F446142

General Info

Members Datasets Scaffolds Average Seq Length
448 298 447 287

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10020574|Ga0099795_100205741
Length 317
Sequence MTIPQTSADVVATSPSAVIAGLDPAIHPPEPKNGLAMDARVKPGHDELEFATPAIKPPRRLPVQKDWPTSAIVAAQIGILIAIIAAWEIGAATGFIDKFFWSHPSAIYHTLTIFFTTGDAFTDIAFTFRSTILGFLIGTFAGSALGLSFWWSKNYAAIVQPYIICFESLPKLALAPLIVLVFGIGIASKIAIATALTLVVSALTTFAGVKAVDPDGEKLFYSLGASRLQVFRKLVIPSCLPWIISVLRVNIGLALTGAIVGEFIASQHGLGRAIIYAGQTYDIALVWVAVSVLSALAVVMYVTVSWIERMLHRGIKA

Samples

Sample ID Description Type Environment
1 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
295 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
296 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
297 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 10.27
Rhizosphere 80.13
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10001521 3300001991 Bacteria 3237
2 JGI24744J21845_10000391 3300002077 Bacteria 7532
3 JGI24034J26672_10000964 3300002239 Bacteria 3759
4 JGI25159J45721_1000448 3300002987 Bacteria 19043
5 JGI25153J46596_10013367 3300003215 Bacteria 3470
6 rootL2_10203526 3300003322 Unclassified 2904
7 JGI25160J50197_1000103 3300003354 Bacteria 80968
8 JGI25161J50226_1001380 3300003374 Bacteria 7397
9 JGI25404J52841_10010205 3300003659 Bacteria 2017
10 Ga0055543_1000087 3300004625 Bacteria 81157
11 Ga0065165_1000776 3300005262 Bacteria 42909
12 Ga0070658_10057614 3300005327 Bacteria 3160
13 Ga0070676_10020750 3300005328 Bacteria 3673
14 Ga0070683_100366629 3300005329 Bacteria 1372
15 Ga0070690_100015208 3300005330 Bacteria 4585
16 Ga0070690_100016258 3300005330 Bacteria 4452
17 Ga0070670_100015340 3300005331 Bacteria 6580
18 Ga0070666_10015233 3300005335 Bacteria 4903
19 Ga0070680_100003405 3300005336 Bacteria 11876
20 Ga0070680_100156067 3300005336 Bacteria 1917
21 Ga0068868_100457492 3300005338 Bacteria 1111
22 Ga0070689_100006393 3300005340 Bacteria 8150
23 Ga0070687_100052865 3300005343 Bacteria 2110
24 Ga0070692_10033733 3300005345 Bacteria 2580
25 Ga0070668_100222537 3300005347 Bacteria 1557
26 Ga0070668_100400398 3300005347 Bacteria 1172
27 Ga0070675_100169840 3300005354 Bacteria 1880
28 Ga0070671_100141291 3300005355 Bacteria 2032
29 Ga0070674_100114046 3300005356 Bacteria 1990
30 Ga0070673_100141746 3300005364 Bacteria 2028
31 Ga0070673_100323081 3300005364 Bacteria 1364
32 Ga0070667_100018786 3300005367 Bacteria 5732
33 Ga0070709_10048919 3300005434 Bacteria 2640
34 Ga0070709_10509082 3300005434 Bacteria 916
35 Ga0070713_100028268 3300005436 Bacteria 4427
36 Ga0070713_100030368 3300005436 Bacteria 4291
37 Ga0070713_100056637 3300005436 Bacteria 3261
38 Ga0070713_100066720 3300005436 Bacteria 3027
39 Ga0070710_10016661 3300005437 Bacteria 3744
40 Ga0070701_10021077 3300005438 Bacteria 3104
41 Ga0070711_100190449 3300005439 Bacteria 1576
42 Ga0070700_100013170 3300005441 Bacteria 4640
43 Ga0070708_100212372 3300005445 Bacteria 1813
44 Ga0070708_100277614 3300005445 Bacteria 1577
45 Ga0070663_100281703 3300005455 Bacteria 1325
46 Ga0070678_100017455 3300005456 Bacteria 4622
47 Ga0070678_100059514 3300005456 Bacteria 2808
48 Ga0070662_100259976 3300005457 Bacteria 1398
49 Ga0070685_10086228 3300005466 Bacteria 1893
50 Ga0070706_100102056 3300005467 Bacteria 2666
51 Ga0070706_100137145 3300005467 Bacteria 2283
52 Ga0070707_100147435 3300005468 Bacteria 2290
53 Ga0070698_100114152 3300005471 Bacteria 2666
54 Ga0070699_100014638 3300005518 Bacteria 6747
55 Ga0070699_100043048 3300005518 Bacteria 3909
56 Ga0070699_100119835 3300005518 Bacteria 2313
57 Ga0070679_100008548 3300005530 Bacteria 9644
58 Ga0070679_100069154 3300005530 Bacteria 3522
59 Ga0070679_100080032 3300005530 Bacteria 3257
60 Ga0070679_100138187 3300005530 Bacteria 2417
61 Ga0070679_100147187 3300005530 Bacteria 2333
62 Ga0070697_100017234 3300005536 Bacteria 5680
63 Ga0070697_100125737 3300005536 Bacteria 2148
64 Ga0070686_100002493 3300005544 Bacteria 10135
65 Ga0070686_100343003 3300005544 Bacteria 1120
66 Ga0068855_100205612 3300005563 Bacteria 2215
67 Ga0068855_100608527 3300005563 Bacteria 1177
68 Ga0068857_100450919 3300005577 Bacteria 1202
69 Ga0068859_100138751 3300005617 Bacteria 2505
70 Ga0068864_100020968 3300005618 Bacteria 5473
71 Ga0068861_100143429 3300005719 Unclassified 1952
72 Ga0068870_10001278 3300005840 Bacteria 10113
73 Ga0068858_100003359 3300005842 Bacteria 15938
74 Ga0068860_100047356 3300005843 Bacteria 4098
75 Ga0081455_10007998 3300005937 Bacteria 11052
76 Ga0081455_10098364 3300005937 Bacteria 2356
77 Ga0081455_10230788 3300005937 Bacteria 1366
78 Ga0081538_10076177 3300005981 Bacteria 1815
79 Ga0081540_1000008 3300005983 Bacteria 203702
80 Ga0081540_1004373 3300005983 Bacteria 10802
81 Ga0081540_1045179 3300005983 Bacteria 2241
82 Ga0081540_1048354 3300005983 Bacteria 2131
83 Ga0070717_10080259 3300006028 Bacteria 2737
84 Ga0075365_10007347 3300006038 Bacteria 6162
85 Ga0075365_10032719 3300006038 Bacteria 3346
86 Ga0075363_100154214 3300006048 Bacteria 1298
87 Ga0075364_10243582 3300006051 Bacteria 1221
88 Ga0070715_10019985 3300006163 Bacteria 2576
89 Ga0070715_10049988 3300006163 Bacteria 1793
90 Ga0070716_100012493 3300006173 Bacteria 4306
91 Ga0070712_100002349 3300006175 Bacteria 11653
92 Ga0070712_100379190 3300006175 Bacteria 1164
93 Ga0075362_10143422 3300006177 Bacteria 1142
94 Ga0075367_10036392 3300006178 Bacteria 2854
95 Ga0068871_100039780 3300006358 Bacteria 3764
96 Ga0075428_100219790 3300006844 Bacteria 2052
97 Ga0075430_100229157 3300006846 Bacteria 1541
98 Ga0075431_100081785 3300006847 Bacteria 3335
99 Ga0075431_100282175 3300006847 Bacteria 1681
100 Ga0075433_10074125 3300006852 Bacteria 2994
101 Ga0075434_100085717 3300006871 Bacteria 3150
102 Ga0075434_100108144 3300006871 Bacteria 2791
103 Ga0075434_100116909 3300006871 Bacteria 2680
104 Ga0075434_100700145 3300006871 Bacteria 1031
105 Ga0075429_100145556 3300006880 Bacteria 2074
106 Ga0075429_100257409 3300006880 Bacteria 1528
107 Ga0068865_100013556 3300006881 Bacteria 5155
108 Ga0068865_100192388 3300006881 Unclassified 1579
109 Ga0075436_100354276 3300006914 Bacteria 1058
110 Ga0097620_100138758 3300006931 Bacteria 2505
111 Ga0075435_100021676 3300007076 Bacteria 4946
112 Ga0075435_100253650 3300007076 Bacteria 1498
113 Ga0099795_10003911 3300007788 Bacteria 3764
114 Ga0099795_10020574 3300007788 Bacteria 2152
115 Ga0105250_10082701 3300009092 Bacteria 1302
116 Ga0105245_10233503 3300009098 Bacteria 1780
