F446018

General Info

Members Datasets Scaffolds Average Seq Length
447 260 894 159

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0260036|Ga0495640_0260036_249_824
Length 191
Sequence MTADFPRSRERWPELAPSGGAIVKVPVSISVNGRRYQREVEPRLLLVHFIRDLGGITGTKVGCDTSQCGSCTVLLDGIAVRSCTCLAAQADGCAVTTIEGLAPAGSLHPLQEAFWNKHGLQCGFCTPGMILASHELLRQNPTPTDDEIRHGLEGNMCRCTGYQNIVRAVREAAAGLRPGGVESVGQGAPQP

Samples

Sample ID Description Type Environment
1 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
169 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
173 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 6.04
Rhizosphere 92.62
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495640_0260036 3300046533 Bacteria 1085
2 SwRhRL2b_contig_1393997 2162886007 Bacteria 3333
3 JGI24752J21851_1004716 3300001976 Bacteria 1784
4 JGI24737J22298_10076745 3300001990 Bacteria 996
5 JGI24744J21845_10052940 3300002077 Bacteria 747
6 JGI25406J46586_10168623 3300003203 Bacteria 638
7 Ga0065712_10270633 3300005290 Bacteria 916
8 Ga0065715_10114731 3300005293 Bacteria 2440
9 Ga0065715_10141316 3300005293 Bacteria 1849
10 Ga0065707_10010826 3300005295 Bacteria 3734
11 Ga0065707_10128991 3300005295 Bacteria 1953
12 Ga0065707_10355727 3300005295 Bacteria 911
13 Ga0070658_10423127 3300005327 Bacteria 1145
14 Ga0070676_10479265 3300005328 Bacteria 880
15 Ga0070683_100059051 3300005329 Bacteria 3563
16 Ga0070683_100253424 3300005329 Bacteria 1674
17 Ga0070670_100416348 3300005331 Bacteria 1187
18 Ga0070670_100893551 3300005331 Bacteria 805
19 Ga0068869_100041033 3300005334 Bacteria 3312
20 Ga0068869_101608942 3300005334 Bacteria 579
21 Ga0070666_10832256 3300005335 Bacteria 681
22 Ga0068868_101186891 3300005338 Bacteria 705
23 Ga0070660_100059906 3300005339 Bacteria 2953
24 Ga0070689_100222729 3300005340 Bacteria 1548
25 Ga0070689_100461284 3300005340 Bacteria 1082
26 Ga0070691_10273349 3300005341 Bacteria 914
27 Ga0070687_100016115 3300005343 Bacteria 3399
28 Ga0070661_100036153 3300005344 Bacteria 3590
29 Ga0070661_100382385 3300005344 Bacteria 1110
30 Ga0070692_10011304 3300005345 Bacteria 4093
31 Ga0070668_100050023 3300005347 Bacteria 3217
32 Ga0070669_100001922 3300005353 Bacteria 14992
33 Ga0070675_100004471 3300005354 Bacteria 10665
34 Ga0070675_100052547 3300005354 Bacteria 3350
35 Ga0070675_100605539 3300005354 Bacteria 994
36 Ga0070671_100003498 3300005355 Bacteria 12262
37 Ga0070671_100051616 3300005355 Bacteria 3420
38 Ga0070674_100217843 3300005356 Bacteria 1483
39 Ga0070673_100104583 3300005364 Bacteria 2338
40 Ga0070673_100176587 3300005364 Bacteria 1826
41 Ga0070673_100254579 3300005364 Bacteria 1532
42 Ga0070688_100228332 3300005365 Bacteria 1315
43 Ga0070659_100774400 3300005366 Bacteria 833
44 Ga0070667_100224371 3300005367 Bacteria 1673
45 Ga0070667_100244394 3300005367 Bacteria 1603
46 Ga0070667_101937937 3300005367 Bacteria 555
47 Ga0070709_10004951 3300005434 Bacteria 7199
48 Ga0070714_100155734 3300005435 Bacteria 2062
49 Ga0070714_100314308 3300005435 Bacteria 1463
50 Ga0070713_100036892 3300005436 Bacteria 3948
51 Ga0070713_100079446 3300005436 Bacteria 2794
52 Ga0070710_10005020 3300005437 Bacteria 6262
53 Ga0070701_10047907 3300005438 Bacteria 2203
54 Ga0070701_10156792 3300005438 Bacteria 1315
55 Ga0070701_10552399 3300005438 Bacteria 756
