F446132

General Info

Members Datasets Scaffolds Average Seq Length
448 247 896 122

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_101324929|Ga0070716_1013249291
Length 131
Sequence MKYVCLVYLVENDMSAMTKKEADACTDESLAYDDALRKAGHLVVAHALQPIESATTVRVRNGKLFATDGPFAETKEQLGGFMLIEARDLNEAIQIAAKIPPAKYGSIEVRPTRELVLDDVPVQRAAAAAAP

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
243 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 2818991436 Collimonas arenae 515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 1.79
Rhizosphere 92.19
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_101324929 3300006173 Bacteria 583
2 JGI25162J39368_1000091 3300002737 Bacteria 101521
3 JGI25163J39215_1004869 3300002771 Bacteria 900
4 JGI25165J46597_1000172 3300003214 Bacteria 101521
5 Ga0055538_1000063 3300003751 Bacteria 101521
6 Ga0055539_1000096 3300003752 Bacteria 101521
7 Ga0055533_1000107 3300003756 Bacteria 101521
8 Ga0055525_1000140 3300003759 Bacteria 101521
9 Ga0055541_1000064 3300003841 Bacteria 101521
10 JGI25405J52794_10116132 3300003911 Bacteria 602
11 Ga0065712_10384327 3300005290 Bacteria 748
12 Ga0065715_10566177 3300005293 Bacteria 730
13 Ga0065707_10024392 3300005295 Bacteria 1712
14 Ga0070676_10352685 3300005328 Bacteria 1012
15 Ga0070690_100102096 3300005330 Bacteria 1903
16 Ga0070690_101372364 3300005330 Bacteria 568
17 Ga0068869_100006486 3300005334 Bacteria 7425
18 Ga0068869_100286873 3300005334 Bacteria 1325
19 Ga0068869_100565254 3300005334 Bacteria 957
20 Ga0068869_101249132 3300005334 Bacteria 654
21 Ga0070680_100043175 3300005336 Bacteria 3662
22 Ga0070680_100047768 3300005336 Bacteria 3486
23 Ga0070680_101371645 3300005336 Bacteria 612
24 Ga0070680_101607185 3300005336 Bacteria 563
25 Ga0070682_100137302 3300005337 Bacteria 1662
26 Ga0070689_100012167 3300005340 Bacteria 6189
27 Ga0070689_100092805 3300005340 Bacteria 2382
28 Ga0070689_100136231 3300005340 Bacteria 1972
29 Ga0070689_100714429 3300005340 Bacteria 876
30 Ga0070691_10226234 3300005341 Bacteria 993
31 Ga0070691_10570671 3300005341 Bacteria 664
32 Ga0070687_100242109 3300005343 Bacteria 1116
33 Ga0070661_100461237 3300005344 Bacteria 1012
34 Ga0070661_100623852 3300005344 Bacteria 873
35 Ga0070661_101313836 3300005344 Bacteria 607
36 Ga0070692_10154144 3300005345 Bacteria 1311
37 Ga0070669_100324612 3300005353 Bacteria 1244
38 Ga0070669_100642622 3300005353 Bacteria 892
39 Ga0070675_100056041 3300005354 Bacteria 3246
40 Ga0070675_100525493 3300005354 Bacteria 1068
41 Ga0070673_100053885 3300005364 Bacteria 3162
42 Ga0070688_101078678 3300005365 Bacteria 641
43 Ga0070659_100605025 3300005366 Bacteria 942
44 Ga0070667_101783305 3300005367 Bacteria 579
45 Ga0070703_10302841 3300005406 Bacteria 667
46 Ga0070701_10041098 3300005438 Bacteria 2354
47 Ga0070701_10902391 3300005438 Bacteria 610
48 Ga0070705_100019324 3300005440 Bacteria 3586
49 Ga0070705_100041354 3300005440 Bacteria 2627
50 Ga0070705_100105845 3300005440 Bacteria 1787
51 Ga0070705_100189015 3300005440 Bacteria 1402
52 Ga0070705_100874440 3300005440 Bacteria 721
53 Ga0070700_100039227 3300005441 Bacteria 2892
54 Ga0070700_100697308 3300005441 Bacteria 807
55 Ga0070700_100921085 3300005441 Bacteria 713
56 Ga0070694_100012128 3300005444 Bacteria 5352
57 Ga0070694_100406597 3300005444 Bacteria 1067
58 Ga0070694_100604247 3300005444 Bacteria 884
59 Ga0070708_100285162 3300005445 Bacteria 1554
60 Ga0070708_101264523 3300005445 Bacteria 690
61 Ga0070663_100098478 3300005455 Bacteria 2179
62 Ga0070662_100205160 3300005457 Bacteria 1566
63 Ga0070662_100208524 3300005457 Bacteria 1554
64 Ga0070662_101429971 3300005457 Bacteria 596
65 Ga0070681_10275499 3300005458 Bacteria 1594
66 Ga0070681_10286072 3300005458 Bacteria 1559
67 Ga0070681_10571771 3300005458 Bacteria 1044
68 Ga0070681_10701181 3300005458 Bacteria 928
69 Ga0068867_100076056 3300005459 Bacteria 2520
70 Ga0068867_100177152 3300005459 Bacteria 1693
71 Ga0068867_100259870 3300005459 Bacteria 1415
72 Ga0068867_100390648 3300005459 Bacteria 1171
73 Ga0070685_10035406 3300005466 Bacteria 2816
74 Ga0070685_10412293 3300005466 Bacteria 938
75 Ga0070706_100013644 3300005467 Bacteria 7512
76 Ga0070707_100341422 3300005468 Bacteria 1455
