F446082

General Info

Members Datasets Scaffolds Average Seq Length
448 206 896 159

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10047046|Ga0070658_100470463
Length 184
Sequence MQQASLRCMAKMTVNGEPVEYRLDPQTPLLWALRDASNLTGTKYGCDSHDCGACTVIVDGRAVISCNQPLASLEGARVTTIEGLSADGSHPVQQAWVAEQVTMCGYCEPGFIMAIAALLEAGSFPAEEAIAALPNICRCGAYPRIRKAIARASAAMTNVTSQHERTAQMQFSRTSSAESQNTPR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
157 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
158 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
161 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
162 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
163 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
164 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
178 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
190 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
191 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
194 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
195 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
198 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 2.01
Rhizosphere 97.1
Stem 0
Stem Tuber 0
Unclassified 2.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10047046 3300005327 Bacteria 3491
2 JGI24737J22298_10117944 3300001990 Bacteria 784
3 Ga0065715_10019864 3300005293 Bacteria 3077
4 Ga0070658_10010025 3300005327 Bacteria 7609
5 Ga0070658_10056263 3300005327 Bacteria 3196
6 Ga0070658_10080294 3300005327 Bacteria 2679
7 Ga0070658_10093550 3300005327 Bacteria 2480
8 Ga0070658_10182854 3300005327 Bacteria 1764
9 Ga0070658_10354935 3300005327 Unclassified 1255
10 Ga0070658_10706096 3300005327 Bacteria 875
11 Ga0070683_100011488 3300005329 Bacteria 7659
12 Ga0070690_100928819 3300005330 Bacteria 682
13 Ga0070670_100001339 3300005331 Bacteria 19696
14 Ga0070677_10025246 3300005333 Bacteria 2217
15 Ga0068869_100176260 3300005334 Bacteria 1673
16 Ga0070666_10877724 3300005335 Bacteria 662
17 Ga0070680_100000777 3300005336 Bacteria 22371
18 Ga0070680_100012680 3300005336 Bacteria 6552
19 Ga0068868_100046368 3300005338 Bacteria 3402
20 Ga0068868_100450485 3300005338 Bacteria 1119
21 Ga0070660_100015053 3300005339 Bacteria 5580
22 Ga0070660_100080442 3300005339 Bacteria 2557
23 Ga0070660_100095951 3300005339 Bacteria 2344
24 Ga0070660_100741516 3300005339 Bacteria 824
25 Ga0070660_100763006 3300005339 Bacteria 812
26 Ga0070689_100235226 3300005340 Bacteria 1507
27 Ga0070691_10177218 3300005341 Bacteria 1108
28 Ga0070661_100114578 3300005344 Bacteria 2015
29 Ga0070661_100138205 3300005344 Bacteria 1834
30 Ga0070661_100170815 3300005344 Bacteria 1651
31 Ga0070692_10014271 3300005345 Bacteria 3727
32 Ga0070692_10357796 3300005345 Bacteria 909
33 Ga0070668_100059146 3300005347 Bacteria 2966
34 Ga0070669_100018693 3300005353 Bacteria 4953
35 Ga0070669_100059126 3300005353 Bacteria 2814
36 Ga0070675_100158679 3300005354 Bacteria 1944
37 Ga0070671_100007095 3300005355 Bacteria 8966
38 Ga0070671_100029423 3300005355 Bacteria 4529
39 Ga0070671_100072116 3300005355 Bacteria 2883
40 Ga0070671_100263000 3300005355 Bacteria 1466
41 Ga0070671_100341184 3300005355 Bacteria 1278
42 Ga0070673_100022671 3300005364 Bacteria 4574
43 Ga0070673_100135670 3300005364 Bacteria 2071
44 Ga0070659_100098059 3300005366 Bacteria 2356
45 Ga0070659_100179934 3300005366 Bacteria 1735
46 Ga0070659_100334270 3300005366 Bacteria 1268
47 Ga0070667_100010588 3300005367 Bacteria 7614
48 Ga0070667_100030202 3300005367 Bacteria 4519
49 Ga0070667_100089016 3300005367 Bacteria 2651
50 Ga0070667_100668855 3300005367 Bacteria 959
51 Ga0070714_100025570 3300005435 Bacteria 4873
52 Ga0070678_100037230 3300005456 Bacteria 3414
53 Ga0070662_100032478 3300005457 Bacteria 3669
54 Ga0070662_100050917 3300005457 Bacteria 2988
55 Ga0070662_100082648 3300005457 Bacteria 2395
56 Ga0070681_10552245 3300005458 Bacteria 1066
57 Ga0070679_100094110 3300005530 Bacteria 2983
58 Ga0070679_100223611 3300005530 Bacteria 1843
59 Ga0070679_100469255 3300005530 Bacteria 1203
60 Ga0070679_100888122 3300005530 Bacteria 835
61 Ga0070684_100007096 3300005535 Bacteria 8707
62 Ga0068853_100084407 3300005539 Bacteria 2782
63 Ga0070672_100020170 3300005543 Bacteria 4857
64 Ga0070672_100050371 3300005543 Bacteria 3242
