F446087

General Info

Members Datasets Scaffolds Average Seq Length
448 288 421 204

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100143937|Ga0070690_1001439372
Length 181
Sequence MHIAILTFQGFNELDSLVALGVLNRVKKATWRVTLCCPEPMVTSMNGVVVHAQSRLSEVIVNDPGILSALPLNPARQLIGAQCSGTLLLAKLGLLGGVPACTDLTTKPWVEESGVEVLNQPFFAAGNIATAGGCFASQYLAAWIDAARAALHYVAPVGEKDEYVSRAMKNITPYLPGTCAA

Samples

Sample ID Description Type Environment
1 2511231021 Pseudomonas sp. GM78 Isolate Nodule
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
11 2738541277 Variovorax sp. GV051 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
14 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
15 2818991436 Collimonas arenae 515 Isolate Unclassified
16 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
17 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
18 2885198086 Variovorax sp. 679 Isolate Unclassified
19 2885211737 Variovorax sp. 553 Isolate Unclassified
20 2904564687 Burkholderia sp. 571 Isolate Unclassified
21 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
22 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
23 2928037797 Variovorax sp. 1126 Isolate Unclassified
24 2928044640 Variovorax sp. 1128 Isolate Unclassified
25 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
26 2928536128 Burkholderia sola 565 Isolate Unclassified
27 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
28 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
29 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
35 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
36 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
37 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
38 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
49 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
50 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
119 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
174 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
175 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
176 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
177 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
226 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
227 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
272 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
273 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
274 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
275 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
276 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
277 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
278 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
279 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
280 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
281 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
285 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
286 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 642555112 Paraburkholderia phymatum STM815 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.97
Metatranscriptomes 0
Isolates 6.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.17
Nodule 0.89
Rhizoplane 5.13
Rhizosphere 68.3
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1001710 3300002076 Bacteria 3110
2 JGI25162J39368_1000061 3300002737 Bacteria 136847
3 JGI25158J39367_1001830 3300002739 Bacteria 3607
4 JGI25159J45721_1005260 3300002987 Bacteria 4090
5 JGI25165J46597_1000117 3300003214 Bacteria 137891
6 rootH2_10045261 3300003320 Bacteria 3669
7 rootH1_10108214 3300003323 Bacteria 3038
8 rootH1_10213411 3300003323 Bacteria 3177
9 JGI25160J50197_1000017 3300003354 Bacteria 246175
10 JGI25160J50197_1006084 3300003354 Bacteria 4924
11 Ga0055538_1000046 3300003751 Bacteria 137891
12 Ga0055539_1000065 3300003752 Bacteria 136847
13 Ga0055533_1000075 3300003756 Bacteria 137891
14 Ga0055533_1006352 3300003756 Bacteria 1753
15 Ga0055525_1000095 3300003759 Bacteria 137891
16 Ga0055534_1009289 3300003784 Bacteria 2148
17 Ga0055540_1007437 3300003792 Bacteria 4132
18 Ga0055540_1046786 3300003792 Bacteria 908
19 Ga0055541_1000047 3300003841 Bacteria 136847
20 Ga0065165_1000751 3300005262 Bacteria 44388
21 Ga0065712_10147450 3300005290 Bacteria 1397
22 Ga0065715_10108754 3300005293 Bacteria 2702
23 Ga0070676_10075705 3300005328 Bacteria 2030
24 Ga0070690_100143937 3300005330 Bacteria 1620
25 Ga0070670_100000493 3300005331 Bacteria 31595
26 Ga0070670_100142829 3300005331 Bacteria 2070
27 Ga0070670_100321632 3300005331 Bacteria 1355
28 Ga0070677_10001833 3300005333 Bacteria 6717
29 Ga0070677_10049359 3300005333 Bacteria 1694
30 Ga0068869_100024027 3300005334 Bacteria 4219
31 Ga0068869_100498119 3300005334 Bacteria 1017
32 Ga0070666_10223309 3300005335 Bacteria 1329
33 Ga0068868_100229875 3300005338 Bacteria 1556
34 Ga0070689_101031122 3300005340 Bacteria 733
35 Ga0070669_100059410 3300005353 Bacteria 2807
36 Ga0070669_100754615 3300005353 Bacteria 825
37 Ga0070675_100014052 3300005354 Bacteria 6306
38 Ga0070675_100102937 3300005354 Bacteria 2406
39 Ga0070671_100021008 3300005355 Bacteria 5327
40 Ga0070674_100009516 3300005356 Bacteria 5820
41 Ga0070674_100255572 3300005356 Bacteria 1378
42 Ga0070674_100404307 3300005356 Bacteria 1116
43 Ga0070673_100007985 3300005364 Bacteria 7010
44 Ga0070673_100048712 3300005364 Bacteria 3305
45 Ga0070673_100873255 3300005364 Bacteria 833
46 Ga0070673_101026229 3300005364 Bacteria 769
47 Ga0070667_100315820 3300005367 Bacteria 1409
48 Ga0070667_100690839 3300005367 Bacteria 944
49 Ga0070667_101014103 3300005367 Bacteria 775
50 Ga0070714_100754119 3300005435 Bacteria 941
51 Ga0070694_100382142 3300005444 Bacteria 1098
52 Ga0070678_100015581 3300005456 Bacteria 4835
53 Ga0070678_100033258 3300005456 Bacteria 3578
54 Ga0070678_100114768 3300005456 Bacteria 2113
55 Ga0070678_100213376 3300005456 Bacteria 1601
56 Ga0070678_100503613 3300005456 Bacteria 1069
57 Ga0068867_100016048 3300005459 Bacteria 5317
58 Ga0068867_100178545 3300005459 Bacteria 1687
59 Ga0070679_100926134 3300005530 Bacteria 815
60 Ga0068853_100322160 3300005539 Bacteria 1433
61 Ga0070672_100000362 3300005543 Bacteria 26134
62 Ga0070672_100141413 3300005543 Bacteria 1985
63 Ga0070672_100148279 3300005543 Bacteria 1939
64 Ga0070672_100337055 3300005543 Bacteria 1284
65 Ga0070686_100032652 3300005544 Bacteria 3193
66 Ga0070665_100035122 3300005548 Bacteria 5040
67 Ga0070665_100142947 3300005548 Bacteria 2396
68 Ga0070665_100277525 3300005548 Bacteria 1678