56 Ga0070711_100014869 3300005439 Bacteria 4915
57 Ga0070705_100000156 3300005440 Bacteria 40273
58 Ga0070705_100112916 3300005440 Bacteria 1740
59 Ga0070705_100654164 3300005440 Bacteria 820
60 Ga0070700_100016170 3300005441 Bacteria 4246
61 Ga0070700_100246832 3300005441 Bacteria 1278
62 Ga0070700_100543176 3300005441 Bacteria 902
63 Ga0070694_100001976 3300005444 Bacteria 12165
64 Ga0070694_100003874 3300005444 Bacteria 8942
65 Ga0070708_100020950 3300005445 Bacteria 5521
66 Ga0070708_100481592 3300005445 Bacteria 1171
67 Ga0070663_100418712 3300005455 Bacteria 1098
68 Ga0068867_100000572 3300005459 Bacteria 24397
69 Ga0068867_100073707 3300005459 Bacteria 2557
70 Ga0068867_101070343 3300005459 Bacteria 735
71 Ga0070685_10148023 3300005466 Bacteria 1485
72 Ga0070706_100416348 3300005467 Bacteria 1251
73 Ga0070707_100015917 3300005468 Bacteria 7060
74 Ga0070707_100226433 3300005468 Bacteria 1821
75 Ga0070707_101206602 3300005468 Bacteria 723
76 Ga0070698_100004020 3300005471 Bacteria 16193
77 Ga0070698_100015387 3300005471 Bacteria 8083
78 Ga0070698_100068435 3300005471 Bacteria 3568
79 Ga0070698_100113692 3300005471 Bacteria 2672
80 Ga0070699_100019800 3300005518 Bacteria 5800
81 Ga0070699_100035616 3300005518 Bacteria 4302
82 Ga0070699_100166060 3300005518 Bacteria 1955
83 Ga0070699_101061031 3300005518 Bacteria 743
84 Ga0070679_100638139 3300005530 Bacteria 1008
85 Ga0070679_101050052 3300005530 Bacteria 759
86 Ga0070697_100024631 3300005536 Bacteria 4793
87 Ga0070672_100158860 3300005543 Bacteria 1874
88 Ga0070672_100210059 3300005543 Bacteria 1630
89 Ga0070686_100093109 3300005544 Bacteria 2020
90 Ga0070686_100500322 3300005544 Bacteria 943
91 Ga0070695_100000148 3300005545 Bacteria 32862
92 Ga0070695_100338446 3300005545 Bacteria 1124
93 Ga0070695_100627931 3300005545 Bacteria 846
94 Ga0070696_100000066 3300005546 Bacteria 50688
95 Ga0070696_100144217 3300005546 Bacteria 1743
96 Ga0070693_100075742 3300005547 Bacteria 1993
97 Ga0070704_100002911 3300005549 Bacteria 9720
98 Ga0070704_100540769 3300005549 Bacteria 1017
99 Ga0068855_100620271 3300005563 Bacteria 1164
100 Ga0070664_100059485 3300005564 Bacteria 3251
101 Ga0070664_100115074 3300005564 Bacteria 2350
102 Ga0070664_100496547 3300005564 Bacteria 1124
103 Ga0070664_101311103 3300005564 Bacteria 684
104 Ga0068857_100015360 3300005577 Bacteria 6686
105 Ga0068857_100027198 3300005577 Bacteria 5044
106 Ga0068854_100008268 3300005578 Bacteria 6678
107 Ga0068854_100561507 3300005578 Bacteria 970
108 Ga0068856_100378643 3300005614 Bacteria 1434
109 Ga0070702_100005452 3300005615 Bacteria 5927
110 Ga0070702_100041597 3300005615 Bacteria 2579
111 Ga0068852_100135239 3300005616 Bacteria 2275
112 Ga0068859_100003300 3300005617 Bacteria 16411
113 Ga0068859_100748156 3300005617 Bacteria 1066
114 Ga0068864_100036192 3300005618 Bacteria 4206
115 Ga0068864_100152053 3300005618 Bacteria 2097
116 Ga0068864_100280846 3300005618 Bacteria 1554
117 Ga0068861_100001761 3300005719 Bacteria 13912
118 Ga0068870_10005966 3300005840 Bacteria 5353
119 Ga0068870_10063696 3300005840 Bacteria 1989
120 Ga0068863_100135931 3300005841 Bacteria 2348
121 Ga0068863_100335743 3300005841 Bacteria 1470
122 Ga0068858_100090879 3300005842 Bacteria 2841
123 Ga0068860_100075243 3300005843 Bacteria 3211
124 Ga0068860_100201769 3300005843 Bacteria 1927