65 Ga0070672_101491872 3300005543 Bacteria 606
66 Ga0070695_100050447 3300005545 Bacteria 2666
67 Ga0070696_100227015 3300005546 Bacteria 1403
68 Ga0070696_100273561 3300005546 Bacteria 1285
69 Ga0070693_100297996 3300005547 Bacteria 1086
70 Ga0070665_100218787 3300005548 Bacteria 1905
71 Ga0068855_100131347 3300005563 Bacteria 2860
72 Ga0068855_100136295 3300005563 Bacteria 2801
73 Ga0068855_100178110 3300005563 Bacteria 2404
74 Ga0068855_100479663 3300005563 Bacteria 1354
75 Ga0068855_100753157 3300005563 Bacteria 1038
76 Ga0068855_101016183 3300005563 Bacteria 870
77 Ga0070664_100003131 3300005564 Bacteria 13371
78 Ga0070664_100010492 3300005564 Bacteria 7507
79 Ga0070664_100744482 3300005564 Bacteria 914
80 Ga0068857_100090433 3300005577 Unclassified 2739
81 Ga0068857_100133179 3300005577 Bacteria 2243
82 Ga0068857_100342384 3300005577 Bacteria 1383
83 Ga0068854_100095107 3300005578 Bacteria 2223
84 Ga0068854_100161892 3300005578 Bacteria 1734
85 Ga0068856_100071906 3300005614 Bacteria 3424
86 Ga0068856_100242279 3300005614 Bacteria 1818
87 Ga0068856_100260503 3300005614 Bacteria 1749
88 Ga0068856_100266003 3300005614 Bacteria 1730
89 Ga0068852_100034193 3300005616 Bacteria 4227
90 Ga0068852_100163915 3300005616 Bacteria 2078
91 Ga0068852_100233133 3300005616 Bacteria 1756
92 Ga0068852_100269296 3300005616 Bacteria 1638
93 Ga0068852_100565079 3300005616 Bacteria 1139
94 Ga0068859_100000117 3300005617 Bacteria 75377
95 Ga0068859_100015140 3300005617 Bacteria 7742
96 Ga0068859_100254785 3300005617 Bacteria 1846
97 Ga0068864_100000161 3300005618 Bacteria 62543
98 Ga0068864_100013248 3300005618 Bacteria 6829
99 Ga0068864_100087960 3300005618 Bacteria 2736
100 Ga0068866_10199017 3300005718 Bacteria 1196
101 Ga0068863_100008756 3300005841 Bacteria 9882
102 Ga0068863_100112049 3300005841 Bacteria 2598
103 Ga0068863_100312286 3300005841 Bacteria 1526
104 Ga0068858_100015848 3300005842 Bacteria 7084
105 Ga0068858_100017001 3300005842 Bacteria 6830
106 Ga0068858_100902471 3300005842 Bacteria 864
107 Ga0068860_100008520 3300005843 Bacteria 10216
108 Ga0068860_100272965 3300005843 Bacteria 1651
109 Ga0068860_100281308 3300005843 Bacteria 1626
110 Ga0068860_100505032 3300005843 Bacteria 1207
111 Ga0068860_100537756 3300005843 Bacteria 1170
112 Ga0068862_100034380 3300005844 Bacteria 4288
113 Ga0068862_100075340 3300005844 Bacteria 2919
114 Ga0068862_100532544 3300005844 Bacteria 1119
115 Ga0068862_100613992 3300005844 Bacteria 1045
116 Ga0081540_1132389 3300005983 Bacteria 1016
117 Ga0070717_10010483 3300006028 Bacteria 7001
118 Ga0070716_100520732 3300006173 Bacteria 881
119 Ga0068871_100902615 3300006358 Bacteria 819
120 Ga0075428_101041425 3300006844 Bacteria 865
121 Ga0075431_100256903 3300006847 Unclassified 1774
122 Ga0075433_10021050 3300006852 Bacteria 5463
123 Ga0075434_100215807 3300006871 Bacteria 1938
124 Ga0068865_100276860 3300006881 Bacteria 1334
125 Ga0097620_100000117 3300006931 Bacteria 75377
126 Ga0097620_100015140 3300006931 Bacteria 7742
127 Ga0097620_100254789 3300006931 Bacteria 1846
128 Ga0105251_10146325 3300009011 Bacteria 1068
129 Ga0105240_10007132 3300009093 Bacteria 16278
130 Ga0105240_10405120 3300009093 Bacteria 1535
131 Ga0111539_10148932 3300009094 Bacteria 2740
132 Ga0105245_10033427 3300009098 Bacteria 4558
133 Ga0105243_10026249 3300009148 Bacteria 4458
134 Ga0105241_10853038 3300009174 Bacteria 843
135 Ga0105241_11342654 3300009174 Bacteria 682
136 Ga0105242_10158495 3300009176 Bacteria 1979
137 Ga0105248_10006996 3300009177 Bacteria 12357
138 Ga0105248_10084268 3300009177 Bacteria 3575
139 Ga0105248_10286033 3300009177 Bacteria 1856
140 Ga0105248_10324764 3300009177 Bacteria 1733
141 Ga0105248_10925600 3300009177 Bacteria 984
142 Ga0105238_10210170 3300009551 Bacteria 1922
143 Ga0105249_10333496 3300009553 Bacteria 1531
144 Ga0105249_12044919 3300009553 Bacteria 646
145 Ga0105239_12059468 3300010375 Bacteria 663
146 Ga0157373_10039432 3300013100 Bacteria 3382
147 Ga0157373_10050369 3300013100 Bacteria 2966
148 Ga0157373_10129453 3300013100 Bacteria 1775
149 Ga0157373_10317032 3300013100 Bacteria 1109
150 Ga0157371_10012397 3300013102 Bacteria 6518
151 Ga0157371_10122150 3300013102 Bacteria 1852
152 Ga0157371_10502582 3300013102 Bacteria 895
153 Ga0157370_10034997 3300013104 Bacteria 4887
