Ga0373925_0067504
634 Ga0373925_0314443
635 Ga0436364_0224546
636 Ga0436361_0801166
637 Ga0436363_0438373
638 Ga0451793_0992231
639 Ga0451797_0553572
640 Ga0451800_0440619
641 Ga0451807_1759940
642 Ga0451833_0622181
643 Ga0451841_0491167
644 Ga0451843_0624484
645 Ga0466969_0002315
646 Ga0466969_0025517
647 Ga0466972_0002306
648 Ga0466972_0059919
649 Ga0466965_0025562
650 Ga0466965_0058120
651 Ga0466965_0069852
652 Ga0466963_0125223
653 Ga0466971_0079293
654 Ga0466957_0284237
655 Ga0466960_0009086
656 Ga0466959_0024010
657 Ga0466967_0256727
658 Ga0495592_0000200
659 Ga0495592_0041720
660 Ga0495592_0207679
661 Ga0495629_0002479
662 Ga0495629_0003058
663 Ga0495629_0140358
664 Ga0495641_0004811
665 Ga0495651_0000151
666 Ga0495651_0009665
667 Ga0495651_0063791
668 Ga0495653_0006911
669 Ga0495653_0011082
670 Ga0495653_0043068
671 Ga0495582_0007220
672 Ga0495582_0026156
673 Ga0495582_0090993
674 Ga0495639_0027744
675 Ga0495662_0002767
676 Ga0495662_0007668
677 Ga0495662_0029797
678 Ga0495664_0042836
679 Ga0495664_0070836
680 Ga0495664_0139120
681 Ga0495664_0172039
682 Ga0495664_0226166
683 Ga0495608_0000147
684 Ga0495608_0010300
685 Ga0495618_0038593
686 Ga0495618_0090047
687 Ga0495618_0345643
688 Ga0495628_0000753
689 Ga0495628_0017241
690 Ga0495628_0034053
691 Ga0495628_0230954
692 Ga0495630_0003733
693 Ga0495630_0071190
694 Ga0495630_0091052
695 Ga0495630_0348215
696 Ga0495652_0000276
697 Ga0495652_0010975
698 Ga0495652_0045539
699 Ga0495652_0103797
700 Ga0495665_0002626
701 Ga0495665_0004283
702 Ga0495640_0028266
703 Ga0495640_0033642
704 Ga0495586_0011245
705 Ga0495586_0014824
706 Ga0495586_0021363
707 Ga0495587_0000045
708 Ga0495587_0024000
709 Ga0495587_0190453
710 Ga0495645_0059834
711 Ga0495645_0085497
712 Ga0495645_0104331
713 Ga0495645_0105234
714 Ga0495645_0114802
715 Ga0495667_0000051
716 Ga0495667_0008153
717 Ga0495667_0109098
718 Ga0495634_0004218
719 Ga0495635_0031178
720 Ga0495635_0096216
721 Ga0495635_0341213
722 Ga0495657_0000044
723 Ga0495657_0018429
724 Ga0495657_0034298
725 Ga0495657_0046703
726 Ga0495599_0000101
727 Ga0495599_0026352
728 Ga0495599_0110380
729 Ga0495599_0115958
730 Ga0495599_0151229
731 Ga0495623_0001529
732 Ga0495623_0011274
733 Ga0495623_0020079
734 Ga0495623_0075806
735 Ga0495646_0007263
736 Ga0495646_0060322
737 Ga0495646_0062512
738 Ga0495646_0102533
739 Ga0495658_0003103
740 Ga0495658_0041846
741 Ga0495658_0042703
742 Ga0495658_0313454
743 Ga0495613_0012973
744 Ga0495613_0110822
745 Ga0495613_0186285
746 Ga0495624_0022702
747 Ga0495624_0038097
748 Ga0495600_0003438
749 Ga0495600_0011473
750 Ga0495600_0028588
751 Ga0495600_0063300
752 Ga0495600_0180488
753 Ga0495581_0002856
754 Ga0495581_0003056
755 Ga0495581_0008812
756 Ga0495581_0025193
757 Ga0495581_0252921
758 Ga0495604_0000046
759 Ga0495604_0010113
760 Ga0495604_0029293
761 Ga0495604_0093608
762 Ga0495674_0020387
763 Ga0495674_0022544
764 Ga0495674_0153409
765 Ga0495674_0183840
766 Ga0495674_0439766
767 Ga0495680_0000108
768 Ga0495680_0010102
769 Ga0495680_0048420
770 Ga0495680_0149693
771 Ga0495675_0000119
772 Ga0495675_0039220
773 Ga0495675_0185867
774 Ga0495684_0006104
775 Ga0495684_0049204
776 Ga0495593_0004694
777 Ga0495593_0021015
778 Ga0495593_0052120
779 Ga0495602_0000167
780 Ga0495602_0065731
781 Ga0495602_0101472
782 Ga0496100_0029463
783 Ga0496101_0091124
784 Ga0496101_0388516
785 Ga0496102_0002055
786 Ga0496103_0023923
787 Ga0496104_0004190
788 Ga0496104_0023763
789 Ga0496105_0001901
790 Ga0496105_0011165
791 Ga0496105_0065064
792 Ga0496106_0012056
793 Ga0496106_0250163
794 Ga0496107_0091730
795 Ga0496108_0002448
796 Ga0496108_0143268
797 Ga0496108_0162687
798 Ga0496109_0002062
799 Ga0496109_0082139
800 Ga0496110_0000649
801 Ga0496110_0064629
802 Ga0496111_0000119
803 Ga0496111_0038261
804 Ga0496112_0032245
805 Ga0496112_0086219
806 Ga0496112_0174837
807 Ga0496113_0071975
808 Ga0496113_0076659
809 Ga0496114_0008833
810 Ga0496114_0015102
811 Ga0496114_0114891
812 Ga0496114_0699469
813 Ga0496115_0165732
814 Ga0496115_0176770
815 Ga0496115_0214889
816 Ga0501031_0021674
817 Ga0501032_0066582
818 Ga0501033_0068180
819 Ga0501036_0009793
820 Ga0501038_0054624
821 Ga0501039_0008520
822 Ga0501040_0002977
823 Ga0501040_0027636
824 Ga0501041_0020341
825 Ga0501042_0010071
826 Ga0501042_0023422
827 Ga0501043_0039938
828 Ga0501046_0062320
829 Ga0501048_0050440
830 Ga0501048_0087565
831 Ga0501068_0037328
832 Ga0501069_0071552
833 Ga0501071_0005594
834 Ga0501071_0054592
835 Ga0501072_0019802
836 Ga0501072_0092899
837 Ga0501074_0086370
838 Ga0501075_0007849
839 Ga0501076_0035097
840 Ga0501076_0063055
841 Ga0501077_0041477
842 Ga0501079_0004788
843 Ga0501079_0021803
844 Ga0501080_0027443
845 Ga0501080_0294033
846 Ga0501083_0001175
847 Ga0501035_0118956
848 Ga0501045_0017777
849 Ga0501045_0025947
850 nmdc:mga03683_53797_c1
851 nmdc:mga03n38_72090_c1
852 nmdc:mga03n38_78186_c1
853 nmdc:mga00v17_151597_c1
854 nmdc:mga00v17_36984_c1
855 nmdc:mga0yw44_18723_c1
856 nmdc:mga0yw44_22630_c1
857 nmdc:mga0yw44_34824_c1
858 nmdc:mga06z11_154858_c1
859 nmdc:mga06z11_72636_c1
860 nmdc:mga05p37_15523_c1
861 nmdc:mga05p37_308325_c1
862 nmdc:mga09592_72661_c1
863 nmdc:mga09592_8591_c1
864 nmdc:mga0qj67_204030_c1
865 nmdc:mga0qj67_2717_c1
866 nmdc:mga06r32_115561_c1
867 nmdc:mga06r32_323_c7
868 nmdc:mga06r32_9817_c1
869 nmdc:mga08y16_205074_c1
870 nmdc:mga08y16_43352_c1
871 nmdc:mga0n895_16343_c1
872 nmdc:mga0rr50_61671_c1
873 nmdc:mga08x19_63052_c1
874 nmdc:mga0a205_111472_c1
875 Ga0495601_0083826
876 Ga0495612_0056232
877 Ga0495612_0056777
878 Ga0495595_0000441
879 Ga0495619_0109128
880 Ga0495619_0226420
881 Ga0500577_0043563
882 Ga0501084_0005504
883 Ga0501084_0246124
884 Ga0501082_0117970
885 Ga0501082_0170355
886 Ga0466962_0041022
887 Ga0530510_0011080
888 Ga0530510_0016038
889 2559430396
890 2583153053
891 2586063469
892 2791912452
893 2795787292
894 2809587378
895 2866615170
896 2899362552
897 2915774889
898 8047716752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

