F446034

General Info

Members Datasets Scaffolds Average Seq Length
447 303 895 320

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0095305|Ga0496126_0095305_13_1170
Length 374
Sequence MDVALIGVGGRAVWNFAASSGSGEIVVDGIVLAMQITLLAMQGAFDLGLAAVLDTLETANELAATLVGIGRRVCTGRGFVVPVRVANSAPRPDAVVLPALGEKMPAGLQARLSQQDVAKAGGLLREWSQDGAWIGAACTGTFVLADSTLLDGHGATTSWWLAPLFRQRYARVGLDESRMLVSSGRFVTAGAALAHVDLALGLVRRHSPGLAALTARYLLVEPRASQAAFVIPDHLAHSDPLVERFESWARQHIKHGFSLADAAQTVGTSERTLDRRLRAVLGKSPLSYFQDLRVERAVHLLQTTQVSVEGIAAEIGYSDGVTLRTLLRRKLGRGVREIRARSTLTATTDRPPAEPALASSTEPVARHSGHIRSS

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
91 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
94 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
191 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
192 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
196 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
238 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
246 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
278 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
279 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
280 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
283 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
284 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
285 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
286 2643221594 Achromobacter sp. Root170 Isolate Unclassified
287 2643221609 Acidovorax sp. Root217 Isolate Unclassified
288 2643221611 Acidovorax sp. Root219 Isolate Unclassified
289 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
290 2643221660 Methylibium sp. Root1272 Isolate Unclassified
291 2738541337 Pelomonas sp. BT06 Isolate Unclassified
292 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
293 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
294 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
295 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
296 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
297 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
298 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
299 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
300 2928051484 Variovorax sp. 1133 Isolate Unclassified
301 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
302 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
303 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.41
Metatranscriptomes 0.67
Isolates 4.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.99
Nodule 2.46
Rhizoplane 4.03
Rhizosphere 65.32
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0095305 3300048929 Bacteria 2611
2 JGI24740J21852_10004982 3300001979 Bacteria 5642
3 JGI24739J22299_10001660 3300001989 Bacteria 8456
4 JGI24737J22298_10001622 3300001990 Bacteria 8013
5 JGI24735J21928_10006300 3300002067 Bacteria 3917
6 JGI25152J39213_1002277 3300002773 Bacteria 7403
7 JGI25151J46595_10000021 3300003187 Bacteria 227826
8 JGI25151J46595_10006652 3300003187 Bacteria 5768
9 JGI25151J46595_10011627 3300003187 Bacteria 4039
10 JGI25153J46596_10001218 3300003215 Bacteria 15527
11 JGI25153J46596_10011540 3300003215 Bacteria 3895
12 rootH1_10029734 3300003316 Bacteria 1483
13 rootH1_10029734 3300003323 Bacteria 2737
14 rootH1_10064386 3300003316 Unclassified 2713
15 rootL2_10039015 3300003322 Bacteria 6285
16 rootL2_10175834 3300003322 Bacteria 1933
17 rootL2_10284682 3300003322 Bacteria 2127
18 rootH1_10004278 3300003323 Bacteria 12809
19 rootH1_10005354 3300003323 Bacteria 16078
20 rootH1_10013216 3300003323 Bacteria 9545
21 rootH1_10077084 3300003323 Bacteria 3912
22 rootH1_10116353 3300003323 Bacteria 3390
23 rootH1_10182954 3300003323 Bacteria 1830
24 Ga0006562J51391_1106681 3300003578 Bacteria 2550
25 Ga0055539_1002016 3300003752 Bacteria 3336
26 Ga0055533_1000026 3300003756 Bacteria 323407
27 Ga0055535_1000056 3300003761 Bacteria 128204
28 Ga0055529_1000165 3300003763 Bacteria 91442
29 Ga0055526_1002006 3300003771 Bacteria 14023
30 Ga0055537_1003702 3300003773 Bacteria 4620
31 Ga0055524_1001033 3300003775 Bacteria 17200
32 Ga0055524_1001458 3300003775 Bacteria 13528
33 Ga0055524_1002704 3300003775 Bacteria 8960
34 Ga0055524_1013217 3300003775 Bacteria 3124
35 Ga0055534_1006195 3300003784 Bacteria 3056
36 Ga0055528_1007951 3300003790 Bacteria 4620
37 Ga0055528_1010393 3300003790 Bacteria 3787
38 Ga0055543_1000769 3300004625 Bacteria 15968
39 Ga0058862_12371833 3300004803 Bacteria 1150