117 Ga0105245_10473198 3300009098 Bacteria 1265
118 Ga0105247_10050544 3300009101 Bacteria 2558
119 Ga0105247_10136392 3300009101 Bacteria 1604
120 Ga0105247_10263613 3300009101 Bacteria 1182
121 Ga0114129_10108617 3300009147 Bacteria 3830
122 Ga0114129_10136570 3300009147 Bacteria 3364
123 Ga0105243_10420320 3300009148 Unclassified 1247
124 Ga0105242_10052438 3300009176 Bacteria 3328
125 Ga0105242_10070255 3300009176 Bacteria 2903
126 Ga0105248_10013941 3300009177 Bacteria 8845
127 Ga0105248_10100711 3300009177 Bacteria 3256
128 Ga0099796_10003033 3300010159 Bacteria 3816
129 Ga0099796_10005767 3300010159 Bacteria 3116
130 Ga0105239_10413847 3300010375 Bacteria 1527
131 Ga0105239_10763627 3300010375 Unclassified 1107
132 Ga0105246_10052319 3300011119 Bacteria 2807
133 Ga0157374_10072199 3300013296 Bacteria 3256
134 Ga0163162_10067064 3300013306 Bacteria 3638
135 Ga0163162_10116684 3300013306 Bacteria 2770
136 Ga0163162_10154028 3300013306 Bacteria 2417
137 Ga0157372_10881092 3300013307 Bacteria 1039
138 Ga0157375_10379364 3300013308 Bacteria 1580
139 Ga0157375_10653568 3300013308 Bacteria 1207
140 Ga0163163_10079391 3300014325 Bacteria 3280
141 Ga0157379_10159577 3300014968 Bacteria 2035
142 Ga0163161_10169260 3300017792 Bacteria 1670
143 Ga0213872_10079513 3300021361 Bacteria 1474
144 Ga0213874_10049367 3300021377 Bacteria 1286
145 Ga0213876_10224885 3300021384 Bacteria 998
146 Ga0209436_103678 3300025208 Bacteria 3990
147 Ga0209130_1000098 3300025284 Bacteria 142506
148 Ga0209758_1000063 3300025297 Bacteria 315999
149 Ga0209758_1038536 3300025297 Bacteria 1831
150 Ga0207426_1000069 3300025302 Bacteria 334513
151 Ga0207697_10084745 3300025315 Bacteria 1338
152 Ga0207682_10061669 3300025893 Unclassified 1570
153 Ga0207692_10005289 3300025898 Bacteria 5161
154 Ga0207692_10109295 3300025898 Bacteria 1531
155 Ga0207710_10009427 3300025900 Bacteria 4108
156 Ga0207710_10191715 3300025900 Bacteria 1006
157 Ga0207688_10002540 3300025901 Bacteria 9852
158 Ga0207688_10173532 3300025901 Bacteria 1283
159 Ga0207647_10013439 3300025904 Bacteria 5673
160 Ga0207645_10013005 3300025907 Bacteria 5624
161 Ga0207645_10058294 3300025907 Bacteria 2465
162 Ga0207643_10000967 3300025908 Bacteria 17260
163 Ga0207705_10270200 3300025909 Bacteria 1300
164 Ga0207684_10003027 3300025910 Bacteria 16653
165 Ga0207654_10041458 3300025911 Bacteria 2599
166 Ga0207707_10010597 3300025912 Bacteria 8006
167 Ga0207707_10184810 3300025912 Bacteria 1819
168 Ga0207707_10277475 3300025912 Bacteria 1452
169 Ga0207693_10004942 3300025915 Bacteria 11204
170 Ga0207693_10028165 3300025915 Bacteria 4439
171 Ga0207693_10233722 3300025915 Bacteria 1444
172 Ga0207663_10263588 3300025916 Bacteria 1273
173 Ga0207662_10011477 3300025918 Bacteria 4917
174 Ga0207662_10173206 3300025918 Unclassified 1385
175 Ga0207657_10052414 3300025919 Bacteria 3540
176 Ga0207649_10214620 3300025920 Bacteria 1367
177 Ga0207652_10048906 3300025921 Bacteria 3617
178 Ga0207646_10148216 3300025922 Bacteria 2115
179 Ga0207650_10009662 3300025925 Bacteria 6593
180 Ga0207650_10022709 3300025925 Bacteria 4444
181 Ga0207700_10056164 3300025928 Bacteria 2963
182 Ga0207700_10157955 3300025928 Bacteria 1881
183 Ga0207700_10457323 3300025928 Bacteria 1126
184 Ga0207664_10242164 3300025929 Bacteria 1571
185 Ga0207664_10304992 3300025929 Bacteria 1402
186 Ga0207664_10447237 3300025929 Bacteria 1153
187 Ga0207706_10063514 3300025933 Bacteria 3250
188 Ga0207670_10001209 3300025936 Bacteria 13624
189 Ga0207670_10201902 3300025936 Bacteria 1511
190 Ga0207669_10042758 3300025937 Bacteria 2648
191 Ga0207704_10010940 3300025938 Bacteria 4448
192 Ga0207704_10143111 3300025938 Unclassified 1676
193 Ga0207665_10001435 3300025939 Bacteria 16026
194 Ga0207691_10024270 3300025940 Bacteria 5702
195 Ga0207711_10015837 3300025941 Bacteria 6255
196 Ga0207711_10062207 3300025941 Bacteria 3220
197 Ga0207689_10026731 3300025942 Bacteria 4834
198 Ga0207661_10128277 3300025944 Bacteria 2169
199 Ga0207679_10019653 3300025945 Bacteria 4543
200 Ga0207667_10104334 3300025949 Bacteria 2924
201 Ga0207668_10242872 3300025972 Bacteria 1458
202 Ga0207668_10253629 3300025972 Bacteria 1430
203 Ga0207703_10045246 3300026035 Bacteria 3540
204 Ga0207678_10014323 3300026067 Bacteria 6972
205 Ga0207708_10001893 3300026075 Bacteria 15454
206 Ga0207641_10008033 3300026088 Bacteria 8746
207 Ga0207648_10001640 3300026089 Bacteria 24524
208 Ga0207676_10055919 3300026095 Bacteria 3100
209 Ga0207674_10081025 3300026116 Bacteria 3248
210 Ga0207675_100007548 3300026118 Bacteria 10274
211 Ga0207683_10027762 3300026121 Bacteria 4890
212 Ga0207683_10028800 3300026121 Bacteria 4805
213 Ga0207698_10037686 3300026142 Bacteria 3564
214 Ga0209179_1000721 3300027512 Bacteria 3578
215 Ga0209179_1014093 3300027512 Bacteria 1462
216 Ga0207428_10082930 3300027907 Bacteria 2501
217 Ga0268264_10078369 3300028381 Bacteria 2817
218 Ga0265338_10021309 3300028800 Bacteria 6764
219 Ga0265332_10001929 3300031238 Bacteria 10963
220 Ga0265325_10151806 3300031241 Bacteria 1095
221 Ga0265340_10015028 3300031247 Bacteria 4031
222 Ga0265340_10031294 3300031247 Bacteria 2662
223 Ga0265339_10000289 3300031249 Bacteria 40750
224 Ga0265339_10008650 3300031249 Bacteria 6460
225 Ga0265331_10004993 3300031250 Bacteria 8142
226 Ga0265313_10000091 3300031595 Bacteria 90050
227 Ga0265314_10012424 3300031711 Bacteria 6948
228 Ga0265342_10000766 3300031712 Bacteria 32726
229 Ga0373944_0023423 3300035089 Bacteria 1801
230 Ga0373923_0000573 3300035111 Bacteria 9075
231 Ga0373923_0073998 3300035111 Bacteria 1468
232 Ga0373932_0044700 3300035112 Bacteria 1293
233 Ga0373936_0000350 3300035113 Bacteria 15643
234 Ga0373936_0035549 3300035113 Bacteria 1984
235 Ga0373936_0058415 3300035113 Bacteria 1570
236 Ga0373945_0054665 3300035116 Bacteria 1476
237 Ga0373953_0000112 3300035117 Bacteria 19685
238 Ga0373954_0004744 3300035118 Bacteria 5860
239 Ga0373943_0002689 3300035170 Bacteria 8078
240 Ga0373943_0059144 3300035170 Bacteria 1909
241 Ga0373946_0006277 3300035171 Bacteria 4307
242 Ga0373955_0004039 3300035172 Bacteria 6477
243 Ga0373924_0017254 3300035410 Bacteria 2766
244 Ga0373935_0048006 3300035692 Bacteria 2701
245 Ga0373935_0109700 3300035692 Bacteria 1830
246 Ga0373927_0026722 3300035695 Bacteria 3772
247 Ga0373933_0001117 3300035724 Bacteria 15975
248 Ga0373947_0000216 3300035725 Bacteria 32290
249 Ga0373947_0053073 3300035725 Bacteria 2444
250 Ga0373947_0071379 3300035725 Bacteria 2129