125 Ga0068860_100285541 3300005843 Bacteria 1614
126 Ga0068860_100331830 3300005843 Bacteria 1494
127 Ga0068862_100000265 3300005844 Bacteria 58275
128 Ga0068862_100009897 3300005844 Bacteria 7873
129 Ga0068862_100185850 3300005844 Bacteria 1867
130 Ga0081455_10004017 3300005937 Bacteria 16686
131 Ga0081455_10018603 3300005937 Bacteria 6606
132 Ga0081538_10049575 3300005981 Bacteria 2546
133 Ga0081539_10002098 3300005985 Bacteria 29700
134 Ga0070717_10033280 3300006028 Bacteria 4158
135 Ga0070717_10220526 3300006028 Bacteria 1667
136 Ga0070717_10699583 3300006028 Bacteria 921
137 Ga0070716_100004911 3300006173 Bacteria 6436
138 Ga0070712_100058107 3300006175 Bacteria 2720
139 Ga0097621_100285626 3300006237 Bacteria 1453
140 Ga0068871_100001004 3300006358 Bacteria 18915
141 Ga0068871_100021395 3300006358 Bacteria 4970
142 Ga0068871_101159440 3300006358 Bacteria 724
143 Ga0075428_100007068 3300006844 Bacteria 12438
144 Ga0075428_100586770 3300006844 Bacteria 1191
145 Ga0075428_100924758 3300006844 Bacteria 925
146 Ga0075433_10075489 3300006852 Bacteria 2967
147 Ga0075433_10273270 3300006852 Bacteria 1498
148 Ga0075433_10456649 3300006852 Bacteria 1126
149 Ga0075434_100004212 3300006871 Bacteria 12894
150 Ga0075434_100080270 3300006871 Bacteria 3259
151 Ga0075434_100333210 3300006871 Bacteria 1538
152 Ga0075434_100563402 3300006871 Bacteria 1159
153 Ga0075429_100331057 3300006880 Bacteria 1333
154 Ga0075429_100363679 3300006880 Bacteria 1267
155 Ga0075429_101005931 3300006880 Bacteria 729
156 Ga0075436_100216121 3300006914 Bacteria 1360
157 Ga0075436_100283755 3300006914 Bacteria 1184
158 Ga0097620_100003300 3300006931 Bacteria 16411
159 Ga0097620_100748196 3300006931 Bacteria 1066
160 Ga0075435_100002240 3300007076 Bacteria 12757
161 Ga0075435_100060268 3300007076 Bacteria 3077
162 Ga0075435_100094689 3300007076 Bacteria 2469
163 Ga0075435_100985342 3300007076 Bacteria 736
164 Ga0105250_10153357 3300009092 Bacteria 959
165 Ga0111539_10214587 3300009094 Bacteria 2242
166 Ga0111539_10276055 3300009094 Bacteria 1956
167 Ga0111539_11538544 3300009094 Bacteria 771
168 Ga0105247_10368203 3300009101 Bacteria 1015
169 Ga0114129_10001655 3300009147 Bacteria 30310
170 Ga0114129_10076020 3300009147 Bacteria 4676
171 Ga0114129_10204761 3300009147 Bacteria 2670
172 Ga0114129_10700267 3300009147 Bacteria 1302
173 Ga0105243_10032900 3300009148 Bacteria 4008
174 Ga0105243_10091526 3300009148 Bacteria 2505
175 Ga0105243_10346594 3300009148 Bacteria 1362
176 Ga0105243_10528391 3300009148 Bacteria 1123
177 Ga0105242_10867651 3300009176 Bacteria 900
178 Ga0105248_10028907 3300009177 Bacteria 6180
179 Ga0105248_10929039 3300009177 Bacteria 982
180 Ga0105249_10004215 3300009553 Bacteria 12427
181 Ga0105249_10786634 3300009553 Bacteria 1015
182 Ga0099796_10359578 3300010159 Bacteria 629
183 Ga0105246_10172147 3300011119 Bacteria 1659
184 Ga0157324_1015884 3300012506 Bacteria 710
185 Ga0157326_1077215 3300012513 Bacteria 539
186 Ga0157371_10186532 3300013102 Bacteria 1484
187 Ga0157369_10222055 3300013105 Bacteria 1978
188 Ga0157374_10263755 3300013296 Bacteria 1697
189 Ga0157374_11348598 3300013296 Bacteria 736
190 Ga0163162_10111762 3300013306 Bacteria 2830
191 Ga0157372_10439131 3300013307 Bacteria 1521
192 Ga0157372_11917047 3300013307 Bacteria 681