40 Ga0065165_1010311 3300005262 Bacteria 4057
41 Ga0070658_10064421 3300005327 Bacteria 2989
42 Ga0070658_10107512 3300005327 Bacteria 2308
43 Ga0070658_10426026 3300005327 Bacteria 1142
44 Ga0070683_100008707 3300005329 Bacteria 8629
45 Ga0070690_100001198 3300005330 Bacteria 13397
46 Ga0070690_100007455 3300005330 Bacteria 6267
47 Ga0070670_100125034 3300005331 Bacteria 2220
48 Ga0070670_100206447 3300005331 Bacteria 1708
49 Ga0070670_100289872 3300005331 Bacteria 1430
50 Ga0068869_100020666 3300005334 Bacteria 4518
51 Ga0070666_10011286 3300005335 Bacteria 5607
52 Ga0070682_100001677 3300005337 Bacteria 12323
53 Ga0068868_100004590 3300005338 Bacteria 9698
54 Ga0070689_100000312 3300005340 Bacteria 28320
55 Ga0070689_100087163 3300005340 Bacteria 2456
56 Ga0070687_100003980 3300005343 Bacteria 5829
57 Ga0070675_100003726 3300005354 Bacteria 11585
58 Ga0070671_100009369 3300005355 Bacteria 7864
59 Ga0070671_100017706 3300005355 Bacteria 5774
60 Ga0070671_100054920 3300005355 Unclassified 3312
61 Ga0070674_100108985 3300005356 Bacteria 2030
62 Ga0070673_100005112 3300005364 Bacteria 8370
63 Ga0070673_100005589 3300005364 Bacteria 8063
64 Ga0070688_100000250 3300005365 Bacteria 28293
65 Ga0070659_100080310 3300005366 Bacteria 2604
66 Ga0070667_100015481 3300005367 Bacteria 6307
67 Ga0070667_100449754 3300005367 Bacteria 1177
68 Ga0070700_100005490 3300005441 Bacteria 6726
69 Ga0070708_100000073 3300005445 Bacteria 64587
70 Ga0070708_100314638 3300005445 Unclassified 1475
71 Ga0070708_100331946 3300005445 Bacteria 1433
72 Ga0070663_100061600 3300005455 Bacteria 2702
73 Ga0070678_100007753 3300005456 Bacteria 6384
74 Ga0070662_100274789 3300005457 Bacteria 1361
75 Ga0070681_10085973 3300005458 Bacteria 3098
76 Ga0068867_100001442 3300005459 Bacteria 16474
77 Ga0070685_10000365 3300005466 Bacteria 27475
78 Ga0070706_100013851 3300005467 Bacteria 7456
79 Ga0070706_100097651 3300005467 Bacteria 2728
80 Ga0070706_100264706 3300005467 Bacteria 1605
81 Ga0070707_100204125 3300005468 Bacteria 1927
82 Ga0070698_100007146 3300005471 Bacteria 12094
83 Ga0070698_100417055 3300005471 Bacteria 1277
84 Ga0070699_100118236 3300005518 Bacteria 2330
85 Ga0070697_100121232 3300005536 Bacteria 2187
86 Ga0070697_100130069 3300005536 Bacteria 2111
87 Ga0070697_100210366 3300005536 Bacteria 1656
88 Ga0070672_100042812 3300005543 Bacteria 3487
89 Ga0070672_100067725 3300005543 Unclassified 2830
90 Ga0070686_100000397 3300005544 Bacteria 27512
91 Ga0070686_100181949 3300005544 Bacteria 1494
92 Ga0070696_100082877 3300005546 Bacteria 2274
93 Ga0070665_100095134 3300005548 Bacteria 2983
94 Ga0070665_100288442 3300005548 Bacteria 1643
95 Ga0070704_100029409 3300005549 Bacteria 3668
96 Ga0068855_100096877 3300005563 Bacteria 3398
97 Ga0068855_100331094 3300005563 Bacteria 1681
98 Ga0068855_100441954 3300005563 Bacteria 1420
99 Ga0068857_100002081 3300005577 Bacteria 16255
100 Ga0068857_100013194 3300005577 Bacteria 7201
101 Ga0068854_100001373 3300005578 Bacteria 14644
102 Ga0068852_100141953 3300005616 Unclassified 2224
103 Ga0068852_100143294 3300005616 Bacteria 2214
104 Ga0068852_100285180 3300005616 Bacteria 1593
105 Ga0068859_100000706 3300005617 Bacteria 33544
106 Ga0068859_100036325 3300005617 Bacteria 4946
107 Ga0068859_100075821 3300005617 Bacteria 3404
108 Ga0068859_100443835 3300005617 Bacteria 1394
109 Ga0068859_100652964 3300005617 Bacteria 1144
110 Ga0068864_100001399 3300005618 Bacteria 19954
111 Ga0068864_100011857 3300005618 Bacteria 7198
112 Ga0068866_10066500 3300005718 Bacteria 1889
113 Ga0068866_10093617 3300005718 Bacteria 1642
114 Ga0068863_100079606 3300005841 Bacteria 3103
115 Ga0068863_100115488 3300005841 Bacteria 2558
116 Ga0068858_100112944 3300005842 Bacteria 2537
117 Ga0068860_100166781 3300005843 Bacteria 2126
118 Ga0068860_100191137 3300005843 Bacteria 1981
119 Ga0075366_10027269 3300006195 Bacteria 3350
120 Ga0097621_100015573 3300006237 Bacteria 5726
121 Ga0075370_10061598 3300006353 Bacteria 2137
122 Ga0075370_10190261 3300006353 Bacteria 1209
123 Ga0068871_100033670 3300006358 Bacteria 4059
124 Ga0075434_100117088 3300006871 Bacteria 2677
125 Ga0068865_100120392 3300006881 Bacteria 1950
126 Ga0075436_100195464 3300006914 Unclassified 1432
127 Ga0097620_100000706 3300006931 Bacteria 33544
128 Ga0097620_100036322 3300006931 Bacteria 4946
129 Ga0097620_100075822 3300006931 Bacteria 3404
130 Ga0097620_100443828 3300006931 Bacteria 1394