154 Ga0157370_10282667 3300013104 Bacteria 1533
155 Ga0157370_11429897 3300013104 Bacteria 622
156 Ga0157369_10008565 3300013105 Bacteria 11731
157 Ga0157369_10081273 3300013105 Bacteria 3468
158 Ga0157369_10152397 3300013105 Bacteria 2443
159 Ga0157369_10576649 3300013105 Bacteria 1162
160 Ga0157374_10494116 3300013296 Bacteria 1228
161 Ga0157374_11344939 3300013296 Bacteria 737
162 Ga0157378_10578314 3300013297 Unclassified 1132
163 Ga0163162_10054919 3300013306 Bacteria 4008
164 Ga0163162_11007726 3300013306 Bacteria 942
165 Ga0157372_10501234 3300013307 Bacteria 1416
166 Ga0157372_10551653 3300013307 Bacteria 1343
167 Ga0157372_11940859 3300013307 Bacteria 677
168 Ga0163163_10000259 3300014325 Bacteria 53596
169 Ga0182008_10084851 3300014497 Bacteria 1560
170 Ga0157379_10002538 3300014968 Bacteria 15307
171 Ga0157379_10861178 3300014968 Bacteria 858
172 Ga0157376_11586741 3300014969 Bacteria 688
173 Ga0197907_10132243 3300020069 Bacteria 677
174 Ga0206356_10198633 3300020070 Bacteria 1581
175 Ga0207697_10012624 3300025315 Bacteria 3537
176 Ga0207682_10028838 3300025893 Bacteria 2217
177 Ga0207688_10003884 3300025901 Bacteria 8151
178 Ga0207688_10031476 3300025901 Bacteria 2929
179 Ga0207680_10042241 3300025903 Bacteria 2666
180 Ga0207680_10173515 3300025903 Bacteria 1454
181 Ga0207647_10019058 3300025904 Bacteria 4621
182 Ga0207647_10024895 3300025904 Bacteria 3941
183 Ga0207645_10540116 3300025907 Bacteria 790
184 Ga0207643_10066614 3300025908 Bacteria 2066
185 Ga0207705_10014649 3300025909 Bacteria 5641
186 Ga0207705_10033121 3300025909 Bacteria 3693
187 Ga0207705_10077477 3300025909 Bacteria 2418
188 Ga0207705_10088966 3300025909 Bacteria 2259
189 Ga0207705_10393423 3300025909 Bacteria 1071
190 Ga0207705_10476909 3300025909 Bacteria 968
191 Ga0207705_10673404 3300025909 Bacteria 804
192 Ga0207654_10019248 3300025911 Bacteria 3600
193 Ga0207654_10131594 3300025911 Bacteria 1584
194 Ga0207707_10100551 3300025912 Bacteria 2527
195 Ga0207707_10623859 3300025912 Bacteria 911
196 Ga0207695_10412160 3300025913 Bacteria 1236
197 Ga0207660_10003839 3300025917 Bacteria 9796
198 Ga0207660_10116951 3300025917 Bacteria 2014
199 Ga0207660_10827262 3300025917 Bacteria 756
200 Ga0207657_10060715 3300025919 Bacteria 3244
201 Ga0207657_10068087 3300025919 Bacteria 3025
202 Ga0207649_10118866 3300025920 Bacteria 1779
203 Ga0207649_10395182 3300025920 Bacteria 1033
204 Ga0207652_10153601 3300025921 Bacteria 2062
205 Ga0207652_10206155 3300025921 Bacteria 1770
206 Ga0207652_10647528 3300025921 Bacteria 945
207 Ga0207681_10024824 3300025923 Bacteria 3849
208 Ga0207681_10153854 3300025923 Bacteria 1726
209 Ga0207694_10124046 3300025924 Bacteria 2064
210 Ga0207650_10025534 3300025925 Bacteria 4209
211 Ga0207650_10027925 3300025925 Bacteria 4042
212 Ga0207650_10662571 3300025925 Bacteria 880
213 Ga0207659_10719425 3300025926 Bacteria 855
214 Ga0207687_10040946 3300025927 Bacteria 3179
215 Ga0207687_10678657 3300025927 Bacteria 873
216 Ga0207700_10028101 3300025928 Bacteria 3948
217 Ga0207664_10017154 3300025929 Bacteria 5300
218 Ga0207644_10000346 3300025931 Bacteria 30047
219 Ga0207644_10099047 3300025931 Bacteria 2186
220 Ga0207690_10325028 3300025932 Bacteria 1210
221 Ga0207690_10826729 3300025932 Bacteria 766
222 Ga0207706_10071730 3300025933 Bacteria 3047
223 Ga0207686_10178705 3300025934 Bacteria 1503
224 Ga0207709_10182359 3300025935 Bacteria 1484
225 Ga0207670_10482489 3300025936 Bacteria 1004
226 Ga0207669_10043089 3300025937 Bacteria 2641
227 Ga0207665_10319117 3300025939 Bacteria 1165
228 Ga0207691_10009292 3300025940 Bacteria 9434
229 Ga0207691_10109213 3300025940 Bacteria 2461
230 Ga0207691_10177440 3300025940 Bacteria 1863
231 Ga0207711_10000039 3300025941 Bacteria 162974
232 Ga0207711_10050361 3300025941 Bacteria 3565
233 Ga0207711_10296602 3300025941 Bacteria 1490
234 Ga0207711_10649416 3300025941 Bacteria 984
235 Ga0207689_10006113 3300025942 Bacteria 10649
236 Ga0207661_10006104 3300025944 Bacteria 8511
237 Ga0207679_10155763 3300025945 Bacteria 1865
238 Ga0207679_10635650 3300025945 Bacteria 964
239 Ga0207667_10015036 3300025949 Bacteria 8804
240 Ga0207667_10042394 3300025949 Bacteria 4838
241 Ga0207667_10106294 3300025949 Bacteria 2895
242 Ga0207667_11264681 3300025949 Bacteria 715
243 Ga0207651_10138223 3300025960 Bacteria 1877