193 Ga0157375_10041665 3300013308 Bacteria 4436
194 Ga0157375_10250140 3300013308 Bacteria 1933
195 Ga0157375_11172841 3300013308 Bacteria 900
196 Ga0157380_10210660 3300014326 Bacteria 1732
197 Ga0157379_10109887 3300014968 Bacteria 2476
198 Ga0157376_11598163 3300014969 Bacteria 686
199 Ga0163161_10351384 3300017792 Bacteria 1172
200 Ga0163161_10509648 3300017792 Bacteria 981
201 Ga0213874_10061379 3300021377 Bacteria 1178
202 Ga0213876_10216829 3300021384 Bacteria 1017
203 Ga0207656_10028224 3300025321 Bacteria 2302
204 Ga0207656_10298429 3300025321 Bacteria 797
205 Ga0207653_10392767 3300025885 Bacteria 544
206 Ga0207692_10048037 3300025898 Bacteria 2146
207 Ga0207642_10067244 3300025899 Bacteria 1691
208 Ga0207710_10222268 3300025900 Bacteria 938
209 Ga0207688_10000217 3300025901 Bacteria 25744
210 Ga0207647_10211659 3300025904 Bacteria 1119
211 Ga0207645_10014631 3300025907 Bacteria 5242
212 Ga0207645_10301436 3300025907 Bacteria 1067
213 Ga0207643_10005624 3300025908 Bacteria 6700
214 Ga0207643_10106247 3300025908 Bacteria 1650
215 Ga0207643_10408277 3300025908 Bacteria 859
216 Ga0207684_10165828 3300025910 Bacteria 1903
217 Ga0207684_10279174 3300025910 Bacteria 1441
218 Ga0207707_11152453 3300025912 Bacteria 629
219 Ga0207693_10193025 3300025915 Bacteria 1602
220 Ga0207693_10382305 3300025915 Bacteria 1101
221 Ga0207663_10163342 3300025916 Bacteria 1575
222 Ga0207662_10026697 3300025918 Bacteria 3332
223 Ga0207662_10027283 3300025918 Bacteria 3295
224 Ga0207657_10008557 3300025919 Bacteria 10373
225 Ga0207649_10429581 3300025920 Bacteria 993
226 Ga0207652_10301922 3300025921 Bacteria 1445
227 Ga0207646_10108857 3300025922 Bacteria 2486
228 Ga0207646_10974235 3300025922 Bacteria 750
229 Ga0207681_10001144 3300025923 Bacteria 17122
230 Ga0207681_10049189 3300025923 Bacteria 2849
231 Ga0207659_10006934 3300025926 Bacteria 6961
232 Ga0207659_10101686 3300025926 Bacteria 2168
233 Ga0207659_10416875 3300025926 Bacteria 1125
234 Ga0207659_10892570 3300025926 Bacteria 764
235 Ga0207700_10027553 3300025928 Bacteria 3981
236 Ga0207700_10054618 3300025928 Bacteria 2999
237 Ga0207700_10153287 3300025928 Bacteria 1906
238 Ga0207664_10146883 3300025929 Bacteria 2000
239 Ga0207664_10176274 3300025929 Bacteria 1833
240 Ga0207664_10504641 3300025929 Bacteria 1083
241 Ga0207664_10679528 3300025929 Bacteria 926
242 Ga0207644_10014821 3300025931 Bacteria 5226
243 Ga0207644_10225405 3300025931 Bacteria 1487
244 Ga0207686_10649227 3300025934 Bacteria 835
245 Ga0207709_10028681 3300025935 Bacteria 3220
246 Ga0207709_10127355 3300025935 Bacteria 1729
247 Ga0207709_10252356 3300025935 Bacteria 1289
248 Ga0207670_10058256 3300025936 Bacteria 2623
249 Ga0207669_10083771 3300025937 Bacteria 2052
250 Ga0207665_10016034 3300025939 Bacteria 4921
251 Ga0207691_10041662 3300025940 Bacteria 4238
252 Ga0207691_10098186 3300025940 Bacteria 2617
253 Ga0207691_10120061 3300025940 Bacteria 2331
254 Ga0207711_10019333 3300025941 Bacteria 5672
255 Ga0207689_10005222 3300025942 Bacteria 11652
256 Ga0207689_10022474 3300025942 Bacteria 5303
257 Ga0207661_10240774 3300025944 Bacteria 1605
258 Ga0207661_10541039 3300025944 Bacteria 1066
259 Ga0207679_10134850 3300025945 Bacteria 1986
260 Ga0207679_10159319 3300025945 Bacteria 1846
261 Ga0207679_10459239 3300025945 Bacteria 1131