251 Ga0373947_0081114 3300035725 Bacteria 2008
252 Ga0373937_0000003 3300036401 Bacteria 235408
253 Ga0373925_0000118 3300037068 Bacteria 85072
254 Ga0436364_0096810 3300037853 Bacteria 2623
255 Ga0395901_0735944 3300038443 Bacteria 980
256 Ga0436365_0702834 3300039437 Bacteria 2589
257 Ga0436360_0101432 3300039438 Bacteria 902
258 Ga0436360_0131471 3300039438 Bacteria 1078
259 Ga0436361_0573246 3300039447 Bacteria 3492
260 Ga0436363_1350811 3300039450 Bacteria 5326
261 Ga0466965_0025121 3300044683 Bacteria 2883
262 Ga0466963_0164253 3300044694 Bacteria 1546
263 Ga0466963_0170482 3300044694 Bacteria 1517
264 Ga0466957_0008848 3300044842 Bacteria 5735
265 Ga0466959_0029230 3300045049 Bacteria 4084
266 Ga0466958_0038254 3300045836 Bacteria 2878
267 Ga0466967_0284994 3300045976 Bacteria 1586
268 Ga0495592_0000051 3300046454 Bacteria 111216
269 Ga0495592_0136020 3300046454 Bacteria 1714
270 Ga0495603_0131435 3300046455 Bacteria 1457
271 Ga0495629_0029563 3300046459 Bacteria 3884
272 Ga0495651_0000583 3300046462 Bacteria 28302
273 Ga0495653_0000039 3300046463 Bacteria 119840
274 Ga0495580_0062974 3300046472 Bacteria 2602
275 Ga0495582_0083192 3300046473 Bacteria 1778
276 Ga0495582_0139576 3300046473 Bacteria 1373
277 Ga0495639_0014456 3300046475 Bacteria 3418
278 Ga0495664_0000015 3300046477 Bacteria 192569
279 Ga0495584_0121924 3300046491 Bacteria 1320
280 Ga0495594_0029016 3300046499 Bacteria 2988
281 Ga0495596_0044841 3300046500 Bacteria 1739
282 Ga0495608_0000025 3300046511 Bacteria 158132
283 Ga0495616_0019394 3300046513 Bacteria 3712
284 Ga0495618_0091399 3300046514 Bacteria 1946
285 Ga0495618_0181273 3300046514 Bacteria 1338
286 Ga0495628_0000011 3300046516 Bacteria 225267
287 Ga0495628_0224939 3300046516 Bacteria 1408
288 Ga0495630_0000372 3300046517 Bacteria 35516
289 Ga0495630_0107895 3300046517 Bacteria 2109
290 Ga0495666_0053853 3300046526 Bacteria 1930
291 Ga0495652_0000014 3300046529 Bacteria 225484
292 Ga0495654_0000063 3300046530 Bacteria 128630
293 Ga0495640_0000008 3300046533 Bacteria 220320
294 Ga0495640_0115256 3300046533 Bacteria 1751
295 Ga0495587_0000015 3300046536 Bacteria 187415
296 Ga0495587_0221547 3300046536 Bacteria 1067
297 Ga0495598_0134550 3300046537 Bacteria 850
298 Ga0495645_0000020 3300046543 Bacteria 143867
299 Ga0495667_0000013 3300046559 Bacteria 220294
300 Ga0495656_0090369 3300046615 Bacteria 1399
301 Ga0495634_0000415 3300046642 Bacteria 42260
302 Ga0495634_0178478 3300046642 Bacteria 1331
303 Ga0495635_0000012 3300046663 Bacteria 225271
304 Ga0495588_0024635 3300046674 Bacteria 2990
305 Ga0495657_0000048 3300046675 Bacteria 104278
306 Ga0495599_0000008 3300046678 Bacteria 225534
307 Ga0495623_0000002 3300046679 Bacteria 166669
308 Ga0495646_0000004 3300046680 Bacteria 268993
309 Ga0495658_0037468 3300046683 Bacteria 2681
310 Ga0495613_0011168 3300046689 Bacteria 6668
311 Ga0495613_0101651 3300046689 Bacteria 2076
312 Ga0495613_0109984 3300046689 Bacteria 1986
313 Ga0495613_0394841 3300046689 Bacteria 944
314 Ga0495624_0006290 3300046690 Bacteria 8446
315 Ga0495670_0098066 3300046691 Bacteria 1506
316 Ga0495600_0000024 3300046809 Bacteria 92414
317 Ga0495604_0000001 3300047317 Bacteria 708627
318 Ga0495674_0000023 3300047319 Bacteria 157443
319 Ga0495674_0142615 3300047319 Bacteria 2013
320 Ga0495674_0165277 3300047319 Bacteria 1850
321 Ga0495674_0513977 3300047319 Bacteria 957
322 Ga0495676_0042243 3300047321 Bacteria 3744
323 Ga0495680_0000233 3300047322 Bacteria 60821
324 Ga0495675_0000392 3300047444 Bacteria 30250
325 Ga0495677_0029499 3300047445 Bacteria 1995
326 Ga0495679_031766 3300047446 Bacteria 1701
327 Ga0495684_0000007 3300047471 Bacteria 225614
328 Ga0495684_0049116 3300047471 Bacteria 3225
329 Ga0495686_0141841 3300047472 Bacteria 1417
330 Ga0495593_0000722 3300047673 Bacteria 19167
331 Ga0495602_0000045 3300048088 Bacteria 118132
332 Ga0496100_0146565 3300048903 Bacteria 1679
333 Ga0496101_0007757 3300048904 Bacteria 6974
334 Ga0496101_0072154 3300048904 Bacteria 2533
335 Ga0496102_0096946 3300048905 Bacteria 2734
336 Ga0496102_0098027 3300048905 Bacteria 2720
337 Ga0496102_0113275 3300048905 Bacteria 2530
338 Ga0496102_0311498 3300048905 Unclassified 1483
339 Ga0496103_0026559 3300048906 Bacteria 3504
340 Ga0496104_0000280 3300048907 Bacteria 45178
341 Ga0496104_0016202 3300048907 Bacteria 6767
342 Ga0496104_0118984 3300048907 Bacteria 2536
343 Ga0496104_0527032 3300048907 Unclassified 1092
344 Ga0496105_0024047 3300048908 Bacteria 4948
345 Ga0496105_0049615 3300048908 Bacteria 3466
346 Ga0496106_0020789 3300048909 Bacteria 4871
347 Ga0496106_0076408 3300048909 Bacteria 2567
348 Ga0496106_0083359 3300048909 Bacteria 2459
349 Ga0496107_0016731 3300048910 Bacteria 5155
350 Ga0496107_0021462 3300048910 Bacteria 4564
351 Ga0496107_0027318 3300048910 Bacteria 4052
352 Ga0496107_0027628 3300048910 Bacteria 4029
353 Ga0496107_0332834 3300048910 Bacteria 1130
354 Ga0496108_0002485 3300048911 Bacteria 14755
355 Ga0496108_0105337 3300048911 Bacteria 2408
356 Ga0496109_0001072 3300048912 Bacteria 22689
357 Ga0496109_0004069 3300048912 Bacteria 12225
358 Ga0496109_0076903 3300048912 Bacteria 3071
359 Ga0496110_0000570 3300048913 Bacteria 25287
360 Ga0496110_0014289 3300048913 Bacteria 6587
361 Ga0496110_0032674 3300048913 Bacteria 4497
362 Ga0496110_0100915 3300048913 Bacteria 2587
363 Ga0496110_0224818 3300048913 Bacteria 1707
364 Ga0496110_0299065 3300048913 Bacteria 1466
365 Ga0496111_0057858 3300048914 Bacteria 2806
366 Ga0496111_0351229 3300048914 Bacteria 1091
367 Ga0496112_0005539 3300048915 Bacteria 10941
368 Ga0496112_0005780 3300048915 Bacteria 10758
369 Ga0496112_0102365 3300048915 Bacteria 2834
370 Ga0496112_0213246 3300048915 Bacteria 1888
371 Ga0496113_0034717 3300048916 Bacteria 3682
372 Ga0496114_0043676 3300048917 Bacteria 3716
373 Ga0496114_0114005 3300048917 Bacteria 2318
374 Ga0496114_0131046 3300048917 Bacteria 2165
375 Ga0496115_0055171 3300048918 Bacteria 3192
376 Ga0496115_0055976 3300048918 Bacteria 3169
377 Ga0496115_0092907 3300048918 Bacteria 2467
378 Ga0496119_0037343 3300048922 Bacteria 3157
379 Ga0496121_0062257 3300048924 Bacteria 3057
380 Ga0496122_0013263 3300048925 Bacteria 8079
381 Ga0496123_0003466 3300048926 Bacteria 17640
382 Ga0496125_0096211 3300048928 Bacteria 2199
383 Ga0501033_0046185 3300049570 Bacteria 3238
384 Ga0501033_0067006 3300049570 Bacteria 2640
385 Ga0501034_0135937 3300049571 Bacteria 2439
386 Ga0501036_0153363 3300049572 Bacteria 1943