131 Ga0097620_100653008 3300006931 Bacteria 1144
132 Ga0099823_1001716 3300006944 Bacteria 18761
133 Ga0075435_100115600 3300007076 Bacteria 2234
134 Ga0099795_10045068 3300007788 Bacteria 1584
135 Ga0105251_10002748 3300009011 Bacteria 13466
136 Ga0105240_10017782 3300009093 Bacteria 9569
137 Ga0105240_10059193 3300009093 Bacteria 4782
138 Ga0111539_10014934 3300009094 Bacteria 9680
139 Ga0105245_10102057 3300009098 Bacteria 2656
140 Ga0105241_10052859 3300009174 Bacteria 3103
141 Ga0105242_10005844 3300009176 Bacteria 9478
142 Ga0105248_10029569 3300009177 Bacteria 6113
143 Ga0105248_10062547 3300009177 Bacteria 4179
144 Ga0105237_10000401 3300009545 Bacteria 61614
145 Ga0105238_10017736 3300009551 Bacteria 7237
146 Ga0123341_1083040 3300009765 Bacteria 1232
147 Ga0123342_1031780 3300009766 Bacteria 2527
148 Ga0105239_10206423 3300010375 Bacteria 2201
149 Ga0157314_1000026 3300012500 Bacteria 14438
150 Ga0157327_1001658 3300012512 Bacteria 1434
151 Ga0157371_10005125 3300013102 Bacteria 11172
152 Ga0157370_10114046 3300013104 Bacteria 2525
153 Ga0157369_10071392 3300013105 Bacteria 3727
154 Ga0157369_10172582 3300013105 Bacteria 2278
155 Ga0157374_10031956 3300013296 Bacteria 4789
156 Ga0157374_10178121 3300013296 Bacteria 2076
157 Ga0157378_10050822 3300013297 Bacteria 3688
158 Ga0157378_10322874 3300013297 Unclassified 1500
159 Ga0163162_10019072 3300013306 Bacteria 6728
160 Ga0157375_10022015 3300013308 Bacteria 5861
161 Ga0157375_10053342 3300013308 Bacteria 3978
162 Ga0157375_10686887 3300013308 Bacteria 1178
163 Ga0163163_10003704 3300014325 Bacteria 13015
164 Ga0163163_10018776 3300014325 Bacteria 6482
165 Ga0157380_10008933 3300014326 Bacteria 7159
166 Ga0157380_10059884 3300014326 Unclassified 3040
167 Ga0157380_10169068 3300014326 Bacteria 1908
168 Ga0157379_10054159 3300014968 Bacteria 3585
169 Ga0157379_10094211 3300014968 Bacteria 2687
170 Ga0157376_10013123 3300014969 Bacteria 6172
171 Ga0163161_10165438 3300017792 Bacteria 1688
172 Ga0224712_10048231 3300022467 Bacteria 1643
173 Ga0209436_101337 3300025208 Bacteria 8718
174 Ga0209674_100024 3300025226 Bacteria 535481
175 Ga0209563_100069 3300025230 Bacteria 253154
176 Ga0209258_100071 3300025242 Bacteria 278319
177 Ga0209677_100092 3300025253 Bacteria 102482
178 Ga0209677_100495 3300025253 Bacteria 22160
179 Ga0209759_1000797 3300025256 Bacteria 25577
180 Ga0209129_1000124 3300025258 Bacteria 133610
181 Ga0209129_1006233 3300025258 Bacteria 3935
182 Ga0209565_1001938 3300025263 Bacteria 8133
183 Ga0209455_1000030 3300025272 Bacteria 533479
184 Ga0209673_1000216 3300025273 Bacteria 114232
185 Ga0209673_1008333 3300025273 Bacteria 4622
186 Ga0209130_1000646 3300025284 Bacteria 32516
187 Ga0209130_1002654 3300025284 Bacteria 8558
188 Ga0209675_1003279 3300025291 Bacteria 7782
189 Ga0209676_1013530 3300025292 Bacteria 3132
190 Ga0209025_1000010 3300025294 Bacteria 986612
191 Ga0209025_1000049 3300025294 Bacteria 333459
192 Ga0209025_1011162 3300025294 Bacteria 5973
193 Ga0209564_1000057 3300025295 Bacteria 340400
194 Ga0209564_1000070 3300025295 Bacteria 303126
195 Ga0209564_1000834 3300025295 Bacteria 41660
196 Ga0209758_1000214 3300025297 Bacteria 126364
197 Ga0209758_1000247 3300025297 Bacteria 110976
198 Ga0209758_1015395 3300025297 Bacteria 3963
199 Ga0209256_1000047 3300025299 Bacteria 314709
200 Ga0209256_1000609 3300025299 Bacteria 49593
201 Ga0209256_1000671 3300025299 Bacteria 46253
202 Ga0209256_1000768 3300025299 Bacteria 41660
203 Ga0207426_1000194 3300025302 Bacteria 150009
204 Ga0207426_1021553 3300025302 Bacteria 2227
205 Ga0207713_1008710 3300025735 Bacteria 5796
206 Ga0207642_10092626 3300025899 Bacteria 1497
207 Ga0207647_10008595 3300025904 Bacteria 7306
208 Ga0207647_10053496 3300025904 Bacteria 2488
209 Ga0207705_10032767 3300025909 Bacteria 3713
210 Ga0207705_10044904 3300025909 Bacteria 3176
211 Ga0207705_10080670 3300025909 Bacteria 2371
212 Ga0207684_10151484 3300025910 Bacteria 1995
213 Ga0207707_10047960 3300025912 Bacteria 3721
214 Ga0207695_10000800 3300025913 Bacteria 58751
215 Ga0207695_10013799 3300025913 Bacteria 9612
216 Ga0207671_10000037 3300025914 Bacteria 230395
217 Ga0207662_10003426 3300025918 Bacteria 8160
218 Ga0207652_10274955 3300025921 Bacteria 1519
219 Ga0207652_10417907 3300025921 Bacteria 1210
220 Ga0207646_10232609 3300025922 Bacteria 1665
221 Ga0207646_10567559 3300025922 Bacteria 1020
222 Ga0207694_10077422 3300025924 Bacteria 2606
223 Ga0207650_10075502 3300025925 Bacteria 2544