262 Ga0207679_11523002 3300025945 Bacteria 613
263 Ga0207651_10112025 3300025960 Bacteria 2050
264 Ga0207651_10630207 3300025960 Bacteria 940
265 Ga0207712_10192520 3300025961 Bacteria 1611
266 Ga0207668_10045801 3300025972 Bacteria 2985
267 Ga0207668_10068916 3300025972 Bacteria 2517
268 Ga0207640_10005858 3300025981 Bacteria 6704
269 Ga0207658_11131550 3300025986 Bacteria 715
270 Ga0207677_11122502 3300026023 Bacteria 717
271 Ga0207678_10249580 3300026067 Bacteria 1520
272 Ga0207708_10028455 3300026075 Bacteria 4232
273 Ga0207708_10153736 3300026075 Bacteria 1813
274 Ga0207702_10483325 3300026078 Bacteria 1205
275 Ga0207641_10025334 3300026088 Bacteria 4891
276 Ga0207641_10087769 3300026088 Bacteria 2714
277 Ga0207648_10000478 3300026089 Bacteria 44666
278 Ga0207648_10026883 3300026089 Bacteria 5110
279 Ga0207648_10774729 3300026089 Bacteria 892
280 Ga0207676_10303531 3300026095 Bacteria 1458
281 Ga0207676_10393651 3300026095 Bacteria 1293
282 Ga0207674_10019242 3300026116 Bacteria 7402
283 Ga0207674_10220559 3300026116 Bacteria 1844
284 Ga0207675_100004021 3300026118 Bacteria 14264
285 Ga0207675_100012176 3300026118 Bacteria 8036
286 Ga0207675_100258370 3300026118 Bacteria 1687
287 Ga0207428_10002496 3300027907 Bacteria 18377
288 Ga0268266_10051521 3300028379 Bacteria 3533
289 Ga0268265_10000663 3300028380 Bacteria 34113
290 Ga0268265_10705307 3300028380 Bacteria 975
291 Ga0268264_10119900 3300028381 Bacteria 2317
292 Ga0268264_10223392 3300028381 Bacteria 1735
293 Ga0268264_10316100 3300028381 Bacteria 1475
294 Ga0265327_10001348 3300031251 Bacteria 31829
295 Ga0307416_100224906 3300032002 Bacteria 1803
296 Ga0307416_102419956 3300032002 Bacteria 624
297 Ga0307414_10391366 3300032004 Bacteria 1205
298 Ga0307411_10670167 3300032005 Bacteria 900
299 Ga0307411_11734952 3300032005 Bacteria 578
300 Ga0373950_0007938 3300034818 Bacteria 1659
301 Ga0373958_0005339 3300034819 Bacteria 1948
302 Ga0373959_0019800 3300034820 Bacteria 1278
303 Ga0373938_0000816 3300034957 Bacteria 5038
304 Ga0373938_0053307 3300034957 Bacteria 929
305 Ga0373928_0006059 3300035084 Bacteria 2318
306 Ga0373940_0001081 3300035088 Bacteria 4726
307 Ga0373951_0008033 3300035091 Bacteria 2391
308 Ga0373952_0003985 3300035092 Bacteria 2669
309 Ga0373952_0129704 3300035092 Bacteria 691
310 Ga0373932_0004883 3300035112 Bacteria 3159
311 Ga0373939_0000681 3300035114 Bacteria 8439
312 Ga0373941_0068061 3300035115 Bacteria 1175
313 Ga0373941_0216472 3300035115 Bacteria 734
314 Ga0373954_0229018 3300035118 Bacteria 915
315 Ga0373957_0086566 3300035120 Bacteria 1241
316 Ga0373942_0032879 3300035207 Bacteria 1380
317 Ga0373961_0041150 3300035241 Bacteria 1334
318 Ga0373962_0091928 3300035242 Bacteria 936
319 Ga0373931_0000170 3300035691 Bacteria 28307
320 Ga0373931_0104406 3300035691 Bacteria 1598
321 Ga0373947_0178006 3300035725 Bacteria 1383
322 Ga0373937_1205999 3300036401 Bacteria 705
323 Ga0436363_1534927 3300039450 Bacteria 2655
324 Ga0436362_0177314 3300039453 Bacteria 1111
325 Ga0439451_001026 3300042009 Bacteria 5424
326 Ga0453683_0627207 3300044673 Bacteria 702
327 Ga0453684_0701353 3300044712 Bacteria 1100
328 Ga0451576_0038444 3300045051 Bacteria 5064
329 Ga0451576_0058364 3300045051 Bacteria 4033
330 Ga0451576_0254220 3300045051 Bacteria 1836
331 Ga0451576_0270486 3300045051 Bacteria 1776