77 Ga0070698_100058064 3300005471 Bacteria 3913
78 Ga0070699_100029946 3300005518 Bacteria 4695
79 Ga0070699_102069227 3300005518 Bacteria 520
80 Ga0070679_100026592 3300005530 Bacteria 5688
81 Ga0070697_100051229 3300005536 Bacteria 3354
82 Ga0070672_100008032 3300005543 Bacteria 7207
83 Ga0070672_100469957 3300005543 Bacteria 1085
84 Ga0070686_100008218 3300005544 Bacteria 5841
85 Ga0070686_100094785 3300005544 Bacteria 2004
86 Ga0070686_100645259 3300005544 Bacteria 839
87 Ga0070686_100802518 3300005544 Bacteria 759
88 Ga0070695_100040840 3300005545 Bacteria 2939
89 Ga0070695_100582839 3300005545 Bacteria 876
90 Ga0070696_100111332 3300005546 Bacteria 1972
91 Ga0070696_100204642 3300005546 Bacteria 1475
92 Ga0070696_100521661 3300005546 Bacteria 948
93 Ga0070696_100533523 3300005546 Bacteria 938
94 Ga0070693_100338273 3300005547 Bacteria 1026
95 Ga0070665_100057510 3300005548 Bacteria 3898
96 Ga0070704_100208842 3300005549 Bacteria 1581
97 Ga0070704_100225021 3300005549 Bacteria 1527
98 Ga0070704_100373685 3300005549 Bacteria 1209
99 Ga0070704_100467835 3300005549 Bacteria 1089
100 Ga0070704_101086148 3300005549 Bacteria 726
101 Ga0070704_101488098 3300005549 Bacteria 623
102 Ga0070664_100261076 3300005564 Bacteria 1558
103 Ga0070664_100282088 3300005564 Bacteria 1498
104 Ga0070664_100386209 3300005564 Bacteria 1279
105 Ga0068857_100405442 3300005577 Bacteria 1269
106 Ga0068857_101920177 3300005577 Bacteria 580
107 Ga0068854_100400915 3300005578 Bacteria 1135
108 Ga0068854_100475537 3300005578 Bacteria 1048
109 Ga0070702_100011357 3300005615 Bacteria 4428
110 Ga0070702_100085477 3300005615 Bacteria 1900
111 Ga0070702_100633672 3300005615 Bacteria 806
112 Ga0068859_100041299 3300005617 Bacteria 4633
113 Ga0068859_100207311 3300005617 Bacteria 2046
114 Ga0068859_100360636 3300005617 Bacteria 1548
115 Ga0068864_100043617 3300005618 Bacteria 3840
116 Ga0068864_100413895 3300005618 Bacteria 1283
117 Ga0068866_10191784 3300005718 Bacteria 1215
118 Ga0068866_10251690 3300005718 Bacteria 1081
119 Ga0068861_100001310 3300005719 Bacteria 15593
120 Ga0068861_100015198 3300005719 Bacteria 5418
121 Ga0068861_100070619 3300005719 Bacteria 2705
122 Ga0068861_100215434 3300005719 Bacteria 1620
123 Ga0068861_100226520 3300005719 Bacteria 1583
124 Ga0068861_100941582 3300005719 Bacteria 821
125 Ga0068861_100950962 3300005719 Bacteria 817
126 Ga0068861_101510457 3300005719 Unclassified 659
127 Ga0068863_100133920 3300005841 Bacteria 2367
128 Ga0068863_100374809 3300005841 Bacteria 1389
129 Ga0068858_101084630 3300005842 Bacteria 786
130 Ga0068858_101330807 3300005842 Bacteria 707
131 Ga0068860_100043352 3300005843 Bacteria 4292
132 Ga0068860_100312595 3300005843 Bacteria 1541
133 Ga0068860_100322665 3300005843 Bacteria 1516
134 Ga0068860_102509484 3300005843 Bacteria 535
135 Ga0068862_100091972 3300005844 Bacteria 2643
136 Ga0068862_100228767 3300005844 Bacteria 1686
137 Ga0068862_100432913 3300005844 Bacteria 1237
138 Ga0068862_100451607 3300005844 Bacteria 1212
139 Ga0068862_101845532 3300005844 Bacteria 614
140 Ga0081455_10000189 3300005937 Bacteria 78564
141 Ga0081455_10217686 3300005937 Bacteria 1418
142 Ga0070715_10703180 3300006163 Bacteria 604
143 Ga0070716_100008675 3300006173 Bacteria 5049
144 Ga0075428_100057575 3300006844 Bacteria 4254
145 Ga0075428_100101592 3300006844 Bacteria 3135
146 Ga0075428_100529581 3300006844 Bacteria 1260
147 Ga0075430_100001479 3300006846 Bacteria 19145
148 Ga0075431_100003064 3300006847 Bacteria 16181
149 Ga0075431_100622103 3300006847 Bacteria 1062
150 Ga0075433_10001027 3300006852 Bacteria 19903
151 Ga0075433_10071678 3300006852 Bacteria 3046
152 Ga0075433_10213247 3300006852 Bacteria 1716
153 Ga0075434_100012330 3300006871 Bacteria 8098
154 Ga0075434_100015625 3300006871 Bacteria 7287
155 Ga0075434_100033003 3300006871 Bacteria 5107
156 Ga0075429_100932714 3300006880 Bacteria 759
157 Ga0075429_101364023 3300006880 Bacteria 618
158 Ga0068865_100136360 3300006881 Bacteria 1845
159 Ga0068865_100405262 3300006881 Bacteria 1118
160 Ga0068865_100853559 3300006881 Bacteria 789
161 Ga0068865_100995746 3300006881 Bacteria 734
162 Ga0075436_100038950 3300006914 Bacteria 3280