244 Ga0207712_10013703 3300025961 Bacteria 5198
245 Ga0207712_10751064 3300025961 Bacteria 855
246 Ga0207668_10287939 3300025972 Bacteria 1350
247 Ga0207640_10134264 3300025981 Bacteria 1794
248 Ga0207640_10268796 3300025981 Bacteria 1333
249 Ga0207640_10461384 3300025981 Bacteria 1049
250 Ga0207658_10000833 3300025986 Bacteria 25774
251 Ga0207658_10114071 3300025986 Bacteria 2142
252 Ga0207658_10132061 3300025986 Bacteria 2007
253 Ga0207677_10015950 3300026023 Bacteria 4435
254 Ga0207703_10001056 3300026035 Bacteria 26258
255 Ga0207703_10005442 3300026035 Bacteria 10250
256 Ga0207703_11257278 3300026035 Bacteria 712
257 Ga0207639_10750235 3300026041 Bacteria 907
258 Ga0207639_10809413 3300026041 Bacteria 873
259 Ga0207678_10013396 3300026067 Bacteria 7197
260 Ga0207678_10029051 3300026067 Bacteria 4826
261 Ga0207678_10035050 3300026067 Bacteria 4369
262 Ga0207678_10559618 3300026067 Bacteria 1001
263 Ga0207702_10009375 3300026078 Bacteria 8218
264 Ga0207702_10524926 3300026078 Bacteria 1156
265 Ga0207702_10716808 3300026078 Bacteria 986
266 Ga0207702_10738386 3300026078 Bacteria 971
267 Ga0207702_10810624 3300026078 Bacteria 925
268 Ga0207641_10000185 3300026088 Bacteria 86885
269 Ga0207641_10061784 3300026088 Bacteria 3195
270 Ga0207641_10277371 3300026088 Bacteria 1575
271 Ga0207676_10000531 3300026095 Bacteria 31982
272 Ga0207676_10078412 3300026095 Bacteria 2676
273 Ga0207676_10152087 3300026095 Bacteria 1994
274 Ga0207674_10075352 3300026116 Bacteria 3384
275 Ga0207674_10154859 3300026116 Unclassified 2247
276 Ga0207683_10036401 3300026121 Bacteria 4286
277 Ga0207683_10038334 3300026121 Bacteria 4176
278 Ga0207698_10009732 3300026142 Bacteria 6138
279 Ga0207698_10082879 3300026142 Bacteria 2594
280 Ga0207698_10140938 3300026142 Bacteria 2077
281 Ga0207698_10247771 3300026142 Bacteria 1628
282 Ga0207698_12338140 3300026142 Bacteria 546
283 Ga0268266_10405791 3300028379 Bacteria 1289
284 Ga0268265_10004573 3300028380 Bacteria 9568
285 Ga0268265_10048098 3300028380 Bacteria 3200
286 Ga0268265_10064283 3300028380 Bacteria 2826
287 Ga0268265_10966033 3300028380 Bacteria 840
288 Ga0268264_10006604 3300028381 Bacteria 9753
289 Ga0268264_10252216 3300028381 Bacteria 1640
290 Ga0268264_10278641 3300028381 Bacteria 1565
291 Ga0268264_11141296 3300028381 Bacteria 788
292 Ga0307513_10228686 3300031456 Bacteria 1674
293 Ga0307509_10812178 3300031507 Bacteria 600
294 Ga0307408_100075346 3300031548 Bacteria 2506
295 Ga0307410_10326882 3300031852 Bacteria 1218
296 Ga0307406_10099044 3300031901 Bacteria 1981
297 Ga0307407_10135202 3300031903 Bacteria 1583
298 Ga0307407_10311944 3300031903 Bacteria 1100
299 Ga0307407_10386065 3300031903 Bacteria 1001
300 Ga0307409_100055597 3300031995 Bacteria 3057
301 Ga0307409_100643663 3300031995 Bacteria 1053
302 Ga0307416_100689718 3300032002 Bacteria 1109
303 Ga0307414_10390180 3300032004 Bacteria 1206
304 Ga0307411_10035731 3300032005 Bacteria 3106
305 Ga0307411_10074601 3300032005 Bacteria 2312
306 Ga0307411_10732309 3300032005 Bacteria 864
307 Ga0373942_0135726 3300035207 Bacteria 779
308 Ga0373947_0187509 3300035725 Bacteria 1349
309 Ga0395899_0001220 3300037312 Bacteria 22496
310 Ga0395899_0008545 3300037312 Bacteria 7888
311 Ga0395899_0011213 3300037312 Bacteria 6868
312 Ga0395899_0014271 3300037312 Bacteria 6065
313 Ga0395899_0048676 3300037312 Bacteria 3153
314 Ga0395899_0106251 3300037312 Bacteria 2021
315 Ga0395899_0107958 3300037312 Unclassified 2003
316 Ga0395899_0151456 3300037312 Bacteria 1643
317 Ga0395899_0454964 3300037312 Bacteria 837
318 Ga0395900_0001734 3300037418 Bacteria 25160
319 Ga0395900_0003883 3300037418 Bacteria 15973
320 Ga0395900_0019480 3300037418 Bacteria 6917
321 Ga0395900_0023244 3300037418 Bacteria 6344
322 Ga0395900_0052516 3300037418 Bacteria 4195
323 Ga0395900_0087753 3300037418 Bacteria 3197
324 Ga0395900_0150624 3300037418 Bacteria 2376
325 Ga0395900_0162264 3300037418 Bacteria 2279
326 Ga0395900_0164956 3300037418 Bacteria 2258
327 Ga0395900_0170581 3300037418 Bacteria 2215
328 Ga0395900_0181649 3300037418 Bacteria 2137
329 Ga0395900_0497236 3300037418 Bacteria 1170
330 Ga0395900_0600621 3300037418 Bacteria 1041
331 Ga0395900_0656097 3300037418 Bacteria 985
332 Ga0395900_0899794 3300037418 Bacteria 808