69 Ga0070665_101335610 3300005548 Bacteria 727
70 Ga0068855_100985604 3300005563 Bacteria 886
71 Ga0070664_100044545 3300005564 Bacteria 3747
72 Ga0070664_100051616 3300005564 Bacteria 3481
73 Ga0068857_100072501 3300005577 Bacteria 3069
74 Ga0068852_100114626 3300005616 Bacteria 2456
75 Ga0068859_100190255 3300005617 Bacteria 2136
76 Ga0068859_100335631 3300005617 Bacteria 1606
77 Ga0068859_101687038 3300005617 Bacteria 700
78 Ga0068864_100192646 3300005618 Bacteria 1870
79 Ga0068861_100084798 3300005719 Bacteria 2487
80 Ga0068861_100392287 3300005719 Bacteria 1230
81 Ga0068851_10016377 3300005834 Bacteria 3546
82 Ga0068851_10087068 3300005834 Bacteria 1640
83 Ga0068851_10096863 3300005834 Bacteria 1561
84 Ga0068870_10405884 3300005840 Bacteria 888
85 Ga0068863_100027622 3300005841 Bacteria 5414
86 Ga0068858_100133125 3300005842 Bacteria 2332
87 Ga0068858_100646948 3300005842 Bacteria 1027
88 Ga0068858_100735837 3300005842 Unclassified 960
89 Ga0068860_100289757 3300005843 Bacteria 1602
90 Ga0068862_100930181 3300005844 Bacteria 856
91 Ga0068862_101545036 3300005844 Bacteria 670
92 Ga0075362_10024425 3300006177 Bacteria 2564
93 Ga0075362_10074157 3300006177 Bacteria 1559
94 Ga0075366_10011942 3300006195 Bacteria 4917
95 Ga0075366_10076843 3300006195 Bacteria 1993
96 Ga0097621_100013175 3300006237 Bacteria 6151
97 Ga0097621_100023892 3300006237 Bacteria 4765
98 Ga0097621_100044748 3300006237 Bacteria 3572
99 Ga0097621_100045880 3300006237 Bacteria 3532
100 Ga0068871_100007969 3300006358 Bacteria 7599
101 Ga0068871_100022642 3300006358 Bacteria 4847
102 Ga0068871_100035022 3300006358 Bacteria 3987
103 Ga0068871_100214007 3300006358 Bacteria 1668
104 Ga0075428_100068927 3300006844 Bacteria 3869
105 Ga0068865_100020538 3300006881 Bacteria 4284
106 Ga0097620_100190249 3300006931 Bacteria 2136
107 Ga0097620_100335637 3300006931 Bacteria 1606
108 Ga0097620_101687035 3300006931 Bacteria 700
109 Ga0105244_10003954 3300009036 Bacteria 10393
110 Ga0105244_10092761 3300009036 Bacteria 1484
111 Ga0105240_10223881 3300009093 Bacteria 2190
112 Ga0111539_10001800 3300009094 Bacteria 28533
113 Ga0105245_10128715 3300009098 Bacteria 2373
114 Ga0105243_10000385 3300009148 Bacteria 47177
115 Ga0105243_10170053 3300009148 Bacteria 1886
116 Ga0105243_10329473 3300009148 Bacteria 1394
117 Ga0105243_10351527 3300009148 Bacteria 1354
118 Ga0105241_10944708 3300009174 Bacteria 803
119 Ga0105242_10018466 3300009176 Bacteria 5452
120 Ga0105248_10003616 3300009177 Bacteria 17150
121 Ga0105248_10447890 3300009177 Bacteria 1455
122 Ga0105248_10487239 3300009177 Bacteria 1390
123 Ga0105248_10816333 3300009177 Bacteria 1053
124 Ga0105248_11000032 3300009177 Bacteria 945
125 Ga0105249_10040354 3300009553 Bacteria 4239
126 Ga0105249_10583566 3300009553 Bacteria 1171
127 Ga0105239_10517446 3300010375 Bacteria 1357
128 Ga0105246_10015764 3300011119 Bacteria 4778
129 Ga0157374_10025829 3300013296 Bacteria 5280
130 Ga0157378_10016883 3300013297 Bacteria 6398
131 Ga0157378_10508773 3300013297 Bacteria 1204
132 Ga0157378_10526895 3300013297 Bacteria 1184
133 Ga0157378_10577001 3300013297 Bacteria 1133
134 Ga0163162_10004865 3300013306 Bacteria 12963
135 Ga0163162_10063827 3300013306 Bacteria 3727
136 Ga0163162_10622449 3300013306 Bacteria 1204
137 Ga0157375_10033265 3300013308 Bacteria 4897
138 Ga0157375_10552440 3300013308 Bacteria 1313
139 Ga0157375_10724102 3300013308 Bacteria 1147
140 Ga0163163_10168352 3300014325 Bacteria 2238
141 Ga0182008_10009042 3300014497 Bacteria 5394
142 Ga0157379_10009921 3300014968 Bacteria 8294
143 Ga0157376_10038711 3300014969 Bacteria 3881
144 Ga0157376_10175648 3300014969 Bacteria 1954
145 Ga0157376_10227586 3300014969 Bacteria 1730
146 Ga0182006_1001750 3300015261 Bacteria 12597
147 Ga0182006_1003729 3300015261 Bacteria 7701
148 Ga0182007_10000335 3300015262 Bacteria 29829
149 Ga0182007_10000753 3300015262 Bacteria 18210
150 Ga0182007_10003350 3300015262 Bacteria 7576
151 Ga0182005_1000242 3300015265 Bacteria 34928
152 Ga0183361_10003 3300016635 Bacteria 577277
153 Ga0163161_10006811 3300017792 Bacteria 7901
154 Ga0163161_10040074 3300017792 Bacteria 3364
155 Ga0163161_10645024 3300017792 Bacteria 877
156 Ga0209760_101685 3300025207 Bacteria 2251
157 Ga0209784_100010 3300025224 Bacteria 683664
158 Ga0209566_100008 3300025225 Bacteria 683664
159 Ga0209674_100019 3300025226 Bacteria 683664
160 Ga0209563_100021 3300025230 Bacteria 683764
161 Ga0207427_100509 3300025231 Bacteria 20603
162 Ga0209437_100019 3300025233 Bacteria 683764
163 Ga0209677_100011 3300025253 Bacteria 683664
164 Ga0209233_1000025 3300025261 Bacteria 683764
165 Ga0209130_1012205 3300025284 Bacteria 2261
166 Ga0209130_1023043 3300025284 Bacteria 1379
167 Ga0209676_1004853 3300025292 Bacteria 7286
168 Ga0209564_1002666 3300025295 Bacteria 13559
169 Ga0207426_1000107 3300025302 Bacteria 242623
170 Ga0209051_1049211 3300025303 Bacteria 1422
171 Ga0207697_10001628 3300025315 Bacteria 12139
172 Ga0207697_10241440 3300025315 Bacteria 798
173 Ga0207656_10032698 3300025321 Bacteria 2162
174 Ga0207656_10116907 3300025321 Bacteria 1238
175 Ga0207656_10186816 3300025321 Bacteria 997
176 Ga0207655_1005419 3300025728 Bacteria 8676
177 Ga0207682_10001005 3300025893 Bacteria 13068
178 Ga0207682_10259588 3300025893 Bacteria 810
179 Ga0207645_10071699 3300025907 Bacteria 2217
180 Ga0207643_10435915 3300025908 Bacteria 832
181 Ga0207695_10491881 3300025913 Bacteria 1109
182 Ga0207681_10000675 3300025923 Bacteria 22417
183 Ga0207681_10124952 3300025923 Bacteria 1893
184 Ga0207681_10685502 3300025923 Bacteria 851
185 Ga0207650_10000548 3300025925 Bacteria 30528
186 Ga0207650_10103381 3300025925 Bacteria 2196
187 Ga0207650_10544686 3300025925 Bacteria 972
188 Ga0207659_10011110 3300025926 Bacteria 5681
189 Ga0207659_10049589 3300025926 Bacteria 2979
190 Ga0207659_10312462 3300025926 Bacteria 1294
191 Ga0207659_10768091 3300025926 Bacteria 827
192 Ga0207687_10439239 3300025927 Bacteria 1080
193 Ga0207644_10032418 3300025931 Bacteria 3645
194 Ga0207644_10342039 3300025931 Bacteria 1213
195 Ga0207690_10004652 3300025932 Bacteria 8114
196 Ga0207690_10044527 3300025932 Bacteria 2926
197 Ga0207706_10006703 3300025933 Bacteria 10648
198 Ga0207709_10043412 3300025935 Bacteria 2710
199 Ga0207670_10231380 3300025936 Bacteria 1420
200 Ga0207704_10020150 3300025938 Bacteria 3521
201 Ga0207704_10249667 3300025938 Bacteria 1331
202 Ga0207691_10000390 3300025940 Bacteria 43939
203 Ga0207691_10291545 3300025940 Bacteria 1403