163 Ga0097620_100041299 3300006931 Bacteria 4633
164 Ga0097620_100207310 3300006931 Bacteria 2046
165 Ga0097620_100360636 3300006931 Bacteria 1548
166 Ga0075435_100006279 3300007076 Bacteria 8390
167 Ga0075435_100103986 3300007076 Bacteria 2356
168 Ga0075435_100164285 3300007076 Bacteria 1871
169 Ga0111539_10096136 3300009094 Bacteria 3479
170 Ga0111539_10129406 3300009094 Bacteria 2956
171 Ga0111539_10546694 3300009094 Bacteria 1349
172 Ga0105245_10025116 3300009098 Bacteria 5239
173 Ga0114129_10008809 3300009147 Bacteria 14398
174 Ga0114129_10043114 3300009147 Bacteria 6350
175 Ga0114129_10700140 3300009147 Bacteria 1302
176 Ga0105243_10258697 3300009148 Bacteria 1557
177 Ga0105243_10880911 3300009148 Bacteria 889
178 Ga0105241_10683810 3300009174 Bacteria 935
179 Ga0105241_12524065 3300009174 Bacteria 515
180 Ga0105242_10417516 3300009176 Bacteria 1256
181 Ga0105242_10700337 3300009176 Bacteria 991
182 Ga0105238_10764301 3300009551 Bacteria 981
183 Ga0105249_10399695 3300009553 Bacteria 1404
184 Ga0105249_10611403 3300009553 Bacteria 1145
185 Ga0105249_11226491 3300009553 Bacteria 821
186 Ga0105249_12285139 3300009553 Bacteria 614
187 Ga0105246_10413176 3300011119 Bacteria 1124
188 Ga0157378_11526867 3300013297 Bacteria 713
189 Ga0157378_12455628 3300013297 Bacteria 573
190 Ga0163162_10076369 3300013306 Bacteria 3412
191 Ga0163162_10217620 3300013306 Bacteria 2040
192 Ga0163162_10344989 3300013306 Bacteria 1622
193 Ga0163162_12382105 3300013306 Bacteria 608
194 Ga0157375_11154526 3300013308 Bacteria 908
195 Ga0163163_10538895 3300014325 Bacteria 1230
196 Ga0157380_10088284 3300014326 Bacteria 2551
197 Ga0157380_10214996 3300014326 Bacteria 1716
198 Ga0157380_10342441 3300014326 Bacteria 1395
199 Ga0157380_10345875 3300014326 Bacteria 1389
200 Ga0157380_10870348 3300014326 Bacteria 924
201 Ga0157380_11452746 3300014326 Bacteria 738
202 Ga0182008_10035632 3300014497 Bacteria 2491
203 Ga0157376_10572359 3300014969 Bacteria 1121
204 Ga0182006_1014135 3300015261 Bacteria 3446
205 Ga0182007_10025188 3300015262 Bacteria 2074
206 Ga0182005_1001310 3300015265 Bacteria 10200
207 Ga0163161_10252755 3300017792 Bacteria 1374
208 Ga0163161_10476111 3300017792 Bacteria 1013
209 Ga0213872_10161525 3300021361 Bacteria 975
210 Ga0213876_10383849 3300021384 Bacteria 747
211 Ga0213871_10055456 3300021441 Bacteria 1095
212 Ga0213871_10095255 3300021441 Bacteria 866
213 Ga0209784_100079 3300025224 Bacteria 136351
214 Ga0209566_100093 3300025225 Bacteria 136351
215 Ga0209674_100115 3300025226 Bacteria 136351
216 Ga0209672_103588 3300025228 Bacteria 3147
217 Ga0209563_100113 3300025230 Bacteria 136351
218 Ga0207427_100588 3300025231 Bacteria 18279
219 Ga0209437_100176 3300025233 Bacteria 136351
220 Ga0209677_100072 3300025253 Bacteria 136351
221 Ga0209233_1000183 3300025261 Bacteria 136351
222 Ga0207653_10459419 3300025885 Bacteria 500
223 Ga0207642_10350126 3300025899 Bacteria 871
224 Ga0207642_10484274 3300025899 Bacteria 755
225 Ga0207642_10790056 3300025899 Bacteria 603
226 Ga0207685_10038033 3300025905 Bacteria 1776
227 Ga0207684_10282453 3300025910 Bacteria 1431
228 Ga0207684_10878629 3300025910 Bacteria 755
229 Ga0207707_10468376 3300025912 Bacteria 1077
230 Ga0207707_10510880 3300025912 Bacteria 1024
231 Ga0207707_10697610 3300025912 Bacteria 852
232 Ga0207707_11051466 3300025912 Bacteria 666
233 Ga0207693_10388155 3300025915 Bacteria 1092
234 Ga0207660_10033511 3300025917 Bacteria 3554
235 Ga0207660_10098976 3300025917 Bacteria 2175
236 Ga0207660_10907409 3300025917 Bacteria 719
237 Ga0207649_10305960 3300025920 Bacteria 1164
238 Ga0207652_10015174 3300025921 Bacteria 6251
239 Ga0207646_10207312 3300025922 Bacteria 1770
240 Ga0207646_11491092 3300025922 Bacteria 586
241 Ga0207681_10230409 3300025923 Bacteria 1438
242 Ga0207681_10328067 3300025923 Bacteria 1219
243 Ga0207681_10350230 3300025923 Bacteria 1182
244 Ga0207659_10150152 3300025926 Bacteria 1819
245 Ga0207687_10661200 3300025927 Bacteria 884
246 Ga0207690_10343451 3300025932 Bacteria 1179
247 Ga0207706_10221481 3300025933 Bacteria 1657
248 Ga0207706_10243735 3300025933 Bacteria 1571
249 Ga0207709_10017464 3300025935 Bacteria 4004
250 Ga0207670_10012199 3300025936 Bacteria 5018