224 Ga0207650_10337165 3300025925 Unclassified 1238
225 Ga0207659_10017742 3300025926 Bacteria 4653
226 Ga0207644_10030651 3300025931 Unclassified 3742
227 Ga0207644_10034390 3300025931 Bacteria 3546
228 Ga0207690_10054474 3300025932 Bacteria 2689
229 Ga0207690_10056191 3300025932 Bacteria 2654
230 Ga0207686_10009880 3300025934 Bacteria 5186
231 Ga0207670_10000299 3300025936 Bacteria 29690
232 Ga0207670_10073046 3300025936 Bacteria 2377
233 Ga0207691_10015803 3300025940 Bacteria 7172
234 Ga0207691_10169820 3300025940 Unclassified 1910
235 Ga0207667_10000185 3300025949 Bacteria 90844
236 Ga0207667_10378241 3300025949 Bacteria 1443
237 Ga0207651_10001817 3300025960 Bacteria 9937
238 Ga0207651_10214666 3300025960 Unclassified 1551
239 Ga0207640_10000628 3300025981 Bacteria 20692
240 Ga0207658_10002349 3300025986 Bacteria 13901
241 Ga0207658_10019668 3300025986 Bacteria 4670
242 Ga0207677_10001445 3300026023 Bacteria 12585
243 Ga0207677_10401800 3300026023 Bacteria 1162
244 Ga0207703_10005187 3300026035 Bacteria 10527
245 Ga0207703_10177428 3300026035 Bacteria 1878
246 Ga0207678_10085508 3300026067 Bacteria 2696
247 Ga0207678_10116859 3300026067 Bacteria 2276
248 Ga0207708_10007091 3300026075 Bacteria 8279
249 Ga0207641_10032707 3300026088 Bacteria 4319
250 Ga0207648_10003220 3300026089 Bacteria 17188
251 Ga0207676_10002950 3300026095 Bacteria 12130
252 Ga0207674_10002468 3300026116 Bacteria 23345
253 Ga0207674_10030186 3300026116 Bacteria 5702
254 Ga0207683_10014190 3300026121 Bacteria 6789
255 Ga0207698_10452636 3300026142 Bacteria 1239
256 Ga0209389_1000702 3300027296 Bacteria 20905
257 Ga0207428_10401759 3300027907 Unclassified 1003
258 Ga0265356_1000211 3300028017 Bacteria 10959
259 Ga0268266_10051735 3300028379 Bacteria 3526
260 Ga0307515_10000257 3300028794 Bacteria 131732
261 Ga0307515_10000283 3300028794 Bacteria 124822
262 Ga0307515_10001727 3300028794 Bacteria 48647
263 Ga0307515_10004838 3300028794 Bacteria 27552
264 Ga0307515_10016473 3300028794 Bacteria 13528
265 Ga0307515_10178174 3300028794 Bacteria 2087
266 Ga0307513_10011813 3300031456 Bacteria 10822
267 Ga0307513_10084005 3300031456 Bacteria 3272
268 Ga0307509_10002275 3300031507 Bacteria 31384
269 Ga0307408_100000831 3300031548 Bacteria 24498
270 Ga0307408_100012997 3300031548 Bacteria 5520
271 Ga0307508_10021940 3300031616 Bacteria 5809
272 Ga0307508_10030786 3300031616 Bacteria 4849
273 Ga0307514_10001925 3300031649 Bacteria 22740
274 Ga0307516_10000803 3300031730 Bacteria 43064
275 Ga0307516_10001053 3300031730 Bacteria 38382
276 Ga0307405_10019570 3300031731 Bacteria 3764
277 Ga0307405_10355313 3300031731 Bacteria 1132
278 Ga0307406_10013322 3300031901 Bacteria 4709
279 Ga0307406_10231630 3300031901 Bacteria 1380
280 Ga0307412_10126746 3300031911 Bacteria 1847
281 Ga0307416_100008599 3300032002 Bacteria 6603
282 Ga0307510_10001725 3300033180 Bacteria 24301
283 Ga0307510_10086655 3300033180 Bacteria 3002
284 Ga0373934_0006730 3300035086 Bacteria 4271
285 Ga0373933_0141526 3300035724 Bacteria 1519
286 Ga0373937_0017611 3300036401 Bacteria 6370
287 Ga0395900_0041181 3300037418 Bacteria 4763
288 Ga0395900_0144694 3300037418 Bacteria 2432
289 Ga0395905_0000103 3300037471 Bacteria 143491
290 Ga0395905_0368520 3300037471 Bacteria 1329
291 Ga0395901_0270896 3300038443 Bacteria 1766
292 Ga0436361_0805952 3300039447 Bacteria 1861
293 Ga0439431_0003587 3300041997 Bacteria 3423
294 Ga0495592_0000128 3300046454 Bacteria 67453
295 Ga0495590_0003309 3300046457 Bacteria 6598
296 Ga0495629_0020391 3300046459 Bacteria 4735
297 Ga0495653_0002435 3300046463 Bacteria 14792
298 Ga0495639_0038340 3300046475 Bacteria 2152
299 Ga0495664_0054121 3300046477 Bacteria 2386
300 Ga0495584_0116469 3300046491 Bacteria 1353
301 Ga0495583_0000018 3300046506 Bacteria 306541
302 Ga0495606_0003207 3300046507 Bacteria 17626
303 Ga0495606_0063021 3300046507 Bacteria 2364
304 Ga0495620_0033167 3300046515 Bacteria 2346
305 Ga0495628_0038642 3300046516 Bacteria 3820
306 Ga0495630_0004101 3300046517 Bacteria 10196
307 Ga0495632_0027510 3300046519 Bacteria 2979
308 Ga0495632_0111008 3300046519 Bacteria 1287
309 Ga0495666_0126444 3300046526 Bacteria 1195
310 Ga0495652_0019068 3300046529 Bacteria 6110
311 Ga0495652_0272595 3300046529 Bacteria 1243
312 Ga0495665_0000513 3300046531 Bacteria 19564
313 Ga0495621_0014072 3300046539 Bacteria 2526
314 Ga0495597_0023249 3300046542 Bacteria 2867
315 Ga0495645_0058766 3300046543 Bacteria 2789