204 Ga0207691_10337359 3300025940 Bacteria 1291
205 Ga0207691_10393666 3300025940 Bacteria 1182
206 Ga0207691_10409222 3300025940 Bacteria 1156
207 Ga0207711_10119472 3300025941 Bacteria 2352
208 Ga0207711_10153170 3300025941 Bacteria 2082
209 Ga0207689_10028480 3300025942 Bacteria 4675
210 Ga0207679_10032365 3300025945 Bacteria 3670
211 Ga0207651_10008110 3300025960 Bacteria 5646
212 Ga0207651_10080554 3300025960 Bacteria 2344
213 Ga0207712_10562518 3300025961 Bacteria 982
214 Ga0207658_10020314 3300025986 Bacteria 4599
215 Ga0207658_10608270 3300025986 Bacteria 982
216 Ga0207703_10350608 3300026035 Bacteria 1359
217 Ga0207639_10179775 3300026041 Bacteria 1798
218 Ga0207678_10018792 3300026067 Bacteria 6070
219 Ga0207641_10084422 3300026088 Bacteria 2764
220 Ga0207648_10005035 3300026089 Bacteria 13408
221 Ga0207648_10192458 3300026089 Bacteria 1808
222 Ga0207648_10256908 3300026089 Bacteria 1558
223 Ga0207648_10325024 3300026089 Bacteria 1383
224 Ga0207676_10050736 3300026095 Bacteria 3236
225 Ga0207675_100019350 3300026118 Bacteria 6353
226 Ga0207675_100367371 3300026118 Bacteria 1413
227 Ga0207675_100413521 3300026118 Bacteria 1331
228 Ga0207675_101004731 3300026118 Bacteria 852
229 Ga0207683_10004118 3300026121 Bacteria 12572
230 Ga0207683_10004593 3300026121 Bacteria 11896
231 Ga0207683_10009877 3300026121 Bacteria 8141
232 Ga0207683_10243657 3300026121 Bacteria 1640
233 Ga0207698_10110896 3300026142 Bacteria 2299
234 Ga0207698_10333209 3300026142 Bacteria 1426
235 Ga0207698_10613561 3300026142 Bacteria 1074
236 Ga0207428_10073119 3300027907 Bacteria 2690
237 Ga0268266_10030284 3300028379 Bacteria 4599
238 Ga0268266_10174638 3300028379 Bacteria 1952
239 Ga0268265_10232590 3300028380 Bacteria 1621
240 Ga0268264_10248689 3300028381 Bacteria 1650
241 Ga0268264_10363643 3300028381 Bacteria 1381
242 Ga0307517_10328931 3300028786 Bacteria 841
243 Ga0307512_10042244 3300030522 Bacteria 3777
244 Ga0265327_10000512 3300031251 Bacteria 67274
245 Ga0307513_10007728 3300031456 Bacteria 13882
246 Ga0307513_10034617 3300031456 Bacteria 5665
247 Ga0307518_10189148 3300031838 Bacteria 1382
248 Ga0307406_10168754 3300031901 Bacteria 1582
249 Ga0307416_100021760 3300032002 Bacteria 4612
250 Ga0307510_10016593 3300033180 Bacteria 8691
251 Ga0373937_0005598 3300036401 Bacteria 10783
252 Ga0436361_0499947 3300039447 Bacteria 763
253 Ga0451791_0800637 3300041451 Bacteria 9000
254 Ga0451793_1149747 3300041452 Bacteria 1078
255 Ga0451802_0762457 3300041460 Bacteria 1491
256 Ga0451807_0047823 3300041486 Bacteria 1510
257 Ga0451807_1598963 3300041486 Bacteria 1201
258 Ga0451841_0828074 3300041498 Bacteria 890
259 Ga0451853_3305508 3300041512 Bacteria 2016
260 Ga0439442_001613 3300042002 Bacteria 4423
261 Ga0439446_0069127 3300042156 Bacteria 1078
262 Ga0451577_0301336 3300042876 Bacteria 1452
263 Ga0466965_0090882 3300044683 Bacteria 1553
264 Ga0466966_0008776 3300044684 Bacteria 6692
265 Ga0466971_0130707 3300044719 Bacteria 1165
266 Ga0466957_0010833 3300044842 Bacteria 5242
267 Ga0466957_0016891 3300044842 Bacteria 4269
268 Ga0451576_0011568 3300045051 Bacteria 10010
269 Ga0466958_0438421 3300045836 Bacteria 845
270 Ga0495592_0016873 3300046454 Bacteria 5545
271 Ga0495603_0000235 3300046455 Bacteria 28862
272 Ga0495603_0057006 3300046455 Bacteria 2312
273 Ga0495590_0072828 3300046457 Bacteria 1207
274 Ga0495629_0000633 3300046459 Bacteria 28575
275 Ga0495629_0033043 3300046459 Bacteria 3661
276 Ga0495629_0087035 3300046459 Bacteria 2180
277 Ga0495651_0085410 3300046462 Bacteria 2376
278 Ga0495651_0754132 3300046462 Bacteria 603
279 Ga0495653_0070382 3300046463 Bacteria 2618
280 Ga0495653_0191636 3300046463 Bacteria 1394
281 Ga0495650_0000651 3300046471 Bacteria 45752
282 Ga0495650_0003786 3300046471 Bacteria 10777
283 Ga0495580_0019785 3300046472 Bacteria 4995
284 Ga0495580_0065019 3300046472 Bacteria 2555
285 Ga0495664_0093210 3300046477 Bacteria 1812
286 Ga0495594_0058107 3300046499 Bacteria 2136
287 Ga0495596_0005559 3300046500 Bacteria 5928
288 Ga0495583_0019161 3300046506 Bacteria 3579
289 Ga0495583_0023667 3300046506 Bacteria 3102
290 Ga0495606_0373453 3300046507 Bacteria 750
291 Ga0495608_0035037 3300046511 Bacteria 3387
292 Ga0495616_0013337 3300046513 Bacteria 4639
293 Ga0495618_0090854 3300046514 Bacteria 1952
294 Ga0495628_0003529 3300046516 Bacteria 14005
295 Ga0495631_0000054 3300046518 Bacteria 70253
296 Ga0495642_0009342 3300046528 Bacteria 3754
297 Ga0495654_0006828 3300046530 Bacteria 6441
298 Ga0495640_0297267 3300046533 Bacteria 1003
299 Ga0495586_0035739 3300046535 Bacteria 2669
300 Ga0495586_0190336 3300046535 Bacteria 1162
301 Ga0495598_0036821 3300046537 Bacteria 1408
302 Ga0495621_0157365 3300046539 Bacteria 897
303 Ga0495621_0162909 3300046539 Bacteria 883
304 Ga0495597_0145359 3300046542 Bacteria 976
305 Ga0495645_0000163 3300046543 Bacteria 45933
306 Ga0495622_0019374 3300046557 Bacteria 3168
307 Ga0495622_0191302 3300046557 Bacteria 915
308 Ga0495667_0181574 3300046559 Bacteria 1350
309 Ga0495625_0068505 3300046660 Bacteria 2494
310 Ga0495635_0102016 3300046663 Bacteria 1961
311 Ga0495635_0288429 3300046663 Bacteria 1102
312 Ga0495659_0163471 3300046664 Bacteria 900
313 Ga0495599_0000818 3300046678 Bacteria 17508
314 Ga0495646_0047241 3300046680 Bacteria 2621
315 Ga0495646_0116317 3300046680 Bacteria 1517
316 Ga0495647_0009009 3300046681 Bacteria 3367
317 Ga0495647_0111628 3300046681 Bacteria 1142
318 Ga0495669_0006915 3300046684 Bacteria 4752
319 Ga0495613_0122088 3300046689 Bacteria 1870
320 Ga0495624_0043766 3300046690 Bacteria 2855
321 Ga0495670_0215514 3300046691 Bacteria 1019
322 Ga0495671_0059598 3300046692 Bacteria 1886
323 Ga0495649_0330037 3300046694 Bacteria 773
324 Ga0495589_0021945 3300046794 Bacteria 3262
325 Ga0495589_0028225 3300046794 Bacteria 2833
326 Ga0495600_0012713 3300046809 Bacteria 5270
327 Ga0495600_0053303 3300046809 Bacteria 2642
328 Ga0495600_0076603 3300046809 Bacteria 2184
329 Ga0495660_0061486 3300046810 Bacteria 2015
330 Ga0495581_0001220 3300047315 Bacteria 14157
331 Ga0495604_0003482 3300047317 Bacteria 12552
332 Ga0495674_0017418 3300047319 Bacteria 6683
333 Ga0495674_0253238 3300047319 Bacteria 1449
334 Ga0495672_0047941 3300047320 Bacteria 2537
335 Ga0495680_0303012 3300047322 Bacteria 1121
336 Ga0495683_0048316 3300047323 Bacteria 2133
337 Ga0495687_029431 3300047443 Bacteria 2542
338 Ga0495675_0012629 3300047444 Bacteria 5315
339 Ga0495675_0405225 3300047444 Bacteria 794