251 Ga0207670_10071419 3300025936 Bacteria 2401
252 Ga0207704_10060220 3300025938 Bacteria 2348
253 Ga0207704_10077521 3300025938 Bacteria 2134
254 Ga0207704_10694621 3300025938 Bacteria 842
255 Ga0207704_11296328 3300025938 Bacteria 623
256 Ga0207665_10007453 3300025939 Bacteria 7235
257 Ga0207665_11221008 3300025939 Bacteria 600
258 Ga0207691_10029682 3300025940 Bacteria 5114
259 Ga0207691_10060666 3300025940 Bacteria 3436
260 Ga0207691_10402072 3300025940 Bacteria 1168
261 Ga0207689_10017674 3300025942 Bacteria 6027
262 Ga0207689_10127160 3300025942 Bacteria 2096
263 Ga0207689_10247587 3300025942 Bacteria 1474
264 Ga0207689_10407076 3300025942 Bacteria 1134
265 Ga0207689_10595222 3300025942 Bacteria 930
266 Ga0207679_10170883 3300025945 Bacteria 1789
267 Ga0207651_10060691 3300025960 Bacteria 2626
268 Ga0207651_10172396 3300025960 Bacteria 1708
269 Ga0207712_10108292 3300025961 Bacteria 2079
270 Ga0207712_10329588 3300025961 Bacteria 1262
271 Ga0207668_10187609 3300025972 Bacteria 1636
272 Ga0207640_10474228 3300025981 Bacteria 1036
273 Ga0207703_10558144 3300026035 Bacteria 1080
274 Ga0207703_10857084 3300026035 Bacteria 869
275 Ga0207678_10094231 3300026067 Bacteria 2558
276 Ga0207678_10406661 3300026067 Bacteria 1179
277 Ga0207708_10021457 3300026075 Bacteria 4870
278 Ga0207708_10675377 3300026075 Bacteria 881
279 Ga0207708_10729178 3300026075 Bacteria 849
280 Ga0207641_10411903 3300026088 Bacteria 1300
281 Ga0207641_11037802 3300026088 Bacteria 817
282 Ga0207648_10234382 3300026089 Bacteria 1633
283 Ga0207648_10336256 3300026089 Bacteria 1359
284 Ga0207648_10338810 3300026089 Bacteria 1354
285 Ga0207648_10342281 3300026089 Bacteria 1347
286 Ga0207648_10705164 3300026089 Bacteria 935
287 Ga0207676_10158827 3300026095 Bacteria 1956
288 Ga0207674_10159022 3300026116 Bacteria 2214
289 Ga0207675_100002498 3300026118 Bacteria 18195
290 Ga0207675_100013988 3300026118 Bacteria 7482
291 Ga0207675_100091494 3300026118 Bacteria 2860
292 Ga0207675_100222898 3300026118 Bacteria 1817
293 Ga0207675_100250535 3300026118 Bacteria 1714
294 Ga0207428_10019161 3300027907 Bacteria 5834
295 Ga0207428_10703210 3300027907 Bacteria 723
296 Ga0268265_10107136 3300028380 Bacteria 2272
297 Ga0268265_10520779 3300028380 Bacteria 1124
298 Ga0268265_10637286 3300028380 Bacteria 1023
299 Ga0268265_10639223 3300028380 Bacteria 1021
300 Ga0268264_10064138 3300028381 Bacteria 3091
301 Ga0268264_10212519 3300028381 Bacteria 1777
302 Ga0268264_10737377 3300028381 Bacteria 981
303 Ga0268264_10992131 3300028381 Bacteria 846
304 Ga0307509_10028702 3300031507 Bacteria 6183
305 Ga0307509_10236508 3300031507 Bacteria 1624
306 Ga0307408_100627554 3300031548 Bacteria 958
307 Ga0307413_10590921 3300031824 Bacteria 907
308 Ga0307406_10542240 3300031901 Bacteria 950
309 Ga0307406_10755706 3300031901 Bacteria 817
310 Ga0307407_11092751 3300031903 Bacteria 620
311 Ga0307416_102281257 3300032002 Bacteria 642
312 Ga0373930_0020708 3300034816 Bacteria 1284
313 Ga0373940_0208527 3300035088 Bacteria 645
314 Ga0373940_0307019 3300035088 Bacteria 548
315 Ga0373932_0443223 3300035112 Bacteria 509
316 Ga0373954_0177544 3300035118 Bacteria 1044
317 Ga0373942_0033798 3300035207 Bacteria 1365
318 Ga0373931_0053416 3300035691 Bacteria 2156
319 Ga0373931_0057001 3300035691 Bacteria 2094
320 Ga0436364_0450465 3300037853 Bacteria 972
321 Ga0436365_1729787 3300039437 Bacteria 916
322 Ga0436360_0000150 3300039438 Bacteria 676
323 Ga0436360_0559831 3300039438 Bacteria 2196
324 Ga0436360_0772219 3300039438 Bacteria 787
325 Ga0451800_1186227 3300041459 Bacteria 929
326 Ga0451802_0855479 3300041460 Bacteria 1049
327 Ga0451804_0045608 3300041463 Bacteria 744
328 Ga0451807_1471629 3300041486 Bacteria 998
329 Ga0451807_2170735 3300041486 Bacteria 755
330 Ga0451845_0207938 3300041501 Bacteria 831
331 Ga0439459_0042063 3300042438 Bacteria 975
332 Ga0451577_0149353 3300042876 Bacteria 2102
333 Ga0451577_0313464 3300042876 Bacteria 1422
334 Ga0453684_1333875 3300044712 Bacteria 747
335 Ga0495592_0073078 3300046454 Bacteria 2494
336 Ga0495603_0311216 3300046455 Bacteria 904
337 Ga0495590_0008205 3300046457 Bacteria 3996
338 Ga0495638_0080090 3300046460 Bacteria 1985