387 Ga0501037_0016678 3300049573 Bacteria 5405
388 Ga0501038_0065052 3300049574 Bacteria 3108
389 Ga0501043_0019340 3300049579 Bacteria 5346
390 Ga0501047_0065649 3300049581 Bacteria 3498
391 Ga0501047_0081955 3300049581 Bacteria 3101
392 Ga0501070_0062214 3300049586 Bacteria 3092
393 Ga0501074_0077654 3300049590 Bacteria 2383
394 Ga0501075_0264412 3300049591 Bacteria 1311
395 Ga0501080_0079524 3300049742 Bacteria 3048
396 Ga0501080_0341172 3300049742 Bacteria 1354
397 Ga0501081_0164875 3300049743 Bacteria 1598
398 Ga0501035_0069963 3300049822 Bacteria 3109
399 Ga0501044_0002125 3300049823 Bacteria 22744
400 Ga0501044_0119905 3300049823 Bacteria 2632
401 nmdc:mga03683_158593_c1 3300050489 Bacteria 1024
402 nmdc:mga03683_174253_c1 3300050489 Bacteria 979
403 nmdc:mga03n38_64635_c1 3300050490 Bacteria 1675
404 nmdc:mga00v17_89350_c1 3300050491 Bacteria 1933
405 nmdc:mga0yw44_7604_c1 3300050492 Bacteria 5343
406 nmdc:mga0yw44_9174_c1 3300050492 Bacteria 4980
407 nmdc:mga0k408_185352_c1 3300050493 Bacteria 1241
408 nmdc:mga06z11_53525_c1 3300050494 Bacteria 2076
409 nmdc:mga06z11_83137_c1 3300050494 Bacteria 1723
410 nmdc:mga04h51_16593_c1 3300050495 Bacteria 2140
411 nmdc:mga04h51_37308_c1 3300050495 Bacteria 1568
412 nmdc:mga05p37_291196_c1 3300050507 Bacteria 1943
413 nmdc:mga05p37_411115_c1 3300050507 Bacteria 1577
414 nmdc:mga05p37_610533_c1 3300050507 Bacteria 1229
415 nmdc:mga05p37_87424_c1 3300050507 Bacteria 3841
416 nmdc:mga09592_58588_c1 3300050508 Bacteria 3257
417 nmdc:mga0qj67_168690_c1 3300050509 Bacteria 1777
418 nmdc:mga06r32_23692_c1 3300050510 Bacteria 5684
419 nmdc:mga06r32_96436_c1 3300050510 Bacteria 2896
420 nmdc:mga08y16_95463_c1 3300050511 Bacteria 3097
421 nmdc:mga0n895_118848_c1 3300050512 Bacteria 2664
422 nmdc:mga0n895_178746_c1 3300050512 Bacteria 2153
423 nmdc:mga0n895_369604_c1 3300050512 Bacteria 1452
424 nmdc:mga0n895_787053_c1 3300050512 Bacteria 942
425 nmdc:mga0rr50_147615_c1 3300050513 Bacteria 1897
426 nmdc:mga0rr50_179722_c1 3300050513 Bacteria 1729
427 nmdc:mga0rr50_420820_c1 3300050513 Bacteria 1130
428 nmdc:mga08x19_242678_c1 3300050514 Bacteria 1242
429 nmdc:mga08x19_52570_c1 3300050514 Bacteria 2620
430 nmdc:mga08x19_73337_c1 3300050514 Bacteria 2234
431 nmdc:mga08x19_9568_c1 3300050514 Bacteria 5801
432 nmdc:mga0a205_281758_c1 3300050515 Bacteria 1537
433 Ga0495601_0000014 3300053077 Bacteria 220318
434 Ga0495601_0303080 3300053077 Bacteria 1041
435 Ga0495612_0000014 3300053078 Bacteria 187444
436 Ga0495655_0003892 3300053083 Bacteria 2507
437 Ga0495655_0048090 3300053083 Bacteria 1118
438 Ga0495595_0000038 3300053084 Bacteria 70955
439 Ga0495595_0009850 3300053084 Bacteria 3961
440 Ga0495595_0089197 3300053084 Bacteria 1478
441 Ga0495619_0000006 3300053085 Bacteria 384835
442 Ga0495619_0027135 3300053085 Bacteria 3689
443 Ga0500593_003573 3300053117 Bacteria 5902
444 Ga0500618_000025 3300053125 Bacteria 150583
445 Ga0500590_014540 3300053148 Bacteria 4058
446 Ga0500634_0203117 3300053161 Unclassified 868
447 Ga0501084_0138557 3300054114 Bacteria 2048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002987 JGI25159J45721_1000448 JGI25159J45721_10004482 248
2 3300003322 rootL2_10203526 rootL2_102035263 248
3 3300003354 JGI25160J50197_1000103 JGI25160J50197_100010379 248
4 3300003374 JGI25161J50226_1001380 JGI25161J50226_10013802 248
5 3300004625 Ga0055543_1000087 Ga0055543_10000873 248
6 3300005262 Ga0065165_1000776 Ga0065165_10007763 248
7 3300010375 Ga0105239_10763627 Ga0105239_107636271 248
8 3300025208 Ga0209436_103678 Ga0209436_1036784 248
9 3300025284 Ga0209130_1000098 Ga0209130_100009878 248
10 3300025302 Ga0207426_1000069 Ga0207426_1000069182 248
11 3300048922 Ga0496119_0037343 Ga0496119_0037343_805_1677 248
12 3300048924 Ga0496121_0062257 Ga0496121_0062257_618_1490 248
13 3300048928 Ga0496125_0096211 Ga0496125_0096211_580_1452 248
14 3300044683 Ga0466965_0025121 Ga0466965_0025121_1945_2841 249
15 3300047472 Ga0495686_0141841 Ga0495686_0141841_43_903 249
16 3300053125 Ga0500618_000025 Ga0500618_000025_10111_10971 249
17 3300013296 Ga0157374_10072199 Ga0157374_100721991 255
18 3300025911 Ga0207654_10041458 Ga0207654_100414584 255
19 3300035112 Ga0373932_0044700 Ga0373932_0044700_17_784 255
20 3300046537 Ga0495598_0134550 Ga0495598_0134550_48_815 255
21 3300047445 Ga0495677_0029499 Ga0495677_0029499_57_824 255
22 3300053083 Ga0495655_0048090 Ga0495655_0048090_287_1054 255
23 3300053161 Ga0500634_0203117 Ga0500634_0203117_43_816 257
24 3300039438 Ga0436360_0101432 Ga0436360_0101432_25_819 260
25 3300046530 Ga0495654_0000063 Ga0495654_0000063_10237_11091 260
26 3300048925 Ga0496122_0013263 Ga0496122_0013263_2449_3303 260
27 3300048926 Ga0496123_0003466 Ga0496123_0003466_10172_11026 260
28 3300053117 Ga0500593_003573 Ga0500593_003573_2443_3306 262
29 3300039438 Ga0436360_0131471 Ga0436360_0131471_258_1064 263
30 3300005336 Ga0070680_100156067 Ga0070680_1001560671 264
31 3300005530 Ga0070679_100069154 Ga0070679_1000691543 264
32 3300025921 Ga0207652_10048906 Ga0207652_100489063 264
33 3300031247 Ga0265340_10031294 Ga0265340_100312943 266
34 3300050489 nmdc:mga03683_174253_c1 nmdc:mga03683_174253_c1_20_823 267
35 3300035725 Ga0373947_0081114 Ga0373947_0081114_1020_1901 268
36 3300046517 Ga0495630_0107895 Ga0495630_0107895_531_1412 268
37 3300047319 Ga0495674_0142615 Ga0495674_0142615_209_1090 268
38 3300053077 Ga0495601_0303080 Ga0495601_0303080_56_937 268
39 3300005436 Ga0070713_100066720 Ga0070713_1000667202 273
40 3300005530 Ga0070679_100138187 Ga0070679_1001381872 273
41 3300021361 Ga0213872_10079513 Ga0213872_100795132 273
42 3300021384 Ga0213876_10224885 Ga0213876_102248851 273
43 3300025928 Ga0207700_10157955 Ga0207700_101579552 273
44 3300025928 Ga0207700_10457323 Ga0207700_104573232 273
45 3300035692 Ga0373935_0109700 Ga0373935_0109700_426_1298 273
46 3300039447 Ga0436361_0573246 Ga0436361_0573246_687_1550 273
47 3300039450 Ga0436363_1350811 Ga0436363_1350811_2378_3241 273
48 3300046454 Ga0495592_0136020 Ga0495592_0136020_523_1395 273
49 3300046536 Ga0495587_0221547 Ga0495587_0221547_137_1000 273
50 3300047319 Ga0495674_0165277 Ga0495674_0165277_809_1672 273
51 3300053084 Ga0495595_0009850 Ga0495595_0009850_123_986 273
52 3300025297 Ga0209758_1038536 Ga0209758_10385362 274
53 3300021377 Ga0213874_10049367 Ga0213874_100493672 275
54 3300045049 Ga0466959_0029230 Ga0466959_0029230_642_1472 275
55 3300053148 Ga0500590_014540 Ga0500590_014540_1571_2446 275
56 3300005445 Ga0070708_100212372 Ga0070708_1002123722 276