340 Ga0495681_0002250 3300047470 Bacteria 13882
341 Ga0495681_0021620 3300047470 Bacteria 3462
342 Ga0495681_0198394 3300047470 Bacteria 815
343 Ga0495684_0143161 3300047471 Bacteria 1792
344 Ga0495593_0016002 3300047673 Bacteria 4235
345 Ga0495593_0058739 3300047673 Bacteria 2017
346 Ga0495602_0046714 3300048088 Bacteria 3908
347 Ga0495614_0146361 3300048089 Bacteria 1052
348 Ga0495626_0059983 3300048091 Bacteria 1735
349 Ga0496100_0011109 3300048903 Bacteria 5112
350 Ga0496100_0077942 3300048903 Bacteria 2229
351 Ga0496101_0003291 3300048904 Bacteria 10050
352 Ga0496101_0005215 3300048904 Bacteria 8267
353 Ga0496101_0008532 3300048904 Bacteria 6698
354 Ga0496101_0014257 3300048904 Bacteria 5340
355 Ga0496102_0000581 3300048905 Bacteria 38737
356 Ga0496103_0003617 3300048906 Bacteria 9427
357 Ga0496104_0069286 3300048907 Bacteria 3352
358 Ga0496104_0243251 3300048907 Bacteria 1711
359 Ga0496105_0094036 3300048908 Bacteria 2475
360 Ga0496110_0355891 3300048913 Bacteria 1334
361 Ga0496112_0027209 3300048915 Bacteria 5514
362 Ga0496113_0000967 3300048916 Bacteria 15283
363 Ga0496114_0001484 3300048917 Bacteria 17814
364 Ga0496116_0033053 3300048919 Bacteria 3677
365 Ga0496116_0052889 3300048919 Bacteria 2686
366 Ga0496116_0270248 3300048919 Bacteria 831
367 Ga0496117_0000240 3300048920 Bacteria 103752
368 Ga0496117_0042075 3300048920 Bacteria 3338
369 Ga0496117_0068794 3300048920 Bacteria 2388
370 Ga0496117_0265891 3300048920 Bacteria 927
371 Ga0496118_0000200 3300048921 Bacteria 105546
372 Ga0496118_0002511 3300048921 Bacteria 24625
373 Ga0496118_0007548 3300048921 Bacteria 11485
374 Ga0496118_0034003 3300048921 Bacteria 4170
375 Ga0496118_0301374 3300048921 Bacteria 880
376 Ga0496119_0034929 3300048922 Bacteria 3301
377 Ga0496119_0062336 3300048922 Bacteria 2222
378 Ga0496119_0080681 3300048922 Bacteria 1876
379 Ga0496119_0194843 3300048922 Bacteria 1053
380 Ga0496120_0085690 3300048923 Bacteria 1695
381 Ga0496121_0001345 3300048924 Bacteria 41995
382 Ga0496121_0007183 3300048924 Bacteria 13491
383 Ga0496121_0047034 3300048924 Bacteria 3685
384 Ga0496121_0047165 3300048924 Bacteria 3679
385 Ga0496121_0065706 3300048924 Bacteria 2949
386 Ga0496123_0090611 3300048926 Bacteria 1817
387 Ga0496123_0159769 3300048926 Bacteria 1203
388 Ga0496124_0104494 3300048927 Bacteria 2290
389 Ga0496125_0020118 3300048928 Bacteria 6275
390 Ga0496125_0021613 3300048928 Bacteria 5997
391 Ga0496125_0197146 3300048928 Bacteria 1323
392 Ga0496126_0137204 3300048929 Bacteria 2109
393 Ga0496126_0385023 3300048929 Bacteria 1141
394 Ga0501298_043903 3300049521 Bacteria 912
395 nmdc:mga0k408_111628_c1 3300050493 Bacteria 1616
396 nmdc:mga0k408_56108_c1 3300050493 Bacteria 2285
397 nmdc:mga07m45_333909_c1 3300050496 Bacteria 881
398 nmdc:mga07m45_7817_c1 3300050496 Bacteria 5472
399 nmdc:mga08y16_247588_c1 3300050511 Bacteria 1842
400 Ga0495601_0052118 3300053077 Bacteria 2583
401 Ga0495619_0012812 3300053085 Bacteria 5281
402 Ga0500651_0000015 3300053093 Bacteria 161416
403 Ga0500562_004939 3300053108 Bacteria 3362
404 Ga0500562_020397 3300053108 Bacteria 1720
405 Ga0500571_000008 3300053110 Bacteria 87309
406 Ga0500594_0000546 3300053118 Bacteria 8149
407 Ga0500595_005311 3300053119 Bacteria 5642
408 Ga0500595_072020 3300053119 Bacteria 1024
409 Ga0500608_017802 3300053122 Bacteria 3233
410 Ga0500618_000449 3300053125 Bacteria 26845
411 Ga0500626_019091 3300053128 Bacteria 3037
412 Ga0500658_0000085 3300053134 Bacteria 43497
413 Ga0500658_0000181 3300053134 Bacteria 29974
414 Ga0500559_0005262 3300053136 Bacteria 5965
415 Ga0500564_096322 3300053138 Bacteria 1312
416 Ga0500568_0001205 3300053139 Bacteria 17266
417 Ga0500616_0054617 3300053153 Bacteria 2092
418 Ga0500619_001788 3300053154 Bacteria 3933
419 Ga0500638_021914 3300053162 Bacteria 3022
420 Ga0500636_0058013 3300053177 Bacteria 2264
421 Ga0466962_0341801 3300061719 Bacteria 744

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10508773 Ga0157378_105087731 171
2 3300006358 Ga0068871_100007969 Ga0068871_10000796914 175
3 3300025931 Ga0207644_10342039 Ga0207644_103420391 175
4 3300042156 Ga0439446_0069127 Ga0439446_0069127_21_626 179
5 3300005330 Ga0070690_100143937 Ga0070690_1001439372 181
6 3300005456 Ga0070678_100213376 Ga0070678_1002133762 181
7 3300005548 Ga0070665_100142947 Ga0070665_1001429472 181
8 3300013306 Ga0163162_10063827 Ga0163162_100638275 181
9 3300026089 Ga0207648_10325024 Ga0207648_103250241 181
10 3300026121 Ga0207683_10243657 Ga0207683_102436572 181
11 3300028379 Ga0268266_10174638 Ga0268266_101746381 181
12 3300032002 Ga0307416_100021760 Ga0307416_10002176010 181
13 3300005841 Ga0068863_100027622 Ga0068863_1000276227 182
14 3300006195 Ga0075366_10011942 Ga0075366_100119423 182
15 3300006237 Ga0097621_100023892 Ga0097621_1000238926 182
16 3300014969 Ga0157376_10038711 Ga0157376_100387116 182
17 3300026088 Ga0207641_10084422 Ga0207641_100844224 182
18 3300050493 nmdc:mga0k408_56108_c1 nmdc:mga0k408_56108_c1_1214_1831 184
19 3300005539 Ga0068853_100322160 Ga0068853_1003221602 187
20 3300006195 Ga0075366_10076843 Ga0075366_100768432 187
21 3300009148 Ga0105243_10170053 Ga0105243_101700532 187
22 3300009148 Ga0105243_10329473 Ga0105243_103294731 187
23 3300013297 Ga0157378_10526895 Ga0157378_105268952 187
24 3300026041 Ga0207639_10179775 Ga0207639_101797752 187
25 3300050493 nmdc:mga0k408_111628_c1 nmdc:mga0k408_111628_c1_29_646 188
26 3300050496 nmdc:mga07m45_7817_c1 nmdc:mga07m45_7817_c1_2067_2684 188
27 3300046462 Ga0495651_0754132 Ga0495651_0754132_16_585 189
28 3300031456 Ga0307513_10007728 Ga0307513_100077288 191
29 iso_pu_bacteria 2904564687 2904566614 195
30 iso_pu_bacteria 2904571731 2904573659 195
31 iso_pu_bacteria 2928536128 2928539505 195
32 iso_pu_bacteria 2513020051 2513228623 196
33 iso_pu_bacteria 2599185214 2599627133 196
34 iso_pu_bacteria 2599185226 2599677427 196
35 iso_pu_bacteria 2599185227 2599684566 196
36 iso_pu_bacteria 2599185229 2599696790 196
37 iso_pu_bacteria 2643221658 2644327760 196
38 iso_pu_bacteria 2738541277 2738722056 196
39 iso_pu_bacteria 2738543019 2739282420 196
40 iso_pu_bacteria 2858688981 2858689378 196
41 iso_pu_bacteria 2885198086 2885204648 196
42 iso_pu_bacteria 2885211737 2885218301 196
43 iso_pu_bacteria 2928037797 2928038983 196
44 iso_pu_bacteria 2928044640 2928045412 196
45 iso_pu_bacteria 2928084124 2928084512 196
46 3300003323 rootH1_10108214 rootH1_101082143 198
47 3300005548 Ga0070665_100035122 Ga0070665_1000351226 198