316 Ga0495645_0118431 3300046543 Bacteria 1867
317 Ga0495622_0000020 3300046557 Bacteria 166839
318 Ga0495633_0000207 3300046558 Bacteria 74645
319 Ga0495668_0058764 3300046616 Bacteria 2122
320 Ga0495635_0009440 3300046663 Bacteria 6820
321 Ga0495599_0053824 3300046678 Bacteria 2521
322 Ga0495646_0003808 3300046680 Bacteria 9432
323 Ga0495658_0093103 3300046683 Bacteria 1788
324 Ga0495624_0004942 3300046690 Bacteria 9663
325 Ga0495649_0001823 3300046694 Bacteria 15652
326 Ga0495649_0052799 3300046694 Bacteria 2202
327 Ga0495589_0007157 3300046794 Bacteria 5847
328 Ga0495600_0065471 3300046809 Bacteria 2376
329 Ga0495604_0003503 3300047317 Bacteria 12506
330 Ga0495674_0036319 3300047319 Bacteria 4435
331 Ga0495672_0127674 3300047320 Bacteria 1342
332 Ga0495680_0039877 3300047322 Bacteria 3743
333 Ga0495683_0015375 3300047323 Bacteria 3983
334 Ga0495687_002080 3300047443 Bacteria 16814
335 Ga0495675_0031693 3300047444 Bacteria 3375
336 Ga0495681_0059352 3300047470 Bacteria 1769
337 Ga0495686_0002009 3300047472 Bacteria 20129
338 Ga0495593_0002863 3300047673 Bacteria 10398
339 Ga0495602_0000273 3300048088 Bacteria 47682
340 Ga0495626_0126396 3300048091 Bacteria 1095
341 Ga0496100_0021444 3300048903 Bacteria 3891
342 Ga0496100_0037053 3300048903 Bacteria 3080
343 Ga0496101_0049681 3300048904 Bacteria 3018
344 Ga0496103_0025038 3300048906 Bacteria 3604
345 Ga0496104_0088333 3300048907 Bacteria 2961
346 Ga0496104_0127400 3300048907 Bacteria 2444
347 Ga0496104_0266717 3300048907 Bacteria 1625
348 Ga0496105_0056466 3300048908 Bacteria 3240
349 Ga0496106_0049008 3300048909 Bacteria 3181
350 Ga0496106_0281866 3300048909 Unclassified 1331
351 Ga0496108_0080238 3300048911 Bacteria 2764
352 Ga0496108_0396614 3300048911 Bacteria 1205
353 Ga0496109_0176086 3300048912 Bacteria 2008
354 Ga0496111_0155137 3300048914 Bacteria 1699
355 Ga0496112_0036960 3300048915 Bacteria 4765
356 Ga0496112_0048665 3300048915 Bacteria 4155
357 Ga0496113_0050220 3300048916 Bacteria 3109
358 Ga0496114_0680687 3300048917 Bacteria 903
359 Ga0496117_0059248 3300048920 Bacteria 2646
360 Ga0496118_0039936 3300048921 Bacteria 3738
361 Ga0496119_0022732 3300048922 Bacteria 4477
362 Ga0496119_0047568 3300048922 Bacteria 2668
363 Ga0496119_0148622 3300048922 Bacteria 1258
364 Ga0496120_0000099 3300048923 Bacteria 144885
365 Ga0496121_0010438 3300048924 Bacteria 10479
366 Ga0496121_0064447 3300048924 Plasmid 2988
367 Ga0496121_0080425 3300048924 Bacteria 2583
368 Ga0496121_0115782 3300048924 Bacteria 2035
369 Ga0496121_0123405 3300048924 Bacteria 1952
370 Ga0496122_0038472 3300048925 Bacteria 3832
371 Ga0496124_0086347 3300048927 Bacteria 2568
372 Ga0496124_0469103 3300048927 Bacteria 853
373 Ga0496125_0001347 3300048928 Bacteria 36226
374 Ga0496125_0017711 3300048928 Bacteria 6781
375 Ga0495678_072416 3300049459 Bacteria 1259
376 Ga0495682_0128428 3300049460 Unclassified 907
377 Ga0501032_0021494 3300049569 Bacteria 4484
378 Ga0501032_0123828 3300049569 Bacteria 1708
379 Ga0501033_0000063 3300049570 Bacteria 101552
380 Ga0501036_0024706 3300049572 Bacteria 5066
381 Ga0501036_0359172 3300049572 Unclassified 1216
382 Ga0501037_0100334 3300049573 Bacteria 2090
383 Ga0501038_0001778 3300049574 Bacteria 20024
384 Ga0501038_0289689 3300049574 Bacteria 1287
385 Ga0501040_0009634 3300049576 Bacteria 6305
386 Ga0501041_0021756 3300049577 Plasmid 3841
387 Ga0501041_0140833 3300049577 Bacteria 1504
388 Ga0501043_0024289 3300049579 Bacteria 4757
389 Ga0501043_0081381 3300049579 Bacteria 2544
390 Ga0501046_0013114 3300049580 Bacteria 7035
391 Ga0501047_0099620 3300049581 Bacteria 2785
392 Ga0501071_0120228 3300049587 Bacteria 1947
393 Ga0501072_0005458 3300049588 Bacteria 9685
394 Ga0501073_0059137 3300049589 Bacteria 2678
395 Ga0501076_0013367 3300049592 Bacteria 6156
396 Ga0501076_0053863 3300049592 Bacteria 3189
397 Ga0501077_0002550 3300049593 Bacteria 10919
398 Ga0501079_0019905 3300049741 Bacteria 5126
399 Ga0501079_0086538 3300049741 Bacteria 2426
400 Ga0501035_0125044 3300049822 Bacteria 2245
401 Ga0501044_0000190 3300049823 Bacteria 77415
402 Ga0501044_0121526 3300049823 Bacteria 2612
403 Ga0501044_0138676 3300049823 Bacteria 2421
404 Ga0501045_0113535 3300049824 Bacteria 2009
405 Ga0501045_0136822 3300049824 Unclassified 1821
406 nmdc:mga04h51_17618_c1 3300050495 Bacteria 2092
407 nmdc:mga07m45_46943_c1 3300050496 Bacteria 2427
408 nmdc:mga08y16_28302_c1 3300050511 Bacteria 5907
409 nmdc:mga08y16_362590_c1 3300050511 Unclassified 1488