332 Ga0495603_0015968 3300046455 Bacteria 4539
333 Ga0495603_0060284 3300046455 Bacteria 2242
334 Ga0495590_0057799 3300046457 Bacteria 1356
335 Ga0495629_0031832 3300046459 Bacteria 3734
336 Ga0495580_0148928 3300046472 Bacteria 1621
337 Ga0495580_0217315 3300046472 Bacteria 1314
338 Ga0495580_0289221 3300046472 Bacteria 1117
339 Ga0495582_0498667 3300046473 Bacteria 704
340 Ga0495639_0424098 3300046475 Bacteria 674
341 Ga0495584_0059057 3300046491 Bacteria 1929
342 Ga0495584_0095209 3300046491 Bacteria 1503
343 Ga0495643_0079454 3300046522 Bacteria 1710
344 Ga0495642_0051221 3300046528 Bacteria 1698
345 Ga0495609_0159434 3300046538 Bacteria 957
346 Ga0495609_0221171 3300046538 Bacteria 786
347 Ga0495621_0005467 3300046539 Bacteria 3654
348 Ga0495621_0012229 3300046539 Bacteria 2673
349 Ga0495645_0076497 3300046543 Bacteria 2408
350 Ga0495633_0195687 3300046558 Bacteria 929
351 Ga0495656_0161738 3300046615 Bacteria 1089
352 Ga0495634_0058979 3300046642 Bacteria 2558
353 Ga0495659_0001497 3300046664 Bacteria 7922
354 Ga0495659_0023867 3300046664 Bacteria 2081
355 Ga0495659_0026868 3300046664 Bacteria 1981
356 Ga0495659_0076756 3300046664 Bacteria 1261
357 Ga0495659_0442948 3300046664 Bacteria 564
358 Ga0495588_0091975 3300046674 Bacteria 1589
359 Ga0495658_0103592 3300046683 Bacteria 1702
360 Ga0495669_0199017 3300046684 Bacteria 957
361 Ga0495669_0253579 3300046684 Bacteria 845
362 Ga0495670_0260889 3300046691 Bacteria 925
363 Ga0495581_0310292 3300047315 Bacteria 922
364 Ga0495636_0007424 3300047318 Bacteria 4314
365 Ga0495677_0145176 3300047445 Bacteria 912
366 Ga0495677_0299146 3300047445 Bacteria 633
367 Ga0495686_0234657 3300047472 Bacteria 1037
368 Ga0495593_0251229 3300047673 Bacteria 885
369 Ga0496100_0010677 3300048903 Bacteria 5206
370 Ga0496101_0000546 3300048904 Bacteria 23085
371 Ga0496102_0006792 3300048905 Bacteria 9767
372 Ga0496103_0016394 3300048906 Bacteria 4420
373 Ga0496104_0043918 3300048907 Bacteria 4199
374 Ga0496104_0191799 3300048907 Bacteria 1955
375 Ga0496105_0310814 3300048908 Bacteria 1265
376 Ga0496105_0440937 3300048908 Bacteria 1029
377 Ga0496106_0000596 3300048909 Bacteria 25827
378 Ga0496106_0394823 3300048909 Bacteria 1112
379 Ga0496107_0129506 3300048910 Bacteria 1862
380 Ga0496108_0041958 3300048911 Bacteria 3819
381 Ga0496108_0121962 3300048911 Bacteria 2236
382 Ga0496108_1064379 3300048911 Bacteria 689
383 Ga0496109_0002259 3300048912 Bacteria 16010
384 Ga0496109_0088621 3300048912 Bacteria 2860
385 Ga0496109_0199609 3300048912 Bacteria 1880
386 Ga0496109_0844921 3300048912 Bacteria 853
387 Ga0496109_0862581 3300048912 Bacteria 843
388 Ga0496110_0008126 3300048913 Bacteria 8429
389 Ga0496111_0273236 3300048914 Bacteria 1254
390 Ga0496112_0007166 3300048915 Bacteria 9874
391 Ga0496112_0709764 3300048915 Bacteria 933
392 Ga0496113_0009607 3300048916 Bacteria 6350
393 Ga0496113_0033583 3300048916 Bacteria 3737
394 Ga0496115_0006165 3300048918 Bacteria 8769
395 Ga0496115_0770872 3300048918 Bacteria 751
396 Ga0496126_0029013 3300048929 Bacteria 5261
397 Ga0501033_0171294 3300049570 Bacteria 1559
398 Ga0501036_0195636 3300049572 Bacteria 1701
399 Ga0501038_0030226 3300049574 Bacteria 4796
400 Ga0501039_0357533 3300049575 Bacteria 1147
401 Ga0501040_0056512 3300049576 Bacteria 2693