48 3300005617 Ga0068859_101687038 Ga0068859_1016870381 198
49 3300005844 Ga0068862_101545036 Ga0068862_1015450361 198
50 3300006177 Ga0075362_10074157 Ga0075362_100741574 198
51 3300006931 Ga0097620_101687035 Ga0097620_1016870351 198
52 3300016635 Ga0183361_10003 Ga0183361_10003272 198
53 3300028379 Ga0268266_10030284 Ga0268266_100302843 198
54 3300039447 Ga0436361_0499947 Ga0436361_0499947_32_628 198
55 3300015262 Ga0182007_10000753 Ga0182007_1000075313 199
56 3300044842 Ga0466957_0016891 Ga0466957_0016891_771_1370 199
57 3300002739 JGI25158J39367_1001830 JGI25158J39367_10018304 200
58 3300002987 JGI25159J45721_1005260 JGI25159J45721_10052604 200
59 3300003354 JGI25160J50197_1006084 JGI25160J50197_10060844 200
60 3300003756 Ga0055533_1006352 Ga0055533_10063522 200
61 3300003784 Ga0055534_1009289 Ga0055534_10092892 200
62 3300003792 Ga0055540_1046786 Ga0055540_10467861 200
63 3300005334 Ga0068869_100498119 Ga0068869_1004981192 200
64 3300005563 Ga0068855_100985604 Ga0068855_1009856042 200
65 3300005564 Ga0070664_100051616 Ga0070664_1000516164 200
66 3300005577 Ga0068857_100072501 Ga0068857_1000725012 200
67 3300005834 Ga0068851_10087068 Ga0068851_100870682 200
68 3300009036 Ga0105244_10003954 Ga0105244_100039545 200
69 3300009036 Ga0105244_10092761 Ga0105244_100927611 200
70 3300009093 Ga0105240_10223881 Ga0105240_102238812 200
71 3300009148 Ga0105243_10000385 Ga0105243_1000038519 200
72 3300009174 Ga0105241_10944708 Ga0105241_109447081 200
73 3300010375 Ga0105239_10517446 Ga0105239_105174462 200
74 3300011119 Ga0105246_10015764 Ga0105246_100157644 200
75 3300014497 Ga0182008_10009042 Ga0182008_100090424 200
76 3300014969 Ga0157376_10175648 Ga0157376_101756482 200
77 3300015261 Ga0182006_1001750 Ga0182006_10017508 200
78 3300015262 Ga0182007_10000335 Ga0182007_1000033511 200
79 3300017792 Ga0163161_10006811 Ga0163161_100068112 200
80 3300025284 Ga0209130_1023043 Ga0209130_10230432 200
81 3300025292 Ga0209676_1004853 Ga0209676_10048532 200
82 3300025303 Ga0209051_1049211 Ga0209051_10492112 200
83 3300025315 Ga0207697_10241440 Ga0207697_102414401 200
84 3300025321 Ga0207656_10032698 Ga0207656_100326981 200
85 3300025728 Ga0207655_1005419 Ga0207655_10054196 200
86 3300025913 Ga0207695_10491881 Ga0207695_104918811 200
87 3300025927 Ga0207687_10439239 Ga0207687_104392392 200
88 3300025932 Ga0207690_10004652 Ga0207690_1000465210 200
89 3300025932 Ga0207690_10044527 Ga0207690_100445274 200
90 3300025933 Ga0207706_10006703 Ga0207706_100067037 200
91 3300025935 Ga0207709_10043412 Ga0207709_100434122 200
92 3300026142 Ga0207698_10110896 Ga0207698_101108962 200
93 3300041451 Ga0451791_0800637 Ga0451791_0800637_7487_8089 200
94 3300041452 Ga0451793_1149747 Ga0451793_1149747_263_865 200
95 3300041460 Ga0451802_0762457 Ga0451802_0762457_413_1015 200
96 3300041486 Ga0451807_0047823 Ga0451807_0047823_326_928 200
97 3300041498 Ga0451841_0828074 Ga0451841_0828074_42_644 200
98 3300041512 Ga0451853_3305508 Ga0451853_3305508_710_1312 200
99 3300042876 Ga0451577_0301336 Ga0451577_0301336_597_1199 200
100 3300044683 Ga0466965_0090882 Ga0466965_0090882_54_671 200
101 3300044684 Ga0466966_0008776 Ga0466966_0008776_5929_6531 200
102 3300044719 Ga0466971_0130707 Ga0466971_0130707_92_694 200
103 3300044842 Ga0466957_0010833 Ga0466957_0010833_4040_4642 200
104 3300045051 Ga0451576_0011568 Ga0451576_0011568_2338_2940 200
105 3300045836 Ga0466958_0438421 Ga0466958_0438421_48_650 200
106 3300046518 Ga0495631_0000054 Ga0495631_0000054_2606_3208 200
107 3300046530 Ga0495654_0006828 Ga0495654_0006828_4026_4628 200
108 3300046539 Ga0495621_0162909 Ga0495621_0162909_96_698 200
109 3300046557 Ga0495622_0191302 Ga0495622_0191302_73_675 200
110 3300046660 Ga0495625_0068505 Ga0495625_0068505_1683_2285 200
111 3300046663 Ga0495635_0288429 Ga0495635_0288429_149_751 200
112 3300048904 Ga0496101_0005215 Ga0496101_0005215_1058_1660 200
113 3300048919 Ga0496116_0052889 Ga0496116_0052889_158_760 200
114 3300048920 Ga0496117_0042075 Ga0496117_0042075_2405_3007 200
115 3300048920 Ga0496117_0068794 Ga0496117_0068794_1760_2362 200
116 3300048921 Ga0496118_0002511 Ga0496118_0002511_2175_2813 200
117 3300048921 Ga0496118_0007548 Ga0496118_0007548_6445_7047 200
118 3300048921 Ga0496118_0301374 Ga0496118_0301374_171_773 200
119 3300048922 Ga0496119_0062336 Ga0496119_0062336_467_1069 200
120 3300048924 Ga0496121_0047034 Ga0496121_0047034_1316_1918 200
121 3300048924 Ga0496121_0065706 Ga0496121_0065706_952_1554 200
122 3300048926 Ga0496123_0090611 Ga0496123_0090611_992_1594 200
123 3300048927 Ga0496124_0104494 Ga0496124_0104494_1332_1934 200
124 3300048928 Ga0496125_0020118 Ga0496125_0020118_1462_2064 200
125 3300048928 Ga0496125_0021613 Ga0496125_0021613_4657_5259 200
126 3300048928 Ga0496125_0197146 Ga0496125_0197146_257_859 200
127 3300048929 Ga0496126_0385023 Ga0496126_0385023_169_771 200
128 3300050496 nmdc:mga07m45_333909_c1 nmdc:mga07m45_333909_c1_80_682 200
129 3300053108 Ga0500562_020397 Ga0500562_020397_326_928 200
130 3300053118 Ga0500594_0000546 Ga0500594_0000546_4719_5321 200
131 3300053119 Ga0500595_072020 Ga0500595_072020_109_711 200
132 3300053128 Ga0500626_019091 Ga0500626_019091_2019_2621 200
133 3300053134 Ga0500658_0000181 Ga0500658_0000181_7279_7881 200
134 3300053136 Ga0500559_0005262 Ga0500559_0005262_3614_4216 200
135 3300053139 Ga0500568_0001205 Ga0500568_0001205_6224_6826 200
136 3300053153 Ga0500616_0054617 Ga0500616_0054617_1479_2081 200
137 3300061719 Ga0466962_0341801 Ga0466962_0341801_21_623 200
138 3300005331 Ga0070670_100142829 Ga0070670_1001428292 201
139 3300005331 Ga0070670_100321632 Ga0070670_1003216322 201
140 3300005333 Ga0070677_10049359 Ga0070677_100493592 201
141 3300005338 Ga0068868_100229875 Ga0068868_1002298752 201
142 3300005353 Ga0070669_100754615 Ga0070669_1007546152 201
143 3300005354 Ga0070675_100014052 Ga0070675_1000140524 201
144 3300005356 Ga0070674_100404307 Ga0070674_1004043072 201
145 3300005364 Ga0070673_100048712 Ga0070673_1000487123 201
146 3300005367 Ga0070667_100690839 Ga0070667_1006908391 201
147 3300005367 Ga0070667_101014103 Ga0070667_1010141031 201
148 3300005456 Ga0070678_100114768 Ga0070678_1001147682 201
149 3300005456 Ga0070678_100503613 Ga0070678_1005036132 201
150 3300005459 Ga0068867_100016048 Ga0068867_1000160482 201
151 3300005530 Ga0070679_100926134 Ga0070679_1009261341 201
152 3300005543 Ga0070672_100141413 Ga0070672_1001414132 201
153 3300005543 Ga0070672_100148279 Ga0070672_1001482792 201
154 3300005543 Ga0070672_100337055 Ga0070672_1003370552 201