410 nmdc:mga0n895_331349_c1 3300050512 Bacteria 1542
411 nmdc:mga0rr50_157598_c1 3300050513 Bacteria 1840
412 nmdc:mga08x19_66222_c1 3300050514 Unclassified 2347
413 Ga0500635_0000112 3300053080 Bacteria 49317
414 Ga0500651_0013926 3300053093 Bacteria 4911
415 Ga0500651_0110504 3300053093 Bacteria 1678
416 Ga0500562_016433 3300053108 Bacteria 1903
417 Ga0500559_0000013 3300053136 Bacteria 163436
418 Ga0500568_0037669 3300053139 Bacteria 1961
419 Ga0500568_0090216 3300053139 Bacteria 1156
420 Ga0500636_0047140 3300053177 Bacteria 2539
421 Ga0500587_005452 3300053739 Bacteria 1710
422 Ga0501084_0013480 3300054114 Bacteria 6765
423 Ga0500661_001670 3300055283 Bacteria 4172
424 Ga0501082_0006474 3300060353 Bacteria 10157
425 Ga0530510_0068278 3300061734 Bacteria 2579
426 Ga0530510_0190767 3300061734 Bacteria 1521
427 2513635493 2513237093 Bacteria 7545552
428 2535520949 2534681796 Bacteria 7146037
429 2588291653 2588253510 Bacteria 6901809
430 2643979507 2643221594 Bacteria 5811388
431 2644058662 2643221609 Bacteria 6756331
432 2644070491 2643221611 Bacteria 6820941
433 2644073525 2643221611 Bacteria 6820941
434 2644305588 2643221654 Bacteria 5273570
435 2644337742 2643221660 Bacteria 4208257
436 2739054907 2738541337 Bacteria 6183410
437 2792624225 2791355091 Bacteria 6135441
438 2792630365 2791355092 Bacteria 6248105
439 2809035778 2808606395 Bacteria 6020352
440 2821444767 2821443989 Bacteria 7658172
441 2838687786 2838686498 Bacteria 7807632
442 2842272182 2842271015 Bacteria 7807131
443 2844462305 2844454524 Bacteria 7952546
444 2904542061 2904541872 Bacteria 8915136
445 2928056801 2928051484 Bacteria 7773759
446 2929167350 2929160207 Bacteria 9075316
447 639651231 639633055 Bacteria 7751309
448 8005549891 8005542996 Bacteria 7077758
449 Ga0496126_0095305
450 JGI24740J21852_10004982
451 JGI24739J22299_10001660
452 JGI24737J22298_10001622
453 JGI24735J21928_10006300
454 JGI25152J39213_1002277
455 JGI25151J46595_10000021
456 JGI25151J46595_10006652
457 JGI25151J46595_10011627
458 JGI25153J46596_10001218
459 JGI25153J46596_10011540
460 rootH1_10029734
461 rootH1_10064386
462 rootL2_10039015
463 rootL2_10175834
464 rootL2_10284682
465 rootH1_10004278
466 rootH1_10005354
467 rootH1_10013216
468 rootH1_10077084
469 rootH1_10116353
470 rootH1_10182954
471 Ga0006562J51391_1106681
472 Ga0055539_1002016
473 Ga0055533_1000026
474 Ga0055535_1000056
475 Ga0055529_1000165
476 Ga0055526_1002006
477 Ga0055537_1003702
478 Ga0055524_1001033
479 Ga0055524_1001458
480 Ga0055524_1002704
481 Ga0055524_1013217
482 Ga0055534_1006195
483 Ga0055528_1007951
484 Ga0055528_1010393
485 Ga0055543_1000769
486 Ga0058862_12371833
487 Ga0065165_1010311
488 Ga0070658_10064421
489 Ga0070658_10107512
490 Ga0070658_10426026
491 Ga0070683_100008707
492 Ga0070690_100001198
493 Ga0070690_100007455
494 Ga0070670_100125034
495 Ga0070670_100206447
496 Ga0070670_100289872
497 Ga0068869_100020666
498 Ga0070666_10011286
499 Ga0070682_100001677
500 Ga0068868_100004590
501 Ga0070689_100000312
502 Ga0070689_100087163
503 Ga0070687_100003980
504 Ga0070675_100003726
505 Ga0070671_100009369
506 Ga0070671_100017706
507 Ga0070671_100054920
508 Ga0070674_100108985
509 Ga0070673_100005112
510 Ga0070673_100005589
511 Ga0070688_100000250
512 Ga0070659_100080310
513 Ga0070667_100015481
514 Ga0070667_100449754
515 Ga0070700_100005490
516 Ga0070708_100000073
517 Ga0070708_100314638
518 Ga0070708_100331946
519 Ga0070663_100061600
520 Ga0070678_100007753
521 Ga0070662_100274789
522 Ga0070681_10085973
523 Ga0068867_100001442
524 Ga0070685_10000365
525 Ga0070706_100013851
526 Ga0070706_100097651
527 Ga0070706_100264706
528 Ga0070707_100204125
529 Ga0070698_100007146
530 Ga0070698_100417055
531 Ga0070699_100118236
532 Ga0070697_100121232
533 Ga0070697_100130069
534 Ga0070697_100210366
535 Ga0070672_100042812
536 Ga0070672_100067725
537 Ga0070686_100000397
538 Ga0070686_100181949
539 Ga0070696_100082877
540 Ga0070665_100095134
541 Ga0070665_100288442
542 Ga0070704_100029409
543 Ga0068855_100096877
544 Ga0068855_100331094
545 Ga0068855_100441954
546 Ga0068857_100002081
547 Ga0068857_100013194
548 Ga0068854_100001373
549 Ga0068852_100141953
550 Ga0068852_100143294
551 Ga0068852_100285180
552 Ga0068859_100000706
553 Ga0068859_100036325
554 Ga0068859_100075821
555 Ga0068859_100443835
556 Ga0068859_100652964
557 Ga0068864_100001399
558 Ga0068864_100011857
559 Ga0068866_10066500
560 Ga0068866_10093617