333 Ga0395900_0989012 3300037418 Bacteria 761
334 Ga0395900_1056203 3300037418 Bacteria 730
335 Ga0395898_0001129 3300037466 Bacteria 40961
336 Ga0395898_0003597 3300037466 Bacteria 17278
337 Ga0395898_0015590 3300037466 Bacteria 7791
338 Ga0395898_0030004 3300037466 Bacteria 5443
339 Ga0395898_0049051 3300037466 Bacteria 4138
340 Ga0395898_0095838 3300037466 Bacteria 2850
341 Ga0395898_0111991 3300037466 Bacteria 2615
342 Ga0395898_0233656 3300037466 Bacteria 1753
343 Ga0395898_0462873 3300037466 Bacteria 1207
344 Ga0395898_0840722 3300037466 Bacteria 857
345 Ga0395898_1062822 3300037466 Bacteria 744
346 Ga0395905_0000109 3300037471 Bacteria 137754
347 Ga0395905_0000187 3300037471 Bacteria 98895
348 Ga0395905_0000654 3300037471 Bacteria 46099
349 Ga0395905_0004065 3300037471 Bacteria 15339
350 Ga0395905_0006217 3300037471 Bacteria 12054
351 Ga0395905_0024401 3300037471 Bacteria 5707
352 Ga0395905_0026361 3300037471 Bacteria 5480
353 Ga0395905_0034001 3300037471 Bacteria 4788
354 Ga0395905_0046275 3300037471 Bacteria 4079
355 Ga0395905_0050084 3300037471 Bacteria 3914
356 Ga0395905_0091310 3300037471 Unclassified 2855
357 Ga0395905_0091418 3300037471 Bacteria 2853
358 Ga0395905_0100441 3300037471 Bacteria 2717
359 Ga0395905_0143241 3300037471 Bacteria 2248
360 Ga0395905_0143808 3300037471 Bacteria 2244
361 Ga0395905_0260603 3300037471 Bacteria 1619
362 Ga0395905_0261842 3300037471 Bacteria 1614
363 Ga0395905_0349430 3300037471 Bacteria 1370
364 Ga0395905_0356762 3300037471 Bacteria 1354
365 Ga0395905_0439322 3300037471 Bacteria 1202
366 Ga0395905_0476472 3300037471 Unclassified 1147
367 Ga0395905_0684907 3300037471 Bacteria 927
368 Ga0395905_0937750 3300037471 Bacteria 768
369 Ga0395905_1075589 3300037471 Bacteria 707
370 Ga0395901_0007349 3300038443 Bacteria 11119
371 Ga0395901_0016796 3300038443 Bacteria 7458
372 Ga0395901_0017926 3300038443 Bacteria 7226
373 Ga0395901_0021926 3300038443 Bacteria 6547
374 Ga0395901_0027422 3300038443 Bacteria 5852
375 Ga0395901_0049178 3300038443 Bacteria 4380
376 Ga0395901_0070814 3300038443 Bacteria 3633
377 Ga0395901_0181530 3300038443 Unclassified 2207
378 Ga0395901_0250903 3300038443 Bacteria 1843
379 Ga0395901_0320755 3300038443 Bacteria 1603
380 Ga0395901_1577434 3300038443 Bacteria 610
381 Ga0436363_0911620 3300039450 Bacteria 1048
382 Ga0439438_050838 3300041405 Bacteria 1054
383 Ga0439465_0039423 3300041413 Bacteria 1525
384 Ga0439432_046031 3300042006 Bacteria 1371
385 Ga0439449_0037012 3300042007 Bacteria 1815
386 Ga0450917_015744 3300042120 Bacteria 641
387 Ga0450890_006393 3300042127 Bacteria 1507
388 Ga0450905_005032 3300042142 Bacteria 1769
389 Ga0450889_007451 3300042144 Bacteria 1104
390 Ga0466969_0155467 3300044656 Bacteria 1052
391 Ga0466972_0236276 3300044658 Bacteria 855
392 Ga0466965_0042379 3300044683 Bacteria 2245
393 Ga0466966_0074111 3300044684 Bacteria 2128
394 Ga0466966_0164566 3300044684 Unclassified 1350
395 Ga0466966_0227765 3300044684 Bacteria 1125
396 Ga0466961_0017864 3300044693 Bacteria 4559
397 Ga0466961_0033744 3300044693 Bacteria 3288
398 Ga0466961_0468370 3300044693 Bacteria 762
399 Ga0466963_0001644 3300044694 Bacteria 12176
400 Ga0466963_0003313 3300044694 Bacteria 9189
401 Ga0466963_0023454 3300044694 Bacteria 3920
402 Ga0466963_0193613 3300044694 Bacteria 1421
403 Ga0466963_0349277 3300044694 Bacteria 1042
404 Ga0466964_0009922 3300044706 Bacteria 3588
405 Ga0466970_0029287 3300044765 Bacteria 2898
406 Ga0466957_0106293 3300044842 Bacteria 1775
407 Ga0466960_0166202 3300044901 Bacteria 1188
408 Ga0466960_0649145 3300044901 Bacteria 630
409 Ga0466959_0036553 3300045049 Bacteria 3629
410 Ga0466959_0069797 3300045049 Bacteria 2545
411 Ga0466958_0069478 3300045836 Bacteria 2153
412 Ga0466958_0132433 3300045836 Bacteria 1566
413 Ga0466967_0222734 3300045976 Bacteria 1793
414 Ga0466967_0428054 3300045976 Bacteria 1291
415 Ga0495621_0312312 3300046539 Bacteria 653
416 Ga0495625_0176592 3300046660 Bacteria 1423
417 Ga0495659_0091302 3300046664 Bacteria 1170
418 Ga0495685_041187 3300047447 Bacteria 1579
419 Ga0496101_0378761 3300048904 Bacteria 1113
420 Ga0496107_0040178 3300048910 Bacteria 3357
421 Ga0496108_0201716 3300048911 Bacteria 1726
422 Ga0496109_0021079 3300048912 Bacteria 5762
423 Ga0496112_0088958 3300048915 Bacteria 3056
424 Ga0496112_0172314 3300048915 Bacteria 2129