155 3300005548 Ga0070665_100277525 Ga0070665_1002775252 201
156 3300005548 Ga0070665_101335610 Ga0070665_1013356101 201
157 3300005618 Ga0068864_100192646 Ga0068864_1001926462 201
158 3300005719 Ga0068861_100392287 Ga0068861_1003922872 201
159 3300005834 Ga0068851_10096863 Ga0068851_100968632 201
160 3300005840 Ga0068870_10405884 Ga0068870_104058842 201
161 3300005842 Ga0068858_100735837 Ga0068858_1007358372 201
162 3300006358 Ga0068871_100214007 Ga0068871_1002140072 201
163 3300009148 Ga0105243_10351527 Ga0105243_103515272 201
164 3300009177 Ga0105248_10447890 Ga0105248_104478902 201
165 3300009177 Ga0105248_10487239 Ga0105248_104872391 201
166 3300013306 Ga0163162_10622449 Ga0163162_106224492 201
167 3300013308 Ga0157375_10724102 Ga0157375_107241022 201
168 3300014325 Ga0163163_10168352 Ga0163163_101683523 201
169 3300017792 Ga0163161_10645024 Ga0163161_106450242 201
170 3300025321 Ga0207656_10186816 Ga0207656_101868162 201
171 3300025893 Ga0207682_10259588 Ga0207682_102595882 201
172 3300025908 Ga0207643_10435915 Ga0207643_104359151 201
173 3300025923 Ga0207681_10124952 Ga0207681_101249523 201
174 3300025925 Ga0207650_10103381 Ga0207650_101033812 201
175 3300025925 Ga0207650_10544686 Ga0207650_105446862 201
176 3300025926 Ga0207659_10049589 Ga0207659_100495893 201
177 3300025926 Ga0207659_10768091 Ga0207659_107680912 201
178 3300025936 Ga0207670_10231380 Ga0207670_102313803 201
179 3300025940 Ga0207691_10291545 Ga0207691_102915452 201
180 3300025940 Ga0207691_10337359 Ga0207691_103373592 201
181 3300025940 Ga0207691_10409222 Ga0207691_104092222 201
182 3300025941 Ga0207711_10119472 Ga0207711_101194722 201
183 3300025960 Ga0207651_10080554 Ga0207651_100805542 201
184 3300025986 Ga0207658_10608270 Ga0207658_106082702 201
185 3300026067 Ga0207678_10018792 Ga0207678_100187924 201
186 3300026089 Ga0207648_10256908 Ga0207648_102569082 201
187 3300026118 Ga0207675_100367371 Ga0207675_1003673712 201
188 3300026118 Ga0207675_101004731 Ga0207675_1010047312 201
189 3300026121 Ga0207683_10009877 Ga0207683_100098773 201
190 3300026142 Ga0207698_10333209 Ga0207698_103332092 201
191 3300028381 Ga0268264_10248689 Ga0268264_102486892 201
192 3300031901 Ga0307406_10168754 Ga0307406_101687542 201
193 3300046459 Ga0495629_0087035 Ga0495629_0087035_1445_2050 201
194 3300046537 Ga0495598_0036821 Ga0495598_0036821_324_929 201
195 3300046539 Ga0495621_0157365 Ga0495621_0157365_258_863 201
196 3300046664 Ga0495659_0163471 Ga0495659_0163471_222_827 201
197 3300046681 Ga0495647_0111628 Ga0495647_0111628_472_1077 201
198 3300048913 Ga0496110_0355891 Ga0496110_0355891_297_902 201
199 iso_pu_bacteria 2511231021 2511358196 201
200 iso_pu_bacteria 2513237166 2514048953 201
201 iso_pu_bacteria 2562617112 2563056127 201
202 iso_pu_bacteria 2711768613 2713481765 201
203 iso_pu_bacteria 2881927736 2881929831 201
204 iso_pu_bacteria 2921643360 2921648509 201
205 iso_pu_bacteria 642555112 642597289 201
206 3300028786 Ga0307517_10328931 Ga0307517_103289311 202
207 3300031456 Ga0307513_10034617 Ga0307513_100346174 202
208 3300053093 Ga0500651_0000015 Ga0500651_0000015_83258_83872 202
209 3300053110 Ga0500571_000008 Ga0500571_000008_11544_12158 202
210 3300053122 Ga0500608_017802 Ga0500608_017802_2176_2790 202
211 3300053134 Ga0500658_0000085 Ga0500658_0000085_33331_33945 202
212 3300053138 Ga0500564_096322 Ga0500564_096322_527_1141 202
213 3300053162 Ga0500638_021914 Ga0500638_021914_2189_2803 202
214 3300053177 Ga0500636_0058013 Ga0500636_0058013_1515_2129 202
215 iso_pu_bacteria 2744054900 2746087009 202
216 iso_pu_bacteria 2744054901 2746094644 202
217 iso_pu_bacteria 2818991436 2819541865 202
218 3300009553 Ga0105249_10583566 Ga0105249_105835662 203
219 3300036401 Ga0373937_0005598 Ga0373937_0005598_2764_3375 203
220 3300046459 Ga0495629_0033043 Ga0495629_0033043_1680_2291 203
221 3300046477 Ga0495664_0093210 Ga0495664_0093210_885_1496 203
222 3300046533 Ga0495640_0297267 Ga0495640_0297267_370_981 203
223 3300046535 Ga0495586_0190336 Ga0495586_0190336_308_919 203
224 3300046681 Ga0495647_0009009 Ga0495647_0009009_549_1160 203
225 3300046809 Ga0495600_0053303 Ga0495600_0053303_1122_1733 203
226 3300047319 Ga0495674_0253238 Ga0495674_0253238_632_1243 203
227 3300047471 Ga0495684_0143161 Ga0495684_0143161_1057_1668 203
228 3300053085 Ga0495619_0012812 Ga0495619_0012812_4334_4945 203
229 3300046471 Ga0495650_0003786 Ga0495650_0003786_2695_3309 204
230 3300046684 Ga0495669_0006915 Ga0495669_0006915_891_1505 204
231 3300047444 Ga0495675_0012629 Ga0495675_0012629_3859_4494 204
232 3300047673 Ga0495593_0016002 Ga0495593_0016002_216_830 204
233 3300003320 rootH2_10045261 rootH2_100452612 205
234 3300003323 rootH1_10213411 rootH1_102134112 205
235 3300003354 JGI25160J50197_1000017 JGI25160J50197_100001732 205
236 3300003792 Ga0055540_1007437 Ga0055540_10074374 205
237 3300005262 Ga0065165_1000751 Ga0065165_100075139 205
238 3300005435 Ga0070714_100754119 Ga0070714_1007541192 205
239 3300006177 Ga0075362_10024425 Ga0075362_100244252 205
240 3300009177 Ga0105248_10816333 Ga0105248_108163332 205
241 3300025284 Ga0209130_1012205 Ga0209130_10122052 205
242 3300025295 Ga0209564_1002666 Ga0209564_100266611 205
243 3300025302 Ga0207426_1000107 Ga0207426_1000107146 205
244 3300030522 Ga0307512_10042244 Ga0307512_100422444 205
245 3300031838 Ga0307518_10189148 Ga0307518_101891482 205
246 3300033180 Ga0307510_10016593 Ga0307510_100165936 205
247 3300046455 Ga0495603_0000235 Ga0495603_0000235_15392_16009 205
248 3300046455 Ga0495603_0057006 Ga0495603_0057006_1652_2269 205
249 3300046457 Ga0495590_0072828 Ga0495590_0072828_60_713 205
250 3300046459 Ga0495629_0000633 Ga0495629_0000633_14122_14739 205
251 3300046463 Ga0495653_0191636 Ga0495653_0191636_398_1015 205
252 3300046471 Ga0495650_0000651 Ga0495650_0000651_38728_39345 205
253 3300046472 Ga0495580_0019785 Ga0495580_0019785_2515_3132 205
254 3300046472 Ga0495580_0065019 Ga0495580_0065019_313_930 205
255 3300046499 Ga0495594_0058107 Ga0495594_0058107_1317_1934 205
256 3300046500 Ga0495596_0005559 Ga0495596_0005559_737_1354 205
257 3300046506 Ga0495583_0019161 Ga0495583_0019161_2927_3544 205
258 3300046506 Ga0495583_0023667 Ga0495583_0023667_665_1282 205
259 3300046507 Ga0495606_0373453 Ga0495606_0373453_52_729 205
260 3300046513 Ga0495616_0013337 Ga0495616_0013337_3178_3795 205
261 3300046528 Ga0495642_0009342 Ga0495642_0009342_2691_3308 205
262 3300046535 Ga0495586_0035739 Ga0495586_0035739_628_1245 205
263 3300046542 Ga0495597_0145359 Ga0495597_0145359_303_920 205