57 3300005467 Ga0070706_100137145 Ga0070706_1001371452 276
58 3300005518 Ga0070699_100119835 Ga0070699_1001198352 276
59 3300005536 Ga0070697_100017234 Ga0070697_1000172346 276
60 3300005937 Ga0081455_10230788 Ga0081455_102307882 276
61 3300007076 Ga0075435_100253650 Ga0075435_1002536502 276
62 3300048913 Ga0496110_0032674 Ga0496110_0032674_3452_4288 276
63 3300048914 Ga0496111_0057858 Ga0496111_0057858_622_1458 276
64 3300048915 Ga0496112_0213246 Ga0496112_0213246_909_1745 276
65 3300050507 nmdc:mga05p37_610533_c1 nmdc:mga05p37_610533_c1_369_1205 276
66 3300050512 nmdc:mga0n895_369604_c1 nmdc:mga0n895_369604_c1_497_1333 276
67 3300050513 nmdc:mga0rr50_420820_c1 nmdc:mga0rr50_420820_c1_111_947 276
68 3300006880 Ga0075429_100257409 Ga0075429_1002574092 277
69 3300050508 nmdc:mga09592_58588_c1 nmdc:mga09592_58588_c1_323_1201 277
70 3300035725 Ga0373947_0053073 Ga0373947_0053073_1176_2030 278
71 3300050489 nmdc:mga03683_158593_c1 nmdc:mga03683_158593_c1_23_859 278
72 3300005530 Ga0070679_100147187 Ga0070679_1001471873 279
73 3300025912 Ga0207707_10184810 Ga0207707_101848102 279
74 3300007788 Ga0099795_10003911 Ga0099795_100039113 280
75 3300031238 Ga0265332_10001929 Ga0265332_100019295 280
76 3300031241 Ga0265325_10151806 Ga0265325_101518062 280
77 3300031247 Ga0265340_10015028 Ga0265340_100150282 280
78 3300031249 Ga0265339_10008650 Ga0265339_100086506 280
79 3300031250 Ga0265331_10004993 Ga0265331_100049939 280
80 3300031712 Ga0265342_10000766 Ga0265342_1000076618 280
81 3300005347 Ga0070668_100222537 Ga0070668_1002225372 281
82 3300005354 Ga0070675_100169840 Ga0070675_1001698402 281
83 3300005356 Ga0070674_100114046 Ga0070674_1001140462 281
84 3300005364 Ga0070673_100141746 Ga0070673_1001417462 281
85 3300005455 Ga0070663_100281703 Ga0070663_1002817032 281
86 3300017792 Ga0163161_10169260 Ga0163161_101692602 281
87 3300025909 Ga0207705_10270200 Ga0207705_102702001 281
88 3300025937 Ga0207669_10042758 Ga0207669_100427582 281
89 3300025972 Ga0207668_10253629 Ga0207668_102536292 281
90 3300028381 Ga0268264_10078369 Ga0268264_100783692 281
91 3300053083 Ga0495655_0003892 Ga0495655_0003892_630_1490 281
92 3300005544 Ga0070686_100343003 Ga0070686_1003430032 282
93 3300005563 Ga0068855_100205612 Ga0068855_1002056122 282
94 3300049570 Ga0501033_0067006 Ga0501033_0067006_85_933 282
95 3300049581 Ga0501047_0065649 Ga0501047_0065649_543_1391 282
96 3300049823 Ga0501044_0002125 Ga0501044_0002125_11450_12298 282
97 3300048913 Ga0496110_0224818 Ga0496110_0224818_395_1246 283
98 3300025929 Ga0207664_10447237 Ga0207664_104472371 284
99 3300035113 Ga0373936_0035549 Ga0373936_0035549_541_1410 284
100 3300050512 nmdc:mga0n895_787053_c1 nmdc:mga0n895_787053_c1_31_894 284
101 3300010159 Ga0099796_10005767 Ga0099796_100057672 285
102 3300044694 Ga0466963_0170482 Ga0466963_0170482_134_1006 285
103 3300005439 Ga0070711_100190449 Ga0070711_1001904492 286
104 3300006175 Ga0070712_100002349 Ga0070712_1000023493 286
105 3300025915 Ga0207693_10004942 Ga0207693_100049423 286
106 3300028800 Ga0265338_10021309 Ga0265338_100213096 286
107 3300031249 Ga0265339_10000289 Ga0265339_1000028920 286
108 3300031595 Ga0265313_10000091 Ga0265313_1000009127 286
109 3300049570 Ga0501033_0046185 Ga0501033_0046185_1012_1899 286
110 3300049571 Ga0501034_0135937 Ga0501034_0135937_342_1229 286
111 3300049572 Ga0501036_0153363 Ga0501036_0153363_42_929 286
112 3300049573 Ga0501037_0016678 Ga0501037_0016678_1030_1917 286
113 3300049574 Ga0501038_0065052 Ga0501038_0065052_1210_2097 286
114 3300049579 Ga0501043_0019340 Ga0501043_0019340_1211_2098 286
115 3300049581 Ga0501047_0081955 Ga0501047_0081955_1012_1899 286
116 3300049586 Ga0501070_0062214 Ga0501070_0062214_1184_2071 286
117 3300049590 Ga0501074_0077654 Ga0501074_0077654_780_1667 286
118 3300049742 Ga0501080_0079524 Ga0501080_0079524_1150_2037 286
119 3300049822 Ga0501035_0069963 Ga0501035_0069963_1040_1927 286
120 3300049823 Ga0501044_0119905 Ga0501044_0119905_706_1593 286
121 3300003215 JGI25153J46596_10013367 JGI25153J46596_100133672 287
122 3300005330 Ga0070690_100016258 Ga0070690_1000162584 287
123 3300005338 Ga0068868_100457492 Ga0068868_1004574922 287
124 3300005340 Ga0070689_100006393 Ga0070689_1000063934 287
125 3300005343 Ga0070687_100052865 Ga0070687_1000528652 287
126 3300005347 Ga0070668_100400398 Ga0070668_1004003981 287
127 3300005434 Ga0070709_10509082 Ga0070709_105090821 287
128 3300005436 Ga0070713_100028268 Ga0070713_1000282682 287
129 3300005445 Ga0070708_100277614 Ga0070708_1002776142 287
130 3300005456 Ga0070678_100059514 Ga0070678_1000595142 287
131 3300005467 Ga0070706_100102056 Ga0070706_1001020562 287
132 3300005468 Ga0070707_100147435 Ga0070707_1001474352 287
133 3300005471 Ga0070698_100114152 Ga0070698_1001141522 287
134 3300005518 Ga0070699_100014638 Ga0070699_1000146382 287
135 3300005518 Ga0070699_100043048 Ga0070699_1000430484 287
136 3300005536 Ga0070697_100125737 Ga0070697_1001257371 287
137 3300005617 Ga0068859_100138751 Ga0068859_1001387512 287
138 3300005618 Ga0068864_100020968 Ga0068864_1000209683 287
139 3300005719 Ga0068861_100143429 Ga0068861_1001434292 287
140 3300005983 Ga0081540_1045179 Ga0081540_10451792 287
141 3300006175 Ga0070712_100379190 Ga0070712_1003791902 287
142 3300006871 Ga0075434_100116909 Ga0075434_1001169092 287
143 3300006881 Ga0068865_100192388 Ga0068865_1001923882 287
144 3300006931 Ga0097620_100138758 Ga0097620_1001387582 287
145 3300009098 Ga0105245_10473198 Ga0105245_104731982 287
146 3300009101 Ga0105247_10263613 Ga0105247_102636132 287
147 3300011119 Ga0105246_10052319 Ga0105246_100523192 287
148 3300013306 Ga0163162_10116684 Ga0163162_101166842 287
149 3300014325 Ga0163163_10079391 Ga0163163_100793912 287
150 3300025297 Ga0209758_1000063 Ga0209758_1000063200 287
151 3300025315 Ga0207697_10084745 Ga0207697_100847452 287
152 3300025893 Ga0207682_10061669 Ga0207682_100616692 287
153 3300025898 Ga0207692_10109295 Ga0207692_101092952 287
154 3300025900 Ga0207710_10191715 Ga0207710_101917151 287
155 3300025907 Ga0207645_10058294 Ga0207645_100582942 287
156 3300025910 Ga0207684_10003027 Ga0207684_1000302710 287
157 3300025915 Ga0207693_10233722 Ga0207693_102337222 287
158 3300025916 Ga0207663_10263588 Ga0207663_102635882 287
159 3300025918 Ga0207662_10173206 Ga0207662_101732061 287
160 3300025922 Ga0207646_10148216 Ga0207646_101482163 287
161 3300025936 Ga0207670_10001209 Ga0207670_100012094 287
162 3300025938 Ga0207704_10143111 Ga0207704_101431112 287