425 Ga0496112_0379624 3300048915 Bacteria 1354
426 Ga0496112_0403863 3300048915 Bacteria 1306
427 Ga0496113_0098317 3300048916 Bacteria 2265
428 Ga0501047_0362202 3300049581 Bacteria 1286
429 Ga0501074_0317682 3300049590 Bacteria 1106
430 Ga0501201_008753 3300049651 Bacteria 979
431 Ga0501209_158889 3300049656 Bacteria 683
432 Ga0501249_088417 3300049679 Bacteria 733
433 Ga0501257_080376 3300049686 Bacteria 840
434 Ga0501258_016701 3300049687 Bacteria 832
435 Ga0501225_0073333 3300049705 Bacteria 975
436 Ga0501234_071148 3300049707 Bacteria 601
437 Ga0501080_0050808 3300049742 Bacteria 3858
438 Ga0501263_043191 3300049760 Bacteria 667
439 Ga0501283_021201 3300049779 Bacteria 1041
440 Ga0501044_1477648 3300049823 Bacteria 545
441 Ga0501204_007338 3300049850 Bacteria 1239
442 nmdc:mga09592_386332_c1 3300050508 Bacteria 1210
443 nmdc:mga06r32_233466_c1 3300050510 Unclassified 1827
444 nmdc:mga08x19_487140_c1 3300050514 Bacteria 870
445 nmdc:mga0a205_4191_c1 3300050515 Bacteria 12927
446 Ga0500658_0000036 3300053134 Bacteria 85304
447 Ga0466962_0170390 3300061719 Bacteria 1060
448 Ga0466962_0297894 3300061719 Bacteria 797
449 Ga0070658_10047046
450 JGI24737J22298_10117944
451 Ga0065715_10019864
452 Ga0070658_10010025
453 Ga0070658_10056263
454 Ga0070658_10080294
455 Ga0070658_10093550
456 Ga0070658_10182854
457 Ga0070658_10354935
458 Ga0070658_10706096
459 Ga0070683_100011488
460 Ga0070690_100928819
461 Ga0070670_100001339
462 Ga0070677_10025246
463 Ga0068869_100176260
464 Ga0070666_10877724
465 Ga0070680_100000777
466 Ga0070680_100012680
467 Ga0068868_100046368
468 Ga0068868_100450485
469 Ga0070660_100015053
470 Ga0070660_100080442
471 Ga0070660_100095951
472 Ga0070660_100741516
473 Ga0070660_100763006
474 Ga0070689_100235226
475 Ga0070691_10177218
476 Ga0070661_100114578
477 Ga0070661_100138205
478 Ga0070661_100170815
479 Ga0070692_10014271
480 Ga0070692_10357796
481 Ga0070668_100059146
482 Ga0070669_100018693
483 Ga0070669_100059126
484 Ga0070675_100158679
485 Ga0070671_100007095
486 Ga0070671_100029423
487 Ga0070671_100072116
488 Ga0070671_100263000
489 Ga0070671_100341184
490 Ga0070673_100022671
491 Ga0070673_100135670
492 Ga0070659_100098059
493 Ga0070659_100179934
494 Ga0070659_100334270
495 Ga0070667_100010588
496 Ga0070667_100030202
497 Ga0070667_100089016
498 Ga0070667_100668855
499 Ga0070714_100025570
500 Ga0070678_100037230
501 Ga0070662_100032478
502 Ga0070662_100050917
503 Ga0070662_100082648
504 Ga0070681_10552245
505 Ga0070679_100094110
506 Ga0070679_100223611
507 Ga0070679_100469255
508 Ga0070679_100888122
509 Ga0070684_100007096
510 Ga0068853_100084407
511 Ga0070672_100020170
512 Ga0070672_100050371
513 Ga0070672_101491872
514 Ga0070695_100050447
515 Ga0070696_100227015
516 Ga0070696_100273561
517 Ga0070693_100297996
518 Ga0070665_100218787
519 Ga0068855_100131347
520 Ga0068855_100136295
521 Ga0068855_100178110
522 Ga0068855_100479663
523 Ga0068855_100753157
524 Ga0068855_101016183
525 Ga0070664_100003131
526 Ga0070664_100010492
527 Ga0070664_100744482
528 Ga0068857_100090433
529 Ga0068857_100133179
530 Ga0068857_100342384
531 Ga0068854_100095107
532 Ga0068854_100161892
533 Ga0068856_100071906
534 Ga0068856_100242279
535 Ga0068856_100260503
536 Ga0068856_100266003
537 Ga0068852_100034193
538 Ga0068852_100163915
539 Ga0068852_100233133
540 Ga0068852_100269296
541 Ga0068852_100565079
542 Ga0068859_100000117
543 Ga0068859_100015140
544 Ga0068859_100254785
545 Ga0068864_100000161
546 Ga0068864_100013248
547 Ga0068864_100087960
548 Ga0068866_10199017
549 Ga0068863_100008756
550 Ga0068863_100112049
551 Ga0068863_100312286
552 Ga0068858_100015848
553 Ga0068858_100017001
554 Ga0068858_100902471
555 Ga0068860_100008520
556 Ga0068860_100272965
557 Ga0068860_100281308
558 Ga0068860_100505032
559 Ga0068860_100537756
560 Ga0068862_100034380
561 Ga0068862_100075340
562 Ga0068862_100532544
563 Ga0068862_100613992
564 Ga0081540_1132389
565 Ga0070717_10010483
566 Ga0070716_100520732
567 Ga0068871_100902615
568 Ga0075428_101041425
569 Ga0075431_100256903
570 Ga0075433_10021050
571 Ga0075434_100215807
572 Ga0068865_100276860
573 Ga0097620_100000117
574 Ga0097620_100015140
575 Ga0097620_100254789
576 Ga0105251_10146325
577 Ga0105240_10007132
578 Ga0105240_10405120
579 Ga0111539_10148932