339 Ga0495638_0281775 3300046460 Bacteria 903
340 Ga0495651_0203077 3300046462 Bacteria 1385
341 Ga0495651_0225648 3300046462 Bacteria 1293
342 Ga0495653_0002698 3300046463 Bacteria 14142
343 Ga0495653_0669474 3300046463 Bacteria 632
344 Ga0495580_0000365 3300046472 Bacteria 36943
345 Ga0495580_0509719 3300046472 Bacteria 802
346 Ga0495584_0080927 3300046491 Bacteria 1635
347 Ga0495585_0183607 3300046492 Bacteria 1074
348 Ga0495594_0055641 3300046499 Bacteria 2182
349 Ga0495594_0891667 3300046499 Bacteria 500
350 Ga0495608_0038644 3300046511 Bacteria 3204
351 Ga0495610_0135357 3300046512 Bacteria 1066
352 Ga0495616_0021831 3300046513 Bacteria 3461
353 Ga0495628_0000440 3300046516 Bacteria 37864
354 Ga0495628_0011236 3300046516 Bacteria 7577
355 Ga0495632_0094040 3300046519 Bacteria 1418
356 Ga0495642_0344469 3300046528 Bacteria 655
357 Ga0495652_0003314 3300046529 Bacteria 16013
358 Ga0495652_0075012 3300046529 Bacteria 2811
359 Ga0495652_0279323 3300046529 Bacteria 1223
360 Ga0495645_0006667 3300046543 Bacteria 8021
361 Ga0495634_0101554 3300046642 Bacteria 1858
362 Ga0495625_0118386 3300046660 Bacteria 1804
363 Ga0495635_0103093 3300046663 Bacteria 1950
364 Ga0495659_0030112 3300046664 Bacteria 1887
365 Ga0495659_0180167 3300046664 Bacteria 860
366 Ga0495599_0000599 3300046678 Bacteria 20565
367 Ga0495623_0032885 3300046679 Bacteria 3331
368 Ga0495623_0251988 3300046679 Bacteria 992
369 Ga0495646_0006269 3300046680 Bacteria 7544
370 Ga0495646_0016002 3300046680 Bacteria 4760
371 Ga0495669_0062943 3300046684 Bacteria 1682
372 Ga0495669_0540244 3300046684 Bacteria 567
373 Ga0495624_0015875 3300046690 Bacteria 5072
374 Ga0495670_0526900 3300046691 Bacteria 642
375 Ga0495671_0642941 3300046692 Bacteria 504
376 Ga0495600_0001191 3300046809 Bacteria 14224
377 Ga0495636_0095507 3300047318 Bacteria 1295
378 Ga0495676_0072687 3300047321 Bacteria 2640
379 Ga0495686_0363268 3300047472 Bacteria 784
380 Ga0495602_0345848 3300048088 Bacteria 1074
381 Ga0495602_1137586 3300048088 Bacteria 510
382 Ga0496102_0002941 3300048905 Bacteria 14451
383 Ga0496104_0851010 3300048907 Bacteria 817
384 Ga0496115_0393025 3300048918 Bacteria 1126
385 Ga0501299_044874 3300049522 Bacteria 898
386 Ga0501034_0900984 3300049571 Unclassified 772
387 Ga0501036_0462320 3300049572 Bacteria 1057
388 Ga0501036_1022955 3300049572 Bacteria 676
389 Ga0501038_0550692 3300049574 Bacteria 877
390 Ga0501040_0891904 3300049576 Bacteria 644
391 Ga0501042_0273760 3300049578 Bacteria 1219
392 Ga0501046_1136223 3300049580 Unclassified 539
393 Ga0501047_0570728 3300049581 Bacteria 955
394 Ga0501067_0004484 3300049583 Bacteria 7701
395 Ga0501068_0022958 3300049584 Bacteria 3653
396 Ga0501069_0196041 3300049585 Bacteria 1169
397 Ga0501071_0005176 3300049587 Bacteria 8357
398 Ga0501071_0779135 3300049587 Bacteria 737
399 Ga0501072_0206942 3300049588 Bacteria 1564
400 Ga0501072_1073838 3300049588 Bacteria 627
401 Ga0501073_0002885 3300049589 Bacteria 12883
402 Ga0501074_0005962 3300049590 Bacteria 8790
403 Ga0501075_0109024 3300049591 Bacteria 2105
404 Ga0501076_0021717 3300049592 Bacteria 4927
405 Ga0501077_0887694 3300049593 Unclassified 573
406 Ga0501079_0005678 3300049741 Bacteria 9315
407 Ga0501079_0207134 3300049741 Bacteria 1532
408 Ga0501080_0003706 3300049742 Bacteria 13481
409 Ga0501080_1724344 3300049742 Bacteria 528
410 Ga0501081_0879920 3300049743 Bacteria 675
411 Ga0501083_0062113 3300049744 Bacteria 2493
412 Ga0501035_0822543 3300049822 Bacteria 741
413 Ga0501045_1011636 3300049824 Unclassified 609
414 nmdc:mga05p37_16241_c1 3300050507 Bacteria 8963
415 nmdc:mga05p37_706416_c1 3300050507 Bacteria 1119
416 nmdc:mga05p37_73700_c1 3300050507 Bacteria 4202
417 nmdc:mga09592_795283_c1 3300050508 Bacteria 800
418 nmdc:mga0qj67_4040_c1 3300050509 Bacteria 10628
419 nmdc:mga06r32_1711727_c1 3300050510 Bacteria 566
420 nmdc:mga06r32_544555_c1 3300050510 Bacteria 1135
421 nmdc:mga06r32_6180_c1 3300050510 Bacteria 10750
422 nmdc:mga08y16_20479_c1 3300050511 Bacteria 6982
423 nmdc:mga08y16_252531_c1 3300050511 Bacteria 1822
424 nmdc:mga08y16_300507_c1 3300050511 Bacteria 1654
425 nmdc:mga0n895_15792_c1 3300050512 Bacteria 6904
426 nmdc:mga0n895_35385_c1 3300050512 Bacteria 4815