561 Ga0068863_100079606
562 Ga0068863_100115488
563 Ga0068858_100112944
564 Ga0068860_100166781
565 Ga0068860_100191137
566 Ga0075366_10027269
567 Ga0097621_100015573
568 Ga0075370_10061598
569 Ga0075370_10190261
570 Ga0068871_100033670
571 Ga0075434_100117088
572 Ga0068865_100120392
573 Ga0075436_100195464
574 Ga0097620_100000706
575 Ga0097620_100036322
576 Ga0097620_100075822
577 Ga0097620_100443828
578 Ga0097620_100653008
579 Ga0099823_1001716
580 Ga0075435_100115600
581 Ga0099795_10045068
582 Ga0105251_10002748
583 Ga0105240_10017782
584 Ga0105240_10059193
585 Ga0111539_10014934
586 Ga0105245_10102057
587 Ga0105241_10052859
588 Ga0105242_10005844
589 Ga0105248_10029569
590 Ga0105248_10062547
591 Ga0105237_10000401
592 Ga0105238_10017736
593 Ga0123341_1083040
594 Ga0123342_1031780
595 Ga0105239_10206423
596 Ga0157314_1000026
597 Ga0157327_1001658
598 Ga0157371_10005125
599 Ga0157370_10114046
600 Ga0157369_10071392
601 Ga0157369_10172582
602 Ga0157374_10031956
603 Ga0157374_10178121
604 Ga0157378_10050822
605 Ga0157378_10322874
606 Ga0163162_10019072
607 Ga0157375_10022015
608 Ga0157375_10053342
609 Ga0157375_10686887
610 Ga0163163_10003704
611 Ga0163163_10018776
612 Ga0157380_10008933
613 Ga0157380_10059884
614 Ga0157380_10169068
615 Ga0157379_10054159
616 Ga0157379_10094211
617 Ga0157376_10013123
618 Ga0163161_10165438
619 Ga0224712_10048231
620 Ga0209436_101337
621 Ga0209674_100024
622 Ga0209563_100069
623 Ga0209258_100071
624 Ga0209677_100092
625 Ga0209677_100495
626 Ga0209759_1000797
627 Ga0209129_1000124
628 Ga0209129_1006233
629 Ga0209565_1001938
630 Ga0209455_1000030
631 Ga0209673_1000216
632 Ga0209673_1008333
633 Ga0209130_1000646
634 Ga0209130_1002654
635 Ga0209675_1003279
636 Ga0209676_1013530
637 Ga0209025_1000010
638 Ga0209025_1000049
639 Ga0209025_1011162
640 Ga0209564_1000057
641 Ga0209564_1000070
642 Ga0209564_1000834
643 Ga0209758_1000214
644 Ga0209758_1000247
645 Ga0209758_1015395
646 Ga0209256_1000047
647 Ga0209256_1000609
648 Ga0209256_1000671
649 Ga0209256_1000768
650 Ga0207426_1000194
651 Ga0207426_1021553
652 Ga0207713_1008710
653 Ga0207642_10092626
654 Ga0207647_10008595
655 Ga0207647_10053496
656 Ga0207705_10032767
657 Ga0207705_10044904
658 Ga0207705_10080670
659 Ga0207684_10151484
660 Ga0207707_10047960
661 Ga0207695_10000800
662 Ga0207695_10013799
663 Ga0207671_10000037
664 Ga0207662_10003426
665 Ga0207652_10274955
666 Ga0207652_10417907
667 Ga0207646_10232609
668 Ga0207646_10567559
669 Ga0207694_10077422
670 Ga0207650_10075502
671 Ga0207650_10337165
672 Ga0207659_10017742
673 Ga0207644_10030651
674 Ga0207644_10034390
675 Ga0207690_10054474
676 Ga0207690_10056191
677 Ga0207686_10009880
678 Ga0207670_10000299
679 Ga0207670_10073046
680 Ga0207691_10015803
681 Ga0207691_10169820
682 Ga0207667_10000185
683 Ga0207667_10378241
684 Ga0207651_10001817
685 Ga0207651_10214666
686 Ga0207640_10000628
687 Ga0207658_10002349
688 Ga0207658_10019668
689 Ga0207677_10001445
690 Ga0207677_10401800
691 Ga0207703_10005187
692 Ga0207703_10177428
693 Ga0207678_10085508
694 Ga0207678_10116859
695 Ga0207708_10007091
696 Ga0207641_10032707
697 Ga0207648_10003220
698 Ga0207676_10002950
699 Ga0207674_10002468
700 Ga0207674_10030186
701 Ga0207683_10014190
702 Ga0207698_10452636
703 Ga0209389_1000702
704 Ga0207428_10401759
705 Ga0265356_1000211
706 Ga0268266_10051735
707 Ga0307515_10000257
708 Ga0307515_10000283
709 Ga0307515_10001727
710 Ga0307515_10004838
711 Ga0307515_10016473
712 Ga0307515_10178174
713 Ga0307513_10011813
714 Ga0307513_10084005
715 Ga0307509_10002275
716 Ga0307408_100000831
717 Ga0307408_100012997
718 Ga0307508_10021940
719 Ga0307508_10030786
720 Ga0307514_10001925
721 Ga0307516_10000803
722 Ga0307516_10001053
723 Ga0307405_10019570
724 Ga0307405_10355313
725 Ga0307406_10013322
726 Ga0307406_10231630
727 Ga0307412_10126746
728 Ga0307416_100008599
729 Ga0307510_10001725
730 Ga0307510_10086655
731 Ga0373934_0006730
732 Ga0373933_0141526
733 Ga0373937_0017611
734 Ga0395900_0041181
735 Ga0395900_0144694
736 Ga0395905_0000103
737 Ga0395905_0368520
738 Ga0395901_0270896
739 Ga0436361_0805952
740 Ga0439431_0003587
741 Ga0495592_0000128
742 Ga0495590_0003309
743 Ga0495629_0020391
744 Ga0495653_0002435
745 Ga0495639_0038340
746 Ga0495664_0054121
747 Ga0495584_0116469
748 Ga0495583_0000018
749 Ga0495606_0003207
750 Ga0495606_0063021
751 Ga0495620_0033167
752 Ga0495628_0038642
753 Ga0495630_0004101
754 Ga0495632_0027510
755 Ga0495632_0111008
756 Ga0495666_0126444