580 Ga0105245_10033427
581 Ga0105243_10026249
582 Ga0105241_10853038
583 Ga0105241_11342654
584 Ga0105242_10158495
585 Ga0105248_10006996
586 Ga0105248_10084268
587 Ga0105248_10286033
588 Ga0105248_10324764
589 Ga0105248_10925600
590 Ga0105238_10210170
591 Ga0105249_10333496
592 Ga0105249_12044919
593 Ga0105239_12059468
594 Ga0157373_10039432
595 Ga0157373_10050369
596 Ga0157373_10129453
597 Ga0157373_10317032
598 Ga0157371_10012397
599 Ga0157371_10122150
600 Ga0157371_10502582
601 Ga0157370_10034997
602 Ga0157370_10282667
603 Ga0157370_11429897
604 Ga0157369_10008565
605 Ga0157369_10081273
606 Ga0157369_10152397
607 Ga0157369_10576649
608 Ga0157374_10494116
609 Ga0157374_11344939
610 Ga0157378_10578314
611 Ga0163162_10054919
612 Ga0163162_11007726
613 Ga0157372_10501234
614 Ga0157372_10551653
615 Ga0157372_11940859
616 Ga0163163_10000259
617 Ga0182008_10084851
618 Ga0157379_10002538
619 Ga0157379_10861178
620 Ga0157376_11586741
621 Ga0197907_10132243
622 Ga0206356_10198633
623 Ga0207697_10012624
624 Ga0207682_10028838
625 Ga0207688_10003884
626 Ga0207688_10031476
627 Ga0207680_10042241
628 Ga0207680_10173515
629 Ga0207647_10019058
630 Ga0207647_10024895
631 Ga0207645_10540116
632 Ga0207643_10066614
633 Ga0207705_10014649
634 Ga0207705_10033121
635 Ga0207705_10077477
636 Ga0207705_10088966
637 Ga0207705_10393423
638 Ga0207705_10476909
639 Ga0207705_10673404
640 Ga0207654_10019248
641 Ga0207654_10131594
642 Ga0207707_10100551
643 Ga0207707_10623859
644 Ga0207695_10412160
645 Ga0207660_10003839
646 Ga0207660_10116951
647 Ga0207660_10827262
648 Ga0207657_10060715
649 Ga0207657_10068087
650 Ga0207649_10118866
651 Ga0207649_10395182
652 Ga0207652_10153601
653 Ga0207652_10206155
654 Ga0207652_10647528
655 Ga0207681_10024824
656 Ga0207681_10153854
657 Ga0207694_10124046
658 Ga0207650_10025534
659 Ga0207650_10027925
660 Ga0207650_10662571
661 Ga0207659_10719425
662 Ga0207687_10040946
663 Ga0207687_10678657
664 Ga0207700_10028101
665 Ga0207664_10017154
666 Ga0207644_10000346
667 Ga0207644_10099047
668 Ga0207690_10325028
669 Ga0207690_10826729
670 Ga0207706_10071730
671 Ga0207686_10178705
672 Ga0207709_10182359
673 Ga0207670_10482489
674 Ga0207669_10043089
675 Ga0207665_10319117
676 Ga0207691_10009292
677 Ga0207691_10109213
678 Ga0207691_10177440
679 Ga0207711_10000039
680 Ga0207711_10050361
681 Ga0207711_10296602
682 Ga0207711_10649416
683 Ga0207689_10006113
684 Ga0207661_10006104
685 Ga0207679_10155763
686 Ga0207679_10635650
687 Ga0207667_10015036
688 Ga0207667_10042394
689 Ga0207667_10106294
690 Ga0207667_11264681
691 Ga0207651_10138223
692 Ga0207712_10013703
693 Ga0207712_10751064
694 Ga0207668_10287939
695 Ga0207640_10134264
696 Ga0207640_10268796
697 Ga0207640_10461384
698 Ga0207658_10000833
699 Ga0207658_10114071
700 Ga0207658_10132061
701 Ga0207677_10015950
702 Ga0207703_10001056
703 Ga0207703_10005442
704 Ga0207703_11257278
705 Ga0207639_10750235
706 Ga0207639_10809413
707 Ga0207678_10013396
708 Ga0207678_10029051
709 Ga0207678_10035050
710 Ga0207678_10559618
711 Ga0207702_10009375
712 Ga0207702_10524926
713 Ga0207702_10716808
714 Ga0207702_10738386
715 Ga0207702_10810624
716 Ga0207641_10000185
717 Ga0207641_10061784
718 Ga0207641_10277371
719 Ga0207676_10000531
720 Ga0207676_10078412
721 Ga0207676_10152087
722 Ga0207674_10075352
723 Ga0207674_10154859
724 Ga0207683_10036401
725 Ga0207683_10038334
726 Ga0207698_10009732
727 Ga0207698_10082879
728 Ga0207698_10140938
729 Ga0207698_10247771
730 Ga0207698_12338140
731 Ga0268266_10405791
732 Ga0268265_10004573
733 Ga0268265_10048098
734 Ga0268265_10064283
735 Ga0268265_10966033
736 Ga0268264_10006604
737 Ga0268264_10252216
738 Ga0268264_10278641
739 Ga0268264_11141296
740 Ga0307513_10228686
741 Ga0307509_10812178
742 Ga0307408_100075346
743 Ga0307410_10326882
744 Ga0307406_10099044
745 Ga0307407_10135202
746 Ga0307407_10311944
747 Ga0307407_10386065
748 Ga0307409_100055597
749 Ga0307409_100643663
750 Ga0307416_100689718
751 Ga0307414_10390180
752 Ga0307411_10035731
753 Ga0307411_10074601
754 Ga0307411_10732309
755 Ga0373942_0135726
756 Ga0373947_0187509
757 Ga0395899_0001220
758 Ga0395899_0008545
759 Ga0395899_0011213
760 Ga0395899_0014271
761 Ga0395899_0048676
762 Ga0395899_0106251
763 Ga0395899_0107958
764 Ga0395899_0151456
765 Ga0395899_0454964
766 Ga0395900_0001734