427 nmdc:mga0n895_414093_c1 3300050512 Bacteria 1363
428 nmdc:mga0n895_64133_c1 3300050512 Bacteria 3634
429 nmdc:mga0rr50_327338_c1 3300050513 Bacteria 1286
430 nmdc:mga0rr50_4668_c1 3300050513 Bacteria 8074
431 nmdc:mga0rr50_54433_c1 3300050513 Bacteria 2981
432 nmdc:mga0rr50_751_c1 3300050513 Bacteria 17465
433 nmdc:mga08x19_10424_c1 3300050514 Bacteria 5580
434 nmdc:mga08x19_114289_c1 3300050514 Bacteria 1803
435 nmdc:mga0a205_351221_c1 3300050515 Bacteria 1342
436 nmdc:mga0a205_6165_c1 3300050515 Bacteria 10819
437 nmdc:mga0a205_70494_c1 3300050515 Bacteria 3375
438 Ga0495601_0001534 3300053077 Bacteria 12756
439 Ga0495601_0145113 3300053077 Bacteria 1549
440 Ga0500595_007369 3300053119 Bacteria 4569
441 Ga0500619_001300 3300053154 Bacteria 4378
442 Ga0500611_111002 3300053727 Bacteria 721
443 Ga0501084_0008484 3300054114 Bacteria 8498
444 Ga0501084_0532710 3300054114 Bacteria 993
445 Ga0501084_0838322 3300054114 Bacteria 774
446 Ga0501082_0056435 3300060353 Bacteria 3383
447 Ga0530510_0789681 3300061734 Bacteria 724
448 2819541304 2818991436 Bacteria 5376622
449 Ga0070716_101324929
450 JGI25162J39368_1000091
451 JGI25163J39215_1004869
452 JGI25165J46597_1000172
453 Ga0055538_1000063
454 Ga0055539_1000096
455 Ga0055533_1000107
456 Ga0055525_1000140
457 Ga0055541_1000064
458 JGI25405J52794_10116132
459 Ga0065712_10384327
460 Ga0065715_10566177
461 Ga0065707_10024392
462 Ga0070676_10352685
463 Ga0070690_100102096
464 Ga0070690_101372364
465 Ga0068869_100006486
466 Ga0068869_100286873
467 Ga0068869_100565254
468 Ga0068869_101249132
469 Ga0070680_100043175
470 Ga0070680_100047768
471 Ga0070680_101371645
472 Ga0070680_101607185
473 Ga0070682_100137302
474 Ga0070689_100012167
475 Ga0070689_100092805
476 Ga0070689_100136231
477 Ga0070689_100714429
478 Ga0070691_10226234
479 Ga0070691_10570671
480 Ga0070687_100242109
481 Ga0070661_100461237
482 Ga0070661_100623852
483 Ga0070661_101313836
484 Ga0070692_10154144
485 Ga0070669_100324612
486 Ga0070669_100642622
487 Ga0070675_100056041
488 Ga0070675_100525493
489 Ga0070673_100053885
490 Ga0070688_101078678
491 Ga0070659_100605025
492 Ga0070667_101783305
493 Ga0070703_10302841
494 Ga0070701_10041098
495 Ga0070701_10902391
496 Ga0070705_100019324
497 Ga0070705_100041354
498 Ga0070705_100105845
499 Ga0070705_100189015
500 Ga0070705_100874440
501 Ga0070700_100039227
502 Ga0070700_100697308
503 Ga0070700_100921085
504 Ga0070694_100012128
505 Ga0070694_100406597
506 Ga0070694_100604247
507 Ga0070708_100285162
508 Ga0070708_101264523
509 Ga0070663_100098478
510 Ga0070662_100205160
511 Ga0070662_100208524
512 Ga0070662_101429971
513 Ga0070681_10275499
514 Ga0070681_10286072
515 Ga0070681_10571771
516 Ga0070681_10701181
517 Ga0068867_100076056
518 Ga0068867_100177152
519 Ga0068867_100259870
520 Ga0068867_100390648
521 Ga0070685_10035406
522 Ga0070685_10412293
523 Ga0070706_100013644
524 Ga0070707_100341422
525 Ga0070698_100058064
526 Ga0070699_100029946
527 Ga0070699_102069227
528 Ga0070679_100026592
529 Ga0070697_100051229
530 Ga0070672_100008032
531 Ga0070672_100469957
532 Ga0070686_100008218
533 Ga0070686_100094785
534 Ga0070686_100645259
535 Ga0070686_100802518
536 Ga0070695_100040840
537 Ga0070695_100582839
538 Ga0070696_100111332
539 Ga0070696_100204642
540 Ga0070696_100521661
541 Ga0070696_100533523
542 Ga0070693_100338273
543 Ga0070665_100057510
544 Ga0070704_100208842
545 Ga0070704_100225021
546 Ga0070704_100373685
547 Ga0070704_100467835
548 Ga0070704_101086148
549 Ga0070704_101488098
550 Ga0070664_100261076
551 Ga0070664_100282088
552 Ga0070664_100386209
553 Ga0068857_100405442
554 Ga0068857_101920177
555 Ga0068854_100400915
556 Ga0068854_100475537
557 Ga0070702_100011357
558 Ga0070702_100085477
559 Ga0070702_100633672
560 Ga0068859_100041299
561 Ga0068859_100207311
562 Ga0068859_100360636
563 Ga0068864_100043617
564 Ga0068864_100413895
565 Ga0068866_10191784
566 Ga0068866_10251690
567 Ga0068861_100001310
568 Ga0068861_100015198
569 Ga0068861_100070619
570 Ga0068861_100215434
571 Ga0068861_100226520
572 Ga0068861_100941582
573 Ga0068861_100950962
574 Ga0068861_101510457
575 Ga0068863_100133920
576 Ga0068863_100374809
577 Ga0068858_101084630
578 Ga0068858_101330807