264 3300046543 Ga0495645_0000163 Ga0495645_0000163_11376_11993 205
265 3300046557 Ga0495622_0019374 Ga0495622_0019374_1184_1801 205
266 3300046559 Ga0495667_0181574 Ga0495667_0181574_139_756 205
267 3300046680 Ga0495646_0116317 Ga0495646_0116317_788_1405 205
268 3300046689 Ga0495613_0122088 Ga0495613_0122088_547_1164 205
269 3300046691 Ga0495670_0215514 Ga0495670_0215514_106_723 205
270 3300046692 Ga0495671_0059598 Ga0495671_0059598_1070_1687 205
271 3300046694 Ga0495649_0330037 Ga0495649_0330037_144_761 205
272 3300046794 Ga0495589_0021945 Ga0495589_0021945_2235_2852 205
273 3300046794 Ga0495589_0028225 Ga0495589_0028225_350_967 205
274 3300046809 Ga0495600_0076603 Ga0495600_0076603_77_694 205
275 3300046810 Ga0495660_0061486 Ga0495660_0061486_297_914 205
276 3300047315 Ga0495581_0001220 Ga0495581_0001220_7059_7676 205
277 3300047319 Ga0495674_0017418 Ga0495674_0017418_2360_2977 205
278 3300047320 Ga0495672_0047941 Ga0495672_0047941_1321_1938 205
279 3300047322 Ga0495680_0303012 Ga0495680_0303012_46_663 205
280 3300047323 Ga0495683_0048316 Ga0495683_0048316_1239_1856 205
281 3300047443 Ga0495687_029431 Ga0495687_029431_1184_1801 205
282 3300047444 Ga0495675_0405225 Ga0495675_0405225_111_728 205
283 3300047470 Ga0495681_0002250 Ga0495681_0002250_5685_6302 205
284 3300047470 Ga0495681_0021620 Ga0495681_0021620_744_1361 205
285 3300047470 Ga0495681_0198394 Ga0495681_0198394_143_760 205
286 3300047673 Ga0495593_0058739 Ga0495593_0058739_1224_1841 205
287 3300048089 Ga0495614_0146361 Ga0495614_0146361_300_917 205
288 3300048091 Ga0495626_0059983 Ga0495626_0059983_728_1345 205
289 3300048903 Ga0496100_0011109 Ga0496100_0011109_4148_4798 205
290 3300048903 Ga0496100_0077942 Ga0496100_0077942_398_1015 205
291 3300048904 Ga0496101_0003291 Ga0496101_0003291_4801_5451 205
292 3300048904 Ga0496101_0008532 Ga0496101_0008532_1022_1639 205
293 3300048904 Ga0496101_0014257 Ga0496101_0014257_967_1584 205
294 3300048905 Ga0496102_0000581 Ga0496102_0000581_4750_5400 205
295 3300048906 Ga0496103_0003617 Ga0496103_0003617_8042_8692 205
296 3300048907 Ga0496104_0069286 Ga0496104_0069286_724_1341 205
297 3300048907 Ga0496104_0243251 Ga0496104_0243251_828_1478 205
298 3300048908 Ga0496105_0094036 Ga0496105_0094036_880_1497 205
299 3300048915 Ga0496112_0027209 Ga0496112_0027209_2115_2732 205
300 3300048916 Ga0496113_0000967 Ga0496113_0000967_14009_14626 205
301 3300048917 Ga0496114_0001484 Ga0496114_0001484_14487_15104 205
302 3300048919 Ga0496116_0033053 Ga0496116_0033053_1421_2038 205
303 3300048919 Ga0496116_0270248 Ga0496116_0270248_148_798 205
304 3300048920 Ga0496117_0000240 Ga0496117_0000240_98612_99262 205
305 3300048920 Ga0496117_0265891 Ga0496117_0265891_154_771 205
306 3300048921 Ga0496118_0000200 Ga0496118_0000200_99874_100524 205
307 3300048921 Ga0496118_0034003 Ga0496118_0034003_1202_1819 205
308 3300048922 Ga0496119_0034929 Ga0496119_0034929_1910_2560 205
309 3300048922 Ga0496119_0080681 Ga0496119_0080681_318_935 205
310 3300048922 Ga0496119_0194843 Ga0496119_0194843_107_757 205
311 3300048923 Ga0496120_0085690 Ga0496120_0085690_1047_1664 205
312 3300048924 Ga0496121_0001345 Ga0496121_0001345_3225_3875 205
313 3300048924 Ga0496121_0007183 Ga0496121_0007183_4246_4863 205
314 3300048924 Ga0496121_0047165 Ga0496121_0047165_1311_1928 205
315 3300048926 Ga0496123_0159769 Ga0496123_0159769_556_1173 205
316 3300048929 Ga0496126_0137204 Ga0496126_0137204_208_858 205
317 3300053108 Ga0500562_004939 Ga0500562_004939_760_1377 205
318 3300053125 Ga0500618_000449 Ga0500618_000449_6016_6633 205
319 3300002076 JGI24749J21850_1001710 JGI24749J21850_10017103 206
320 3300002737 JGI25162J39368_1000061 JGI25162J39368_100006163 206
321 3300003214 JGI25165J46597_1000117 JGI25165J46597_100011756 206
322 3300003751 Ga0055538_1000046 Ga0055538_100004656 206
323 3300003752 Ga0055539_1000065 Ga0055539_100006563 206
324 3300003756 Ga0055533_1000075 Ga0055533_100007556 206
325 3300003759 Ga0055525_1000095 Ga0055525_100009556 206
326 3300003841 Ga0055541_1000047 Ga0055541_100004763 206
327 3300005290 Ga0065712_10147450 Ga0065712_101474502 206
328 3300005293 Ga0065715_10108754 Ga0065715_101087543 206
329 3300005328 Ga0070676_10075705 Ga0070676_100757054 206
330 3300005331 Ga0070670_100000493 Ga0070670_1000004931 206
331 3300005333 Ga0070677_10001833 Ga0070677_100018335 206
332 3300005334 Ga0068869_100024027 Ga0068869_1000240273 206
333 3300005335 Ga0070666_10223309 Ga0070666_102233091 206
334 3300005340 Ga0070689_101031122 Ga0070689_1010311221 206
335 3300005353 Ga0070669_100059410 Ga0070669_1000594105 206
336 3300005354 Ga0070675_100102937 Ga0070675_1001029373 206
337 3300005355 Ga0070671_100021008 Ga0070671_1000210086 206
338 3300005356 Ga0070674_100009516 Ga0070674_1000095169 206
339 3300005356 Ga0070674_100255572 Ga0070674_1002555722 206
340 3300005364 Ga0070673_100007985 Ga0070673_1000079854 206
341 3300005364 Ga0070673_100873255 Ga0070673_1008732552 206
342 3300005364 Ga0070673_101026229 Ga0070673_1010262291 206
343 3300005367 Ga0070667_100315820 Ga0070667_1003158201 206
344 3300005444 Ga0070694_100382142 Ga0070694_1003821422 206
345 3300005456 Ga0070678_100015581 Ga0070678_1000155814 206
346 3300005456 Ga0070678_100033258 Ga0070678_1000332583 206
347 3300005459 Ga0068867_100178545 Ga0068867_1001785452 206
348 3300005543 Ga0070672_100000362 Ga0070672_1000003626 206
349 3300005544 Ga0070686_100032652 Ga0070686_1000326523 206
350 3300005564 Ga0070664_100044545 Ga0070664_1000445456 206
351 3300005616 Ga0068852_100114626 Ga0068852_1001146263 206
352 3300005617 Ga0068859_100190255 Ga0068859_1001902552 206
353 3300005617 Ga0068859_100335631 Ga0068859_1003356313 206
354 3300005719 Ga0068861_100084798 Ga0068861_1000847983 206
355 3300005834 Ga0068851_10016377 Ga0068851_100163774 206
356 3300005842 Ga0068858_100133125 Ga0068858_1001331252 206
357 3300005842 Ga0068858_100646948 Ga0068858_1006469482 206
358 3300005843 Ga0068860_100289757 Ga0068860_1002897572 206
359 3300005844 Ga0068862_100930181 Ga0068862_1009301811 206
360 3300006237 Ga0097621_100013175 Ga0097621_1000131755 206
361 3300006237 Ga0097621_100044748 Ga0097621_1000447486 206
362 3300006237 Ga0097621_100045880 Ga0097621_1000458804 206
363 3300006358 Ga0068871_100022642 Ga0068871_1000226426 206
364 3300006358 Ga0068871_100035022 Ga0068871_1000350225 206
365 3300006844 Ga0075428_100068927 Ga0075428_1000689274 206
366 3300006881 Ga0068865_100020538 Ga0068865_1000205384 206