29

171

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ewl-assembly2.cif.gz_A crystal structure of mshb with glycerol and acetate bound in the active site 0.8149 1 258
4ewl-assembly2.cif.gz_A crystal structure of mshb with glycerol and acetate bound in the active site 0.809 1 258
1q7t-assembly1.cif.gz_A rv1170 (mshb) from mycobacterium tuberculosis 0.806 1 258
4ewl-assembly2.cif.gz_B crystal structure of mshb with glycerol and acetate bound in the active site 0.8026 2 258
1q7t-assembly2.cif.gz_B rv1170 (mshb) from mycobacterium tuberculosis 0.8022 1 258
ID Description Score Start End Superfamily
af_L0T643_2_220_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8549 3 244 3.40.50.10320
af_P9WJN1_3_287_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8471 1 259 3.40.50.10320
af_P9WJN1_3_287_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8441 1 259 3.40.50.10320
af_L0T643_2_220_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8071 3 244 3.40.50.10320
af_Q2G0L0_1_219_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7991 3 241 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A1H8YKQ6-F1-model_v4 N-acetylglucosaminyl deacetylase, LmbE family 0.9731 1 259 GO:0016137
GO:0016811
AF-A0A7W1PZ61-F1-model_v4 PIG-L family deacetylase 0.9723 1 144 GO:0016137
GO:0016811
AF-A0A1H8YKQ6-F1-model_v4 N-acetylglucosaminyl deacetylase, LmbE family 0.9694 1 259 GO:0016137
GO:0016811
AF-A0A353H406-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9597 2 162 GO:0016811
AF-A0A7V8YL22-F1-model_v4 PIG-L family deacetylase 0.9596 2 143 GO:0016137
GO:0016811

Map