579 Ga0068860_100043352
580 Ga0068860_100312595
581 Ga0068860_100322665
582 Ga0068860_102509484
583 Ga0068862_100091972
584 Ga0068862_100228767
585 Ga0068862_100432913
586 Ga0068862_100451607
587 Ga0068862_101845532
588 Ga0081455_10000189
589 Ga0081455_10217686
590 Ga0070715_10703180
591 Ga0070716_100008675
592 Ga0075428_100057575
593 Ga0075428_100101592
594 Ga0075428_100529581
595 Ga0075430_100001479
596 Ga0075431_100003064
597 Ga0075431_100622103
598 Ga0075433_10001027
599 Ga0075433_10071678
600 Ga0075433_10213247
601 Ga0075434_100012330
602 Ga0075434_100015625
603 Ga0075434_100033003
604 Ga0075429_100932714
605 Ga0075429_101364023
606 Ga0068865_100136360
607 Ga0068865_100405262
608 Ga0068865_100853559
609 Ga0068865_100995746
610 Ga0075436_100038950
611 Ga0097620_100041299
612 Ga0097620_100207310
613 Ga0097620_100360636
614 Ga0075435_100006279
615 Ga0075435_100103986
616 Ga0075435_100164285
617 Ga0111539_10096136
618 Ga0111539_10129406
619 Ga0111539_10546694
620 Ga0105245_10025116
621 Ga0114129_10008809
622 Ga0114129_10043114
623 Ga0114129_10700140
624 Ga0105243_10258697
625 Ga0105243_10880911
626 Ga0105241_10683810
627 Ga0105241_12524065
628 Ga0105242_10417516
629 Ga0105242_10700337
630 Ga0105238_10764301
631 Ga0105249_10399695
632 Ga0105249_10611403
633 Ga0105249_11226491
634 Ga0105249_12285139
635 Ga0105246_10413176
636 Ga0157378_11526867
637 Ga0157378_12455628
638 Ga0163162_10076369
639 Ga0163162_10217620
640 Ga0163162_10344989
641 Ga0163162_12382105
642 Ga0157375_11154526
643 Ga0163163_10538895
644 Ga0157380_10088284
645 Ga0157380_10214996
646 Ga0157380_10342441
647 Ga0157380_10345875
648 Ga0157380_10870348
649 Ga0157380_11452746
650 Ga0182008_10035632
651 Ga0157376_10572359
652 Ga0182006_1014135
653 Ga0182007_10025188
654 Ga0182005_1001310
655 Ga0163161_10252755
656 Ga0163161_10476111
657 Ga0213872_10161525
658 Ga0213876_10383849
659 Ga0213871_10055456
660 Ga0213871_10095255
661 Ga0209784_100079
662 Ga0209566_100093
663 Ga0209674_100115
664 Ga0209672_103588
665 Ga0209563_100113
666 Ga0207427_100588
667 Ga0209437_100176
668 Ga0209677_100072
669 Ga0209233_1000183
670 Ga0207653_10459419
671 Ga0207642_10350126
672 Ga0207642_10484274
673 Ga0207642_10790056
674 Ga0207685_10038033
675 Ga0207684_10282453
676 Ga0207684_10878629
677 Ga0207707_10468376
678 Ga0207707_10510880
679 Ga0207707_10697610
680 Ga0207707_11051466
681 Ga0207693_10388155
682 Ga0207660_10033511
683 Ga0207660_10098976
684 Ga0207660_10907409
685 Ga0207649_10305960
686 Ga0207652_10015174
687 Ga0207646_10207312
688 Ga0207646_11491092
689 Ga0207681_10230409
690 Ga0207681_10328067
691 Ga0207681_10350230
692 Ga0207659_10150152
693 Ga0207687_10661200
694 Ga0207690_10343451
695 Ga0207706_10221481
696 Ga0207706_10243735
697 Ga0207709_10017464
698 Ga0207670_10012199
699 Ga0207670_10071419
700 Ga0207704_10060220
701 Ga0207704_10077521
702 Ga0207704_10694621
703 Ga0207704_11296328
704 Ga0207665_10007453
705 Ga0207665_11221008
706 Ga0207691_10029682
707 Ga0207691_10060666
708 Ga0207691_10402072
709 Ga0207689_10017674
710 Ga0207689_10127160
711 Ga0207689_10247587
712 Ga0207689_10407076
713 Ga0207689_10595222
714 Ga0207679_10170883
715 Ga0207651_10060691
716 Ga0207651_10172396
717 Ga0207712_10108292
718 Ga0207712_10329588
719 Ga0207668_10187609
720 Ga0207640_10474228
721 Ga0207703_10558144
722 Ga0207703_10857084
723 Ga0207678_10094231
724 Ga0207678_10406661
725 Ga0207708_10021457
726 Ga0207708_10675377
727 Ga0207708_10729178
728 Ga0207641_10411903
729 Ga0207641_11037802
730 Ga0207648_10234382
731 Ga0207648_10336256
732 Ga0207648_10338810
733 Ga0207648_10342281
734 Ga0207648_10705164
735 Ga0207676_10158827
736 Ga0207674_10159022
737 Ga0207675_100002498
738 Ga0207675_100013988
739 Ga0207675_100091494
740 Ga0207675_100222898
741 Ga0207675_100250535
742 Ga0207428_10019161
743 Ga0207428_10703210
744 Ga0268265_10107136
745 Ga0268265_10520779
746 Ga0268265_10637286
747 Ga0268265_10639223
748 Ga0268264_10064138
749 Ga0268264_10212519
750 Ga0268264_10737377
751 Ga0268264_10992131
752 Ga0307509_10028702
753 Ga0307509_10236508
754 Ga0307408_100627554
755 Ga0307413_10590921
756 Ga0307406_10542240
757 Ga0307406_10755706
758 Ga0307407_11092751
759 Ga0307416_102281257