163 3300025972 Ga0207668_10242872 Ga0207668_102428722 287
164 3300026095 Ga0207676_10055919 Ga0207676_100559193 287
165 3300026121 Ga0207683_10028800 Ga0207683_100288004 287
166 3300035111 Ga0373923_0000573 Ga0373923_0000573_7089_7952 287
167 3300035113 Ga0373936_0000350 Ga0373936_0000350_3321_4184 287
168 3300035117 Ga0373953_0000112 Ga0373953_0000112_9501_10364 287
169 3300035118 Ga0373954_0004744 Ga0373954_0004744_3733_4596 287
170 3300035170 Ga0373943_0002689 Ga0373943_0002689_307_1170 287
171 3300035172 Ga0373955_0004039 Ga0373955_0004039_3807_4670 287
172 3300035410 Ga0373924_0017254 Ga0373924_0017254_617_1480 287
173 3300035724 Ga0373933_0001117 Ga0373933_0001117_1379_2242 287
174 3300035725 Ga0373947_0000216 Ga0373947_0000216_1315_2178 287
175 3300036401 Ga0373937_0000003 Ga0373937_0000003_107335_108198 287
176 3300037068 Ga0373925_0000118 Ga0373925_0000118_83600_84463 287
177 3300046454 Ga0495592_0000051 Ga0495592_0000051_22506_23369 287
178 3300046462 Ga0495651_0000583 Ga0495651_0000583_26092_26955 287
179 3300046463 Ga0495653_0000039 Ga0495653_0000039_92244_93107 287
180 3300046475 Ga0495639_0014456 Ga0495639_0014456_2462_3325 287
181 3300046477 Ga0495664_0000015 Ga0495664_0000015_94464_95327 287
182 3300046511 Ga0495608_0000025 Ga0495608_0000025_87989_88852 287
183 3300046516 Ga0495628_0000011 Ga0495628_0000011_127211_128074 287
184 3300046517 Ga0495630_0000372 Ga0495630_0000372_7316_8179 287
185 3300046529 Ga0495652_0000014 Ga0495652_0000014_97411_98274 287
186 3300046533 Ga0495640_0000008 Ga0495640_0000008_127211_128074 287
187 3300046536 Ga0495587_0000015 Ga0495587_0000015_92217_93080 287
188 3300046543 Ga0495645_0000020 Ga0495645_0000020_87863_88726 287
189 3300046559 Ga0495667_0000013 Ga0495667_0000013_127197_128060 287
190 3300046642 Ga0495634_0000415 Ga0495634_0000415_40063_40926 287
191 3300046663 Ga0495635_0000012 Ga0495635_0000012_97198_98061 287
192 3300046675 Ga0495657_0000048 Ga0495657_0000048_101284_102147 287
193 3300046678 Ga0495599_0000008 Ga0495599_0000008_97461_98324 287
194 3300046679 Ga0495623_0000002 Ga0495623_0000002_101395_102258 287
195 3300046680 Ga0495646_0000004 Ga0495646_0000004_175865_176728 287
196 3300046683 Ga0495658_0037468 Ga0495658_0037468_676_1539 287
197 3300046689 Ga0495613_0011168 Ga0495613_0011168_1176_2039 287
198 3300046689 Ga0495613_0101651 Ga0495613_0101651_541_1404 287
199 3300046690 Ga0495624_0006290 Ga0495624_0006290_4680_5543 287
200 3300046809 Ga0495600_0000024 Ga0495600_0000024_56893_57756 287
201 3300047317 Ga0495604_0000001 Ga0495604_0000001_411804_412667 287
202 3300047319 Ga0495674_0000023 Ga0495674_0000023_64253_65116 287
203 3300047322 Ga0495680_0000233 Ga0495680_0000233_10696_11559 287
204 3300047444 Ga0495675_0000392 Ga0495675_0000392_26648_27511 287
205 3300047471 Ga0495684_0000007 Ga0495684_0000007_97271_98134 287
206 3300047673 Ga0495593_0000722 Ga0495593_0000722_4594_5457 287
207 3300048088 Ga0495602_0000045 Ga0495602_0000045_87872_88735 287
208 3300048912 Ga0496109_0076903 Ga0496109_0076903_879_1742 287
209 3300048913 Ga0496110_0299065 Ga0496110_0299065_227_1090 287
210 3300048916 Ga0496113_0034717 Ga0496113_0034717_1074_1937 287
211 3300050514 nmdc:mga08x19_52570_c1 nmdc:mga08x19_52570_c1_678_1541 287
212 3300050514 nmdc:mga08x19_9568_c1 nmdc:mga08x19_9568_c1_2838_3701 287
213 3300053077 Ga0495601_0000014 Ga0495601_0000014_92245_93108 287
214 3300053078 Ga0495612_0000014 Ga0495612_0000014_92223_93086 287
215 3300053084 Ga0495595_0000038 Ga0495595_0000038_27110_27973 287
216 3300053085 Ga0495619_0000006 Ga0495619_0000006_127211_128074 287
217 3300005327 Ga0070658_10057614 Ga0070658_100576143 288
218 3300005336 Ga0070680_100003405 Ga0070680_1000034056 288
219 3300005436 Ga0070713_100056637 Ga0070713_1000566372 288
220 3300005530 Ga0070679_100008548 Ga0070679_1000085486 288
221 3300006852 Ga0075433_10074125 Ga0075433_100741252 288
222 3300006871 Ga0075434_100085717 Ga0075434_1000857173 288
223 3300007076 Ga0075435_100021676 Ga0075435_1000216762 288
224 3300009147 Ga0114129_10136570 Ga0114129_101365702 288
225 3300010159 Ga0099796_10003033 Ga0099796_100030334 288
226 3300025912 Ga0207707_10010597 Ga0207707_100105971 288
227 3300025928 Ga0207700_10056164 Ga0207700_100561642 288
228 3300027512 Ga0209179_1000721 Ga0209179_10007212 288
229 3300031711 Ga0265314_10012424 Ga0265314_100124245 288
230 3300037853 Ga0436364_0096810 Ga0436364_0096810_1557_2435 288
231 3300038443 Ga0395901_0735944 Ga0395901_0735944_77_946 288
232 3300039437 Ga0436365_0702834 Ga0436365_0702834_475_1353 288
233 3300044694 Ga0466963_0164253 Ga0466963_0164253_37_903 288
234 3300044842 Ga0466957_0008848 Ga0466957_0008848_410_1276 288
235 3300045836 Ga0466958_0038254 Ga0466958_0038254_1550_2416 288
236 3300045976 Ga0466967_0284994 Ga0466967_0284994_700_1566 288
237 3300048907 Ga0496104_0118984 Ga0496104_0118984_70_948 288
238 3300048908 Ga0496105_0049615 Ga0496105_0049615_1688_2566 288
239 3300048913 Ga0496110_0100915 Ga0496110_0100915_419_1297 288
240 3300048918 Ga0496115_0092907 Ga0496115_0092907_903_1781 288
241 3300050512 nmdc:mga0n895_178746_c1 nmdc:mga0n895_178746_c1_161_1027 288
242 3300050513 nmdc:mga0rr50_147615_c1 nmdc:mga0rr50_147615_c1_781_1647 288
243 3300006051 Ga0075364_10243582 Ga0075364_102435822 289
244 3300006847 Ga0075431_100282175 Ga0075431_1002821752 289
245 3300006871 Ga0075434_100700145 Ga0075434_1007001451 289
246 3300025912 Ga0207707_10277475 Ga0207707_102774752 289
247 3300025936 Ga0207670_10201902 Ga0207670_102019021 289
248 3300050492 nmdc:mga0yw44_9174_c1 nmdc:mga0yw44_9174_c1_530_1399 289
249 3300050493 nmdc:mga0k408_185352_c1 nmdc:mga0k408_185352_c1_78_950 289
250 3300050494 nmdc:mga06z11_83137_c1 nmdc:mga06z11_83137_c1_559_1431 289
251 3300050495 nmdc:mga04h51_16593_c1 nmdc:mga04h51_16593_c1_619_1491 289
252 3300050507 nmdc:mga05p37_291196_c1 nmdc:mga05p37_291196_c1_403_1272 289
253 3300050510 nmdc:mga06r32_23692_c1 nmdc:mga06r32_23692_c1_2850_3719 289
254 iso_pu_bacteria 2939631187 2939635541 289
255 3300005437 Ga0070710_10016661 Ga0070710_100166613 290
256 3300005530 Ga0070679_100080032 Ga0070679_1000800322 290
257 3300005983 Ga0081540_1004373 Ga0081540_10043738 290
258 3300006028 Ga0070717_10080259 Ga0070717_100802592 290
259 3300006038 Ga0075365_10032719 Ga0075365_100327194 290
260 3300006163 Ga0070715_10049988 Ga0070715_100499882 290
261 3300006173 Ga0070716_100012493 Ga0070716_1000124932 290
262 3300006914 Ga0075436_100354276 Ga0075436_1003542762 290