402 Ga0501041_0002992 3300049577 Bacteria 9693
403 Ga0501046_0014724 3300049580 Bacteria 6584
404 Ga0501048_0013071 3300049582 Bacteria 6164
405 Ga0501069_0156544 3300049585 Bacteria 1311
406 Ga0501071_0019546 3300049587 Bacteria 4700
407 Ga0501072_0019303 3300049588 Bacteria 5267
408 Ga0501073_0012945 3300049589 Bacteria 6082
409 Ga0501073_0546020 3300049589 Bacteria 801
410 Ga0501076_0006502 3300049592 Bacteria 8479
411 Ga0501079_0082501 3300049741 Unclassified 2486
412 Ga0501081_0004794 3300049743 Bacteria 8696
413 Ga0501045_0003391 3300049824 Bacteria 10908
414 nmdc:mga06z11_90949_c1 3300050494 Bacteria 1656
415 nmdc:mga07m45_551677_c1 3300050496 Bacteria 666
416 nmdc:mga05p37_14640_c1 3300050507 Bacteria 9423
417 nmdc:mga05p37_1818177_c1 3300050507 Bacteria 587
418 nmdc:mga05p37_78681_c1 3300050507 Bacteria 4060
419 nmdc:mga09592_1228921_c1 3300050508 Bacteria 618
420 nmdc:mga09592_190304_c1 3300050508 Bacteria 1776
421 nmdc:mga09592_280310_c1 3300050508 Bacteria 1446
422 nmdc:mga08y16_10222_c1 3300050511 Bacteria 9850
423 nmdc:mga08y16_388460_c1 3300050511 Bacteria 1430
424 nmdc:mga08y16_508_c1 3300050511 Bacteria 35851
425 nmdc:mga0n895_116213_c1 3300050512 Bacteria 2694
426 nmdc:mga0n895_1289347_c1 3300050512 Bacteria 702
427 nmdc:mga0n895_270757_c1 3300050512 Bacteria 1723
428 nmdc:mga0n895_397106_c1 3300050512 Bacteria 1395
429 nmdc:mga0n895_967153_c1 3300050512 Bacteria 834
430 nmdc:mga0n895_977339_c1 3300050512 Bacteria 829
431 nmdc:mga0rr50_10458_c1 3300050513 Bacteria 5888
432 nmdc:mga0rr50_137111_c1 3300050513 Bacteria 1965
433 nmdc:mga0rr50_882332_c1 3300050513 Unclassified 763
434 nmdc:mga0rr50_906133_c1 3300050513 Bacteria 752
435 nmdc:mga0rr50_91710_c1 3300050513 Bacteria 2367
436 nmdc:mga0rr50_986065_c1 3300050513 Bacteria 718
437 nmdc:mga08x19_190226_c1 3300050514 Bacteria 1404
438 nmdc:mga08x19_74962_c1 3300050514 Bacteria 2211
439 nmdc:mga0a205_259705_c1 3300050515 Bacteria 1615
440 nmdc:mga0a205_277633_c1 3300050515 Bacteria 1551
441 nmdc:mga0a205_66654_c1 3300050515 Bacteria 3478
442 nmdc:mga0a205_91717_c1 3300050515 Bacteria 2936
443 nmdc:mga0a205_964121_c1 3300050515 Bacteria 700
444 Ga0501084_0195983 3300054114 Bacteria 1704
445 Ga0590075_066432 3300059424 Bacteria 931
446 Ga0501082_0156847 3300060353 Unclassified 1977
447 Ga0530510_0023863 3300061734 Bacteria 4361
448 Ga0495640_0260036
449 SwRhRL2b_contig_1393997
450 JGI24752J21851_1004716
451 JGI24737J22298_10076745
452 JGI24744J21845_10052940
453 JGI25406J46586_10168623
454 Ga0065712_10270633
455 Ga0065715_10114731
456 Ga0065715_10141316
457 Ga0065707_10010826
458 Ga0065707_10128991
459 Ga0065707_10355727
460 Ga0070658_10423127
461 Ga0070676_10479265
462 Ga0070683_100059051
463 Ga0070683_100253424
464 Ga0070670_100416348
465 Ga0070670_100893551
466 Ga0068869_100041033
467 Ga0068869_101608942
468 Ga0070666_10832256
469 Ga0068868_101186891
470 Ga0070660_100059906
471 Ga0070689_100222729
472 Ga0070689_100461284
473 Ga0070691_10273349
474 Ga0070687_100016115
475 Ga0070661_100036153
476 Ga0070661_100382385
477 Ga0070692_10011304
478 Ga0070668_100050023
479 Ga0070669_100001922
480 Ga0070675_100004471
481 Ga0070675_100052547
482 Ga0070675_100605539
483 Ga0070671_100003498
484 Ga0070671_100051616
485 Ga0070674_100217843
486 Ga0070673_100104583
487 Ga0070673_100176587
488 Ga0070673_100254579