760 Ga0373930_0020708
761 Ga0373940_0208527
762 Ga0373940_0307019
763 Ga0373932_0443223
764 Ga0373954_0177544
765 Ga0373942_0033798
766 Ga0373931_0053416
767 Ga0373931_0057001
768 Ga0436364_0450465
769 Ga0436365_1729787
770 Ga0436360_0000150
771 Ga0436360_0559831
772 Ga0436360_0772219
773 Ga0451800_1186227
774 Ga0451802_0855479
775 Ga0451804_0045608
776 Ga0451807_1471629
777 Ga0451807_2170735
778 Ga0451845_0207938
779 Ga0439459_0042063
780 Ga0451577_0149353
781 Ga0451577_0313464
782 Ga0453684_1333875
783 Ga0495592_0073078
784 Ga0495603_0311216
785 Ga0495590_0008205
786 Ga0495638_0080090
787 Ga0495638_0281775
788 Ga0495651_0203077
789 Ga0495651_0225648
790 Ga0495653_0002698
791 Ga0495653_0669474
792 Ga0495580_0000365
793 Ga0495580_0509719
794 Ga0495584_0080927
795 Ga0495585_0183607
796 Ga0495594_0055641
797 Ga0495594_0891667
798 Ga0495608_0038644
799 Ga0495610_0135357
800 Ga0495616_0021831
801 Ga0495628_0000440
802 Ga0495628_0011236
803 Ga0495632_0094040
804 Ga0495642_0344469
805 Ga0495652_0003314
806 Ga0495652_0075012
807 Ga0495652_0279323
808 Ga0495645_0006667
809 Ga0495634_0101554
810 Ga0495625_0118386
811 Ga0495635_0103093
812 Ga0495659_0030112
813 Ga0495659_0180167
814 Ga0495599_0000599
815 Ga0495623_0032885
816 Ga0495623_0251988
817 Ga0495646_0006269
818 Ga0495646_0016002
819 Ga0495669_0062943
820 Ga0495669_0540244
821 Ga0495624_0015875
822 Ga0495670_0526900
823 Ga0495671_0642941
824 Ga0495600_0001191
825 Ga0495636_0095507
826 Ga0495676_0072687
827 Ga0495686_0363268
828 Ga0495602_0345848
829 Ga0495602_1137586
830 Ga0496102_0002941
831 Ga0496104_0851010
832 Ga0496115_0393025
833 Ga0501299_044874
834 Ga0501034_0900984
835 Ga0501036_0462320
836 Ga0501036_1022955
837 Ga0501038_0550692
838 Ga0501040_0891904
839 Ga0501042_0273760
840 Ga0501046_1136223
841 Ga0501047_0570728
842 Ga0501067_0004484
843 Ga0501068_0022958
844 Ga0501069_0196041
845 Ga0501071_0005176
846 Ga0501071_0779135
847 Ga0501072_0206942
848 Ga0501072_1073838
849 Ga0501073_0002885
850 Ga0501074_0005962
851 Ga0501075_0109024
852 Ga0501076_0021717
853 Ga0501077_0887694
854 Ga0501079_0005678
855 Ga0501079_0207134
856 Ga0501080_0003706
857 Ga0501080_1724344
858 Ga0501081_0879920
859 Ga0501083_0062113
860 Ga0501035_0822543
861 Ga0501045_1011636
862 nmdc:mga05p37_16241_c1
863 nmdc:mga05p37_706416_c1
864 nmdc:mga05p37_73700_c1
865 nmdc:mga09592_795283_c1
866 nmdc:mga0qj67_4040_c1
867 nmdc:mga06r32_1711727_c1
868 nmdc:mga06r32_544555_c1
869 nmdc:mga06r32_6180_c1
870 nmdc:mga08y16_20479_c1
871 nmdc:mga08y16_252531_c1
872 nmdc:mga08y16_300507_c1
873 nmdc:mga0n895_15792_c1
874 nmdc:mga0n895_35385_c1
875 nmdc:mga0n895_414093_c1
876 nmdc:mga0n895_64133_c1
877 nmdc:mga0rr50_327338_c1
878 nmdc:mga0rr50_4668_c1
879 nmdc:mga0rr50_54433_c1
880 nmdc:mga0rr50_751_c1
881 nmdc:mga08x19_10424_c1
882 nmdc:mga08x19_114289_c1
883 nmdc:mga0a205_351221_c1
884 nmdc:mga0a205_6165_c1
885 nmdc:mga0a205_70494_c1
886 Ga0495601_0001534
887 Ga0495601_0145113
888 Ga0500595_007369
889 Ga0500619_001300
890 Ga0500611_111002
891 Ga0501084_0008484
892 Ga0501084_0532710
893 Ga0501084_0838322
894 Ga0501082_0056435
895 Ga0530510_0789681
896 2819541304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

1

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.9347 1 107
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8297 1 107
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.7178 1 108
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.6929 1 108
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.6771 1 108
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.9347 1 107 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8297 1 107 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.706 1 108 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6936 1 108 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.675 1 109 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A431M3H9-F1-model_v4 YciI family protein 0.9833 1 109
AF-A0A536EA00-F1-model_v4 YciI family protein 0.9735 23 105
AF-A0A5C6URQ3-F1-model_v4 YciI family protein 0.9717 1 110
AF-A0A2V8B9X9-F1-model_v4 Dehydrogenase 0.9712 1 101
AF-A0A2V7HNX1-F1-model_v4 YCII-related domain-containing protein 0.97 19 108

Map