263 3300007788 Ga0099795_10020574 Ga0099795_100205741 290
264 3300013308 Ga0157375_10379364 Ga0157375_103793642 290
265 3300025898 Ga0207692_10005289 Ga0207692_100052895 290
266 3300025915 Ga0207693_10028165 Ga0207693_100281653 290
267 3300025929 Ga0207664_10242164 Ga0207664_102421642 290
268 3300025939 Ga0207665_10001435 Ga0207665_100014356 290
269 3300027512 Ga0209179_1014093 Ga0209179_10140932 290
270 3300035695 Ga0373927_0026722 Ga0373927_0026722_2019_2957 290
271 3300048903 Ga0496100_0146565 Ga0496100_0146565_140_1024 290
272 3300048905 Ga0496102_0098027 Ga0496102_0098027_333_1217 290
273 3300048905 Ga0496102_0113275 Ga0496102_0113275_193_1065 290
274 3300048907 Ga0496104_0000280 Ga0496104_0000280_35308_36180 290
275 3300048907 Ga0496104_0016202 Ga0496104_0016202_438_1310 290
276 3300048909 Ga0496106_0076408 Ga0496106_0076408_1432_2304 290
277 3300048910 Ga0496107_0021462 Ga0496107_0021462_3322_4206 290
278 3300048910 Ga0496107_0332834 Ga0496107_0332834_185_1057 290
279 3300048911 Ga0496108_0105337 Ga0496108_0105337_430_1302 290
280 3300048915 Ga0496112_0102365 Ga0496112_0102365_92_964 290
281 3300048917 Ga0496114_0114005 Ga0496114_0114005_1202_2074 290
282 3300048918 Ga0496115_0055976 Ga0496115_0055976_1758_2630 290
283 3300050507 nmdc:mga05p37_411115_c1 nmdc:mga05p37_411115_c1_221_1132 290
284 3300050513 nmdc:mga0rr50_179722_c1 nmdc:mga0rr50_179722_c1_207_1091 290
285 3300050514 nmdc:mga08x19_242678_c1 nmdc:mga08x19_242678_c1_69_953 290
286 3300050514 nmdc:mga08x19_73337_c1 nmdc:mga08x19_73337_c1_1226_2113 290
287 3300050515 nmdc:mga0a205_281758_c1 nmdc:mga0a205_281758_c1_410_1294 290
288 3300001991 JGI24743J22301_10001521 JGI24743J22301_100015211 291
289 3300002077 JGI24744J21845_10000391 JGI24744J21845_100003916 291
290 3300002239 JGI24034J26672_10000964 JGI24034J26672_100009644 291
291 3300003659 JGI25404J52841_10010205 JGI25404J52841_100102052 291
292 3300005328 Ga0070676_10020750 Ga0070676_100207503 291
293 3300005329 Ga0070683_100366629 Ga0070683_1003666292 291
294 3300005330 Ga0070690_100015208 Ga0070690_1000152081 291
295 3300005331 Ga0070670_100015340 Ga0070670_1000153406 291
296 3300005335 Ga0070666_10015233 Ga0070666_100152331 291
297 3300005345 Ga0070692_10033733 Ga0070692_100337333 291
298 3300005355 Ga0070671_100141291 Ga0070671_1001412911 291
299 3300005364 Ga0070673_100323081 Ga0070673_1003230812 291
300 3300005367 Ga0070667_100018786 Ga0070667_1000187866 291
301 3300005434 Ga0070709_10048919 Ga0070709_100489192 291
302 3300005436 Ga0070713_100030368 Ga0070713_1000303684 291
303 3300005438 Ga0070701_10021077 Ga0070701_100210772 291
304 3300005441 Ga0070700_100013170 Ga0070700_1000131704 291
305 3300005456 Ga0070678_100017455 Ga0070678_1000174554 291
306 3300005457 Ga0070662_100259976 Ga0070662_1002599762 291
307 3300005466 Ga0070685_10086228 Ga0070685_100862282 291
308 3300005544 Ga0070686_100002493 Ga0070686_1000024935 291
309 3300005563 Ga0068855_100608527 Ga0068855_1006085272 291
310 3300005577 Ga0068857_100450919 Ga0068857_1004509191 291
311 3300005840 Ga0068870_10001278 Ga0068870_100012784 291
312 3300005842 Ga0068858_100003359 Ga0068858_1000033598 291
313 3300005843 Ga0068860_100047356 Ga0068860_1000473562 291
314 3300005937 Ga0081455_10007998 Ga0081455_100079985 291
315 3300005937 Ga0081455_10098364 Ga0081455_100983642 291
316 3300005981 Ga0081538_10076177 Ga0081538_100761772 291
317 3300005983 Ga0081540_1000008 Ga0081540_100000892 291
318 3300005983 Ga0081540_1048354 Ga0081540_10483542 291
319 3300006038 Ga0075365_10007347 Ga0075365_100073474 291
320 3300006048 Ga0075363_100154214 Ga0075363_1001542142 291
321 3300006163 Ga0070715_10019985 Ga0070715_100199853 291
322 3300006177 Ga0075362_10143422 Ga0075362_101434222 291
323 3300006178 Ga0075367_10036392 Ga0075367_100363922 291
324 3300006358 Ga0068871_100039780 Ga0068871_1000397804 291
325 3300006844 Ga0075428_100219790 Ga0075428_1002197902 291
326 3300006846 Ga0075430_100229157 Ga0075430_1002291572 291
327 3300006847 Ga0075431_100081785 Ga0075431_1000817852 291
328 3300006871 Ga0075434_100108144 Ga0075434_1001081443 291
329 3300006880 Ga0075429_100145556 Ga0075429_1001455562 291
330 3300006881 Ga0068865_100013556 Ga0068865_1000135563 291
331 3300009092 Ga0105250_10082701 Ga0105250_100827012 291
332 3300009098 Ga0105245_10233503 Ga0105245_102335032 291
333 3300009101 Ga0105247_10050544 Ga0105247_100505442 291
334 3300009101 Ga0105247_10136392 Ga0105247_101363921 291
335 3300009147 Ga0114129_10108617 Ga0114129_101086173 291
336 3300009148 Ga0105243_10420320 Ga0105243_104203202 291
337 3300009176 Ga0105242_10052438 Ga0105242_100524381 291
338 3300009176 Ga0105242_10070255 Ga0105242_100702552 291
339 3300009177 Ga0105248_10013941 Ga0105248_100139413 291
340 3300009177 Ga0105248_10100711 Ga0105248_101007113 291
341 3300010375 Ga0105239_10413847 Ga0105239_104138472 291
342 3300013306 Ga0163162_10067064 Ga0163162_100670643 291
343 3300013306 Ga0163162_10154028 Ga0163162_101540281 291
344 3300013307 Ga0157372_10881092 Ga0157372_108810921 291
345 3300013308 Ga0157375_10653568 Ga0157375_106535681 291
346 3300014968 Ga0157379_10159577 Ga0157379_101595772 291
347 3300025900 Ga0207710_10009427 Ga0207710_100094273 291
348 3300025901 Ga0207688_10002540 Ga0207688_100025402 291
349 3300025901 Ga0207688_10173532 Ga0207688_101735322 291
350 3300025904 Ga0207647_10013439 Ga0207647_100134395 291
351 3300025907 Ga0207645_10013005 Ga0207645_100130054 291
352 3300025908 Ga0207643_10000967 Ga0207643_1000096713 291
353 3300025918 Ga0207662_10011477 Ga0207662_100114773 291
354 3300025919 Ga0207657_10052414 Ga0207657_100524142 291
355 3300025920 Ga0207649_10214620 Ga0207649_102146202 291
356 3300025925 Ga0207650_10009662 Ga0207650_100096626 291
357 3300025925 Ga0207650_10022709 Ga0207650_100227092 291
358 3300025929 Ga0207664_10304992 Ga0207664_103049922 291
359 3300025933 Ga0207706_10063514 Ga0207706_100635143 291
360 3300025938 Ga0207704_10010940 Ga0207704_100109403 291
361 3300025940 Ga0207691_10024270 Ga0207691_100242703 291
362 3300025941 Ga0207711_10015837 Ga0207711_100158375 291
363 3300025941 Ga0207711_10062207 Ga0207711_100622072 291
364 3300025942 Ga0207689_10026731 Ga0207689_100267312 291
365 3300025944 Ga0207661_10128277 Ga0207661_101282772 291
366 3300025945 Ga0207679_10019653 Ga0207679_100196534 291
367 3300025949 Ga0207667_10104334 Ga0207667_101043343 291
368 3300026035 Ga0207703_10045246 Ga0207703_100452463 291
369 3300026067 Ga0207678_10014323 Ga0207678_100143235 291