489 Ga0070688_100228332
490 Ga0070659_100774400
491 Ga0070667_100224371
492 Ga0070667_100244394
493 Ga0070667_101937937
494 Ga0070709_10004951
495 Ga0070714_100155734
496 Ga0070714_100314308
497 Ga0070713_100036892
498 Ga0070713_100079446
499 Ga0070710_10005020
500 Ga0070701_10047907
501 Ga0070701_10156792
502 Ga0070701_10552399
503 Ga0070711_100014869
504 Ga0070705_100000156
505 Ga0070705_100112916
506 Ga0070705_100654164
507 Ga0070700_100016170
508 Ga0070700_100246832
509 Ga0070700_100543176
510 Ga0070694_100001976
511 Ga0070694_100003874
512 Ga0070708_100020950
513 Ga0070708_100481592
514 Ga0070663_100418712
515 Ga0068867_100000572
516 Ga0068867_100073707
517 Ga0068867_101070343
518 Ga0070685_10148023
519 Ga0070706_100416348
520 Ga0070707_100015917
521 Ga0070707_100226433
522 Ga0070707_101206602
523 Ga0070698_100004020
524 Ga0070698_100015387
525 Ga0070698_100068435
526 Ga0070698_100113692
527 Ga0070699_100019800
528 Ga0070699_100035616
529 Ga0070699_100166060
530 Ga0070699_101061031
531 Ga0070679_100638139
532 Ga0070679_101050052
533 Ga0070697_100024631
534 Ga0070672_100158860
535 Ga0070672_100210059
536 Ga0070686_100093109
537 Ga0070686_100500322
538 Ga0070695_100000148
539 Ga0070695_100338446
540 Ga0070695_100627931
541 Ga0070696_100000066
542 Ga0070696_100144217
543 Ga0070693_100075742
544 Ga0070704_100002911
545 Ga0070704_100540769
546 Ga0068855_100620271
547 Ga0070664_100059485
548 Ga0070664_100115074
549 Ga0070664_100496547
550 Ga0070664_101311103
551 Ga0068857_100015360
552 Ga0068857_100027198
553 Ga0068854_100008268
554 Ga0068854_100561507
555 Ga0068856_100378643
556 Ga0070702_100005452
557 Ga0070702_100041597
558 Ga0068852_100135239
559 Ga0068859_100003300
560 Ga0068859_100748156
561 Ga0068864_100036192
562 Ga0068864_100152053
563 Ga0068864_100280846
564 Ga0068861_100001761
565 Ga0068870_10005966
566 Ga0068870_10063696
567 Ga0068863_100135931
568 Ga0068863_100335743
569 Ga0068858_100090879
570 Ga0068860_100075243
571 Ga0068860_100201769
572 Ga0068860_100285541
573 Ga0068860_100331830
574 Ga0068862_100000265
575 Ga0068862_100009897
576 Ga0068862_100185850
577 Ga0081455_10004017
578 Ga0081455_10018603
579 Ga0081538_10049575
580 Ga0081539_10002098
581 Ga0070717_10033280
582 Ga0070717_10220526
583 Ga0070717_10699583
584 Ga0070716_100004911
585 Ga0070712_100058107
586 Ga0097621_100285626
587 Ga0068871_100001004
588 Ga0068871_100021395
589 Ga0068871_101159440
590 Ga0075428_100007068
591 Ga0075428_100586770
592 Ga0075428_100924758
593 Ga0075433_10075489
594 Ga0075433_10273270
595 Ga0075433_10456649
596 Ga0075434_100004212
597 Ga0075434_100080270
598 Ga0075434_100333210
599 Ga0075434_100563402
600 Ga0075429_100331057
601 Ga0075429_100363679
602 Ga0075429_101005931
603 Ga0075436_100216121
604 Ga0075436_100283755
605 Ga0097620_100003300
606 Ga0097620_100748196
607 Ga0075435_100002240
608 Ga0075435_100060268
609 Ga0075435_100094689
610 Ga0075435_100985342
611 Ga0105250_10153357
612 Ga0111539_10214587
613 Ga0111539_10276055
614 Ga0111539_11538544
615 Ga0105247_10368203
616 Ga0114129_10001655
617 Ga0114129_10076020
618 Ga0114129_10204761
619 Ga0114129_10700267
620 Ga0105243_10032900
621 Ga0105243_10091526
622 Ga0105243_10346594
623 Ga0105243_10528391
624 Ga0105242_10867651
625 Ga0105248_10028907
626 Ga0105248_10929039
627 Ga0105249_10