767 Ga0395900_0003883
768 Ga0395900_0019480
769 Ga0395900_0023244
770 Ga0395900_0052516
771 Ga0395900_0087753
772 Ga0395900_0150624
773 Ga0395900_0162264
774 Ga0395900_0164956
775 Ga0395900_0170581
776 Ga0395900_0181649
777 Ga0395900_0497236
778 Ga0395900_0600621
779 Ga0395900_0656097
780 Ga0395900_0899794
781 Ga0395900_0989012
782 Ga0395900_1056203
783 Ga0395898_0001129
784 Ga0395898_0003597
785 Ga0395898_0015590
786 Ga0395898_0030004
787 Ga0395898_0049051
788 Ga0395898_0095838
789 Ga0395898_0111991
790 Ga0395898_0233656
791 Ga0395898_0462873
792 Ga0395898_0840722
793 Ga0395898_1062822
794 Ga0395905_0000109
795 Ga0395905_0000187
796 Ga0395905_0000654
797 Ga0395905_0004065
798 Ga0395905_0006217
799 Ga0395905_0024401
800 Ga0395905_0026361
801 Ga0395905_0034001
802 Ga0395905_0046275
803 Ga0395905_0050084
804 Ga0395905_0091310
805 Ga0395905_0091418
806 Ga0395905_0100441
807 Ga0395905_0143241
808 Ga0395905_0143808
809 Ga0395905_0260603
810 Ga0395905_0261842
811 Ga0395905_0349430
812 Ga0395905_0356762
813 Ga0395905_0439322
814 Ga0395905_0476472
815 Ga0395905_0684907
816 Ga0395905_0937750
817 Ga0395905_1075589
818 Ga0395901_0007349
819 Ga0395901_0016796
820 Ga0395901_0017926
821 Ga0395901_0021926
822 Ga0395901_0027422
823 Ga0395901_0049178
824 Ga0395901_0070814
825 Ga0395901_0181530
826 Ga0395901_0250903
827 Ga0395901_0320755
828 Ga0395901_1577434
829 Ga0436363_0911620
830 Ga0439438_050838
831 Ga0439465_0039423
832 Ga0439432_046031
833 Ga0439449_0037012
834 Ga0450917_015744
835 Ga0450890_006393
836 Ga0450905_005032
837 Ga0450889_007451
838 Ga0466969_0155467
839 Ga0466972_0236276
840 Ga0466965_0042379
841 Ga0466966_0074111
842 Ga0466966_0164566
843 Ga0466966_0227765
844 Ga0466961_0017864
845 Ga0466961_0033744
846 Ga0466961_0468370
847 Ga0466963_0001644
848 Ga0466963_0003313
849 Ga0466963_0023454
850 Ga0466963_0193613
851 Ga0466963_0349277
852 Ga0466964_0009922
853 Ga0466970_0029287
854 Ga0466957_0106293
855 Ga0466960_0166202
856 Ga0466960_0649145
857 Ga0466959_0036553
858 Ga0466959_0069797
859 Ga0466958_0069478
860 Ga0466958_0132433
861 Ga0466967_0222734
862 Ga0466967_0428054
863 Ga0495621_0312312
864 Ga0495625_0176592
865 Ga0495659_0091302
866 Ga0495685_041187
867 Ga0496101_0378761
868 Ga0496107_0040178
869 Ga0496108_0201716
870 Ga0496109_0021079
871 Ga0496112_0088958
872 Ga0496112_0172314
873 Ga0496112_0379624
874 Ga0496112_0403863
875 Ga0496113_0098317
876 Ga0501047_0362202
877 Ga0501074_0317682
878 Ga0501201_008753
879 Ga0501209_158889
880 Ga0501249_088417
881 Ga0501257_080376
882 Ga0501258_016701
883 Ga0501225_0073333
884 Ga0501234_071148
885 Ga0501080_0050808
886 Ga0501263_043191
887 Ga0501283_021201
888 Ga0501044_1477648
889 Ga0501204_007338
890 nmdc:mga09592_386332_c1
891 nmdc:mga06r32_233466_c1
892 nmdc:mga08x19_487140_c1
893 nmdc:mga0a205_4191_c1
894 Ga0500658_0000036
895 Ga0466962_0170390
896 Ga0466962_0297894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

80

150

0.93

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

12

80

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.8517 2 149
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.8318 2 149
4c7y-assembly1.cif.gz_A aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide 0.8313 1 150
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8307 2 148
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8289 2 150
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8405 2 72 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8231 2 74 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8148 2 74 3.10.20.30
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8146 82 147 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8126 2 74 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A520JA02-F1-model_v4 (2Fe-2S)-binding protein 0.8734 1 117 GO:0016491
GO:0046872
GO:0051537
AF-A0A841J3Z6-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.8693 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A1W7M6S7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.8682 1 149 GO:0046872
GO:0047121
GO:0051537
AF-A0A520JA02-F1-model_v4 (2Fe-2S)-binding protein 0.8663 1 117 GO:0016491
GO:0046872
GO:0051537
AF-A0A7X0JUW7-F1-model_v4 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) 0.8649 1 151 GO:0046872
GO:0047121
GO:0051537

Map