370 3300026075 Ga0207708_10001893 Ga0207708_100018938 291
371 3300026088 Ga0207641_10008033 Ga0207641_100080335 291
372 3300026089 Ga0207648_10001640 Ga0207648_1000164014 291
373 3300026116 Ga0207674_10081025 Ga0207674_100810252 291
374 3300026118 Ga0207675_100007548 Ga0207675_1000075483 291
375 3300026121 Ga0207683_10027762 Ga0207683_100277624 291
376 3300026142 Ga0207698_10037686 Ga0207698_100376862 291
377 3300027907 Ga0207428_10082930 Ga0207428_100829302 291
378 3300035089 Ga0373944_0023423 Ga0373944_0023423_778_1653 291
379 3300035111 Ga0373923_0073998 Ga0373923_0073998_519_1394 291
380 3300035113 Ga0373936_0058415 Ga0373936_0058415_272_1147 291
381 3300035116 Ga0373945_0054665 Ga0373945_0054665_445_1320 291
382 3300035170 Ga0373943_0059144 Ga0373943_0059144_552_1427 291
383 3300035171 Ga0373946_0006277 Ga0373946_0006277_2236_3111 291
384 3300035692 Ga0373935_0048006 Ga0373935_0048006_197_1072 291
385 3300035725 Ga0373947_0071379 Ga0373947_0071379_920_1795 291
386 3300046455 Ga0495603_0131435 Ga0495603_0131435_197_1072 291
387 3300046459 Ga0495629_0029563 Ga0495629_0029563_841_1716 291
388 3300046472 Ga0495580_0062974 Ga0495580_0062974_1370_2245 291
389 3300046473 Ga0495582_0083192 Ga0495582_0083192_445_1320 291
390 3300046473 Ga0495582_0139576 Ga0495582_0139576_19_894 291
391 3300046491 Ga0495584_0121924 Ga0495584_0121924_183_1058 291
392 3300046499 Ga0495594_0029016 Ga0495594_0029016_260_1135 291
393 3300046500 Ga0495596_0044841 Ga0495596_0044841_688_1563 291
394 3300046513 Ga0495616_0019394 Ga0495616_0019394_301_1176 291
395 3300046514 Ga0495618_0091399 Ga0495618_0091399_246_1121 291
396 3300046514 Ga0495618_0181273 Ga0495618_0181273_435_1310 291
397 3300046516 Ga0495628_0224939 Ga0495628_0224939_124_999 291
398 3300046526 Ga0495666_0053853 Ga0495666_0053853_367_1242 291
399 3300046533 Ga0495640_0115256 Ga0495640_0115256_612_1487 291
400 3300046615 Ga0495656_0090369 Ga0495656_0090369_173_1048 291
401 3300046642 Ga0495634_0178478 Ga0495634_0178478_110_985 291
402 3300046674 Ga0495588_0024635 Ga0495588_0024635_1073_1948 291
403 3300046689 Ga0495613_0109984 Ga0495613_0109984_745_1620 291
404 3300046689 Ga0495613_0394841 Ga0495613_0394841_20_895 291
405 3300046691 Ga0495670_0098066 Ga0495670_0098066_180_1055 291
406 3300047319 Ga0495674_0513977 Ga0495674_0513977_64_939 291
407 3300047321 Ga0495676_0042243 Ga0495676_0042243_2700_3575 291
408 3300047446 Ga0495679_031766 Ga0495679_031766_749_1624 291
409 3300047471 Ga0495684_0049116 Ga0495684_0049116_2305_3180 291
410 3300048904 Ga0496101_0007757 Ga0496101_0007757_5223_6098 291
411 3300048904 Ga0496101_0072154 Ga0496101_0072154_627_1502 291
412 3300048905 Ga0496102_0096946 Ga0496102_0096946_1576_2451 291
413 3300048905 Ga0496102_0311498 Ga0496102_0311498_97_972 291
414 3300048906 Ga0496103_0026559 Ga0496103_0026559_1863_2738 291
415 3300048907 Ga0496104_0527032 Ga0496104_0527032_77_952 291
416 3300048908 Ga0496105_0024047 Ga0496105_0024047_2534_3409 291
417 3300048909 Ga0496106_0020789 Ga0496106_0020789_786_1661 291
418 3300048909 Ga0496106_0083359 Ga0496106_0083359_809_1684 291
419 3300048910 Ga0496107_0016731 Ga0496107_0016731_4060_4935 291
420 3300048910 Ga0496107_0027318 Ga0496107_0027318_2973_3848 291
421 3300048910 Ga0496107_0027628 Ga0496107_0027628_1214_2089 291
422 3300048911 Ga0496108_0002485 Ga0496108_0002485_4164_5039 291
423 3300048912 Ga0496109_0001072 Ga0496109_0001072_14270_15145 291
424 3300048912 Ga0496109_0004069 Ga0496109_0004069_5914_6789 291
425 3300048913 Ga0496110_0000570 Ga0496110_0000570_21392_22267 291
426 3300048913 Ga0496110_0014289 Ga0496110_0014289_3703_4578 291
427 3300048914 Ga0496111_0351229 Ga0496111_0351229_170_1045 291
428 3300048915 Ga0496112_0005539 Ga0496112_0005539_4038_4913 291
429 3300048915 Ga0496112_0005780 Ga0496112_0005780_5307_6182 291
430 3300048917 Ga0496114_0043676 Ga0496114_0043676_855_1730 291
431 3300048917 Ga0496114_0131046 Ga0496114_0131046_695_1570 291
432 3300048918 Ga0496115_0055171 Ga0496115_0055171_808_1683 291
433 3300049591 Ga0501075_0264412 Ga0501075_0264412_128_1003 291
434 3300049742 Ga0501080_0341172 Ga0501080_0341172_180_1055 291
435 3300049743 Ga0501081_0164875 Ga0501081_0164875_581_1456 291
436 3300050490 nmdc:mga03n38_64635_c1 nmdc:mga03n38_64635_c1_193_1068 291
437 3300050491 nmdc:mga00v17_89350_c1 nmdc:mga00v17_89350_c1_556_1431 291
438 3300050492 nmdc:mga0yw44_7604_c1 nmdc:mga0yw44_7604_c1_4092_4967 291
439 3300050494 nmdc:mga06z11_53525_c1 nmdc:mga06z11_53525_c1_882_1757 291
440 3300050495 nmdc:mga04h51_37308_c1 nmdc:mga04h51_37308_c1_269_1144 291
441 3300050507 nmdc:mga05p37_87424_c1 nmdc:mga05p37_87424_c1_1493_2368 291
442 3300050509 nmdc:mga0qj67_168690_c1 nmdc:mga0qj67_168690_c1_793_1668 291
443 3300050510 nmdc:mga06r32_96436_c1 nmdc:mga06r32_96436_c1_989_1864 291
444 3300050511 nmdc:mga08y16_95463_c1 nmdc:mga08y16_95463_c1_1230_2105 291
445 3300050512 nmdc:mga0n895_118848_c1 nmdc:mga0n895_118848_c1_501_1376 291
446 3300053084 Ga0495595_0089197 Ga0495595_0089197_128_1003 291
447 3300053085 Ga0495619_0027135 Ga0495619_0027135_779_1654 291
448 3300054114 Ga0501084_0138557 Ga0501084_0138557_597_1472 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

134

317

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7595 98 277
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7266 100 281
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.6963 44 281
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.6828 98 277
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.6774 94 277
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8905 90 282 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8784 95 283 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8778 90 282 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8697 101 283 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8645 99 287 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3D1YZ15-F1-model_v4 ABC transporter permease 0.9336 91 226 GO:0005886
GO:0055085
AF-A0A0Q4TC69-F1-model_v4 Nitrate ABC transporter permease 0.922 96 232 GO:0005886
GO:0055085
AF-A0A7C6CDF9-F1-model_v4 ABC transporter permease 0.9153 44 287 GO:0005886
GO:0055085
AF-A0A3C0PAW0-F1-model_v4 Sulfonate ABC transporter permease 0.9125 44 288 GO:0005886
GO:0055085
AF-A0A4Z0BKD1-F1-model_v4 ABC transporter permease 0.9081 46 288 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
70.08 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map