757 Ga0495652_0019068
758 Ga0495652_0272595
759 Ga0495665_0000513
760 Ga0495621_0014072
761 Ga0495597_0023249
762 Ga0495645_0058766
763 Ga0495645_0118431
764 Ga0495622_0000020
765 Ga0495633_0000207
766 Ga0495668_0058764
767 Ga0495635_0009440
768 Ga0495599_0053824
769 Ga0495646_0003808
770 Ga0495658_0093103
771 Ga0495624_0004942
772 Ga0495649_0001823
773 Ga0495649_0052799
774 Ga0495589_0007157
775 Ga0495600_0065471
776 Ga0495604_0003503
777 Ga0495674_0036319
778 Ga0495672_0127674
779 Ga0495680_0039877
780 Ga0495683_0015375
781 Ga0495687_002080
782 Ga0495675_0031693
783 Ga0495681_0059352
784 Ga0495686_0002009
785 Ga0495593_0002863
786 Ga0495602_0000273
787 Ga0495626_0126396
788 Ga0496100_0021444
789 Ga0496100_0037053
790 Ga0496101_0049681
791 Ga0496103_0025038
792 Ga0496104_0088333
793 Ga0496104_0127400
794 Ga0496104_0266717
795 Ga0496105_0056466
796 Ga0496106_0049008
797 Ga0496106_0281866
798 Ga0496108_0080238
799 Ga0496108_0396614
800 Ga0496109_0176086
801 Ga0496111_0155137
802 Ga0496112_0036960
803 Ga0496112_0048665
804 Ga0496113_0050220
805 Ga0496114_0680687
806 Ga0496117_0059248
807 Ga0496118_0039936
808 Ga0496119_0022732
809 Ga0496119_0047568
810 Ga0496119_0148622
811 Ga0496120_0000099
812 Ga0496121_0010438
813 Ga0496121_0064447
814 Ga0496121_0080425
815 Ga0496121_0115782
816 Ga0496121_0123405
817 Ga0496122_0038472
818 Ga0496124_0086347
819 Ga0496124_0469103
820 Ga0496125_0001347
821 Ga0496125_0017711
822 Ga0495678_072416
823 Ga0495682_0128428
824 Ga0501032_0021494
825 Ga0501032_0123828
826 Ga0501033_0000063
827 Ga0501036_0024706
828 Ga0501036_0359172
829 Ga0501037_0100334
830 Ga0501038_0001778
831 Ga0501038_0289689
832 Ga0501040_0009634
833 Ga0501041_0021756
834 Ga0501041_0140833
835 Ga0501043_0024289
836 Ga0501043_0081381
837 Ga0501046_0013114
838 Ga0501047_0099620
839 Ga0501071_0120228
840 Ga0501072_0005458
841 Ga0501073_0059137
842 Ga0501076_0013367
843 Ga0501076_0053863
844 Ga0501077_0002550
845 Ga0501079_0019905
846 Ga0501079_0086538
847 Ga0501035_0125044
848 Ga0501044_0000190
849 Ga0501044_0121526
850 Ga0501044_0138676
851 Ga0501045_0113535
852 Ga0501045_0136822
853 nmdc:mga04h51_17618_c1
854 nmdc:mga07m45_46943_c1
855 nmdc:mga08y16_28302_c1
856 nmdc:mga08y16_362590_c1
857 nmdc:mga0n895_331349_c1
858 nmdc:mga0rr50_157598_c1
859 nmdc:mga08x19_66222_c1
860 Ga0500635_0000112
861 Ga0500651_0013926
862 Ga0500651_0110504
863 Ga0500562_016433
864 Ga0500559_0000013
865 Ga0500568_0037669
866 Ga0500568_0090216
867 Ga0500636_0047140
868 Ga0500587_005452
869 Ga0501084_0013480
870 Ga0500661_001670
871 Ga0501082_0006474
872 Ga0530510_0068278
873 Ga0530510_0190767
874 2513635493
875 2535520949
876 2588291653
877 2643979507
878 2644058662
879 2644070491
880 2644073525
881 2644305588
882 2644337742
883 2739054907
884 2792624225
885 2792630365
886 2809035778
887 2821444767
888 2838687786
889 2842272182
890 2844462305
891 2904542061
892 2928056801
893 2929167350
894 639651231
895 8005549891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

250

290

0.96

PF12833

HTH_18

Helix-turn-helix domain

262

354

0.95

PF01965

DJ-1_PfpI

DJ-1/PfpI family

34

205

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9327 210 316
2k9s-assembly1.cif.gz_A solution structure of dna binding domain of e. coli arac 0.9035 213 315
3mkl-assembly2.cif.gz_B crystal structure of dna-binding transcriptional dual regulator from escherichia coli k-12 0.8977 213 316
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.8858 210 316
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.871 213 315
ID Description Score Start End Superfamily
3lsgC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9471 269 313 1.10.10.60
3lsgB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9456 269 313 1.10.10.60
3lsgA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9334 269 313 1.10.10.60
af_P05052_134_237_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9292 222 315 1.10.10.60
3oioA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9283 210 316 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1F8V3J0-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9479 218 313 GO:0003700
GO:0043565
AF-A0A7T1P121-F1-model_v4 deleted 0.9417 215 316
AF-A0A2A2MAE5-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.933 222 314 GO:0003700
GO:0043565
AF-A0A2N5AUR7-F1-model_v4 deleted 0.9278 215 315
AF-A0A5R9AZN9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9272 215 306 GO:0003700
GO:0043565

Map