367 3300006931 Ga0097620_100190249 Ga0097620_1001902492 206
368 3300006931 Ga0097620_100335637 Ga0097620_1003356373 206
369 3300009094 Ga0111539_10001800 Ga0111539_1000180032 206
370 3300009098 Ga0105245_10128715 Ga0105245_101287154 206
371 3300009176 Ga0105242_10018466 Ga0105242_100184666 206
372 3300009177 Ga0105248_10003616 Ga0105248_100036163 206
373 3300009177 Ga0105248_11000032 Ga0105248_110000322 206
374 3300009553 Ga0105249_10040354 Ga0105249_100403542 206
375 3300013296 Ga0157374_10025829 Ga0157374_100258296 206
376 3300013297 Ga0157378_10016883 Ga0157378_100168832 206
377 3300013297 Ga0157378_10577001 Ga0157378_105770012 206
378 3300013306 Ga0163162_10004865 Ga0163162_1000486510 206
379 3300013308 Ga0157375_10033265 Ga0157375_100332651 206
380 3300013308 Ga0157375_10552440 Ga0157375_105524402 206
381 3300014968 Ga0157379_10009921 Ga0157379_100099213 206
382 3300014969 Ga0157376_10227586 Ga0157376_102275861 206
383 3300015261 Ga0182006_1003729 Ga0182006_10037298 206
384 3300015262 Ga0182007_10003350 Ga0182007_100033504 206
385 3300015265 Ga0182005_1000242 Ga0182005_100024216 206
386 3300017792 Ga0163161_10040074 Ga0163161_100400743 206
387 3300025207 Ga0209760_101685 Ga0209760_1016853 206
388 3300025224 Ga0209784_100010 Ga0209784_100010231 206
389 3300025225 Ga0209566_100008 Ga0209566_100008231 206
390 3300025226 Ga0209674_100019 Ga0209674_100019231 206
391 3300025230 Ga0209563_100021 Ga0209563_100021231 206
392 3300025231 Ga0207427_100509 Ga0207427_10050921 206
393 3300025233 Ga0209437_100019 Ga0209437_100019231 206
394 3300025253 Ga0209677_100011 Ga0209677_100011231 206
395 3300025261 Ga0209233_1000025 Ga0209233_1000025231 206
396 3300025315 Ga0207697_10001628 Ga0207697_100016285 206
397 3300025321 Ga0207656_10116907 Ga0207656_101169071 206
398 3300025893 Ga0207682_10001005 Ga0207682_1000100521 206
399 3300025907 Ga0207645_10071699 Ga0207645_100716991 206
400 3300025923 Ga0207681_10000675 Ga0207681_1000067540 206
401 3300025923 Ga0207681_10685502 Ga0207681_106855021 206
402 3300025925 Ga0207650_10000548 Ga0207650_1000054856 206
403 3300025926 Ga0207659_10011110 Ga0207659_100111105 206
404 3300025926 Ga0207659_10312462 Ga0207659_103124621 206
405 3300025931 Ga0207644_10032418 Ga0207644_100324187 206
406 3300025938 Ga0207704_10020150 Ga0207704_100201504 206
407 3300025938 Ga0207704_10249667 Ga0207704_102496672 206
408 3300025940 Ga0207691_10000390 Ga0207691_100003905 206
409 3300025940 Ga0207691_10393666 Ga0207691_103936661 206
410 3300025941 Ga0207711_10153170 Ga0207711_101531703 206
411 3300025942 Ga0207689_10028480 Ga0207689_100284803 206
412 3300025945 Ga0207679_10032365 Ga0207679_100323657 206
413 3300025960 Ga0207651_10008110 Ga0207651_100081105 206
414 3300025961 Ga0207712_10562518 Ga0207712_105625182 206
415 3300025986 Ga0207658_10020314 Ga0207658_100203146 206
416 3300026035 Ga0207703_10350608 Ga0207703_103506082 206
417 3300026089 Ga0207648_10005035 Ga0207648_1000503521 206
418 3300026089 Ga0207648_10192458 Ga0207648_101924583 206
419 3300026095 Ga0207676_10050736 Ga0207676_100507367 206
420 3300026118 Ga0207675_100019350 Ga0207675_1000193501 206
421 3300026118 Ga0207675_100413521 Ga0207675_1004135211 206
422 3300026121 Ga0207683_10004118 Ga0207683_1000411813 206
423 3300026121 Ga0207683_10004593 Ga0207683_100045935 206
424 3300026142 Ga0207698_10613561 Ga0207698_106135612 206
425 3300027907 Ga0207428_10073119 Ga0207428_100731193 206
426 3300028380 Ga0268265_10232590 Ga0268265_102325901 206
427 3300028381 Ga0268264_10363643 Ga0268264_103636432 206
428 3300031251 Ga0265327_10000512 Ga0265327_100005129 206
429 3300041486 Ga0451807_1598963 Ga0451807_1598963_546_1178 206
430 3300042002 Ga0439442_001613 Ga0439442_001613_3224_3853 206
431 3300046454 Ga0495592_0016873 Ga0495592_0016873_531_1154 206
432 3300046462 Ga0495651_0085410 Ga0495651_0085410_1456_2079 206
433 3300046463 Ga0495653_0070382 Ga0495653_0070382_530_1153 206
434 3300046511 Ga0495608_0035037 Ga0495608_0035037_1525_2148 206
435 3300046514 Ga0495618_0090854 Ga0495618_0090854_41_664 206
436 3300046516 Ga0495628_0003529 Ga0495628_0003529_11930_12553 206
437 3300046663 Ga0495635_0102016 Ga0495635_0102016_355_978 206
438 3300046678 Ga0495599_0000818 Ga0495599_0000818_10885_11508 206
439 3300046680 Ga0495646_0047241 Ga0495646_0047241_833_1456 206
440 3300046690 Ga0495624_0043766 Ga0495624_0043766_984_1607 206
441 3300046809 Ga0495600_0012713 Ga0495600_0012713_3624_4247 206
442 3300047317 Ga0495604_0003482 Ga0495604_0003482_11667_12290 206
443 3300048088 Ga0495602_0046714 Ga0495602_0046714_2288_2911 206
444 3300049521 Ga0501298_043903 Ga0501298_043903_279_899 206
445 3300050511 nmdc:mga08y16_247588_c1 nmdc:mga08y16_247588_c1_890_1513 206
446 3300053077 Ga0495601_0052118 Ga0495601_0052118_338_961 206
447 3300053119 Ga0500595_005311 Ga0500595_005311_4991_5614 206
448 3300053154 Ga0500619_001788 Ga0500619_001788_1236_1859 206

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bhn-assembly1.cif.gz_A-2 crystal structure of a dj-1/pfpi-like protein (shew_2856) from shewanella loihica pv-4 at 1.76 a resolution 0.9219 2 197
3bhn-assembly1.cif.gz_A-2 crystal structure of a dj-1/pfpi-like protein (shew_2856) from shewanella loihica pv-4 at 1.76 a resolution 0.8753 2 197
3mgk-assembly1.cif.gz_A crystal structure of probable protease/amidase from clostridium acetobutylicum atcc 824 0.8428 2 177
4y1f-assembly1.cif.gz_B sav1875-e17d 0.826 1 161
1j42-assembly1.cif.gz_A crystal structure of human dj-1 0.8225 2 173
ID Description Score Start End Superfamily
3bhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8952 1 197 3.40.50.880
af_I6Y6S3_1_186_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8859 34 180 3.40.50.880
3bhnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8463 1 197 3.40.50.880
3mgkA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8428 2 177 3.40.50.880
af_A0A0R0L321_118_307_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8397 2 177 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2D9SZN8-F1-model_v4 AraC family transcriptional regulator 0.9933 1 108
AF-A0A212BV40-F1-model_v4 AraC family transcriptional regulator 0.9892 1 198 GO:0006355
AF-T0HA96-F1-model_v4 DJ-1/PfpI domain-containing protein 0.9887 1 204 GO:0006355
AF-A0A562PYI2-F1-model_v4 DJ-1/PfpI family protein 0.9881 1 199 GO:0006355
AF-A0A3A1P305-F1-model_v4 AraC family transcriptional regulator 0.9863 1 197 GO:0006355

Feature Viewer

pLDDT pTM Quality
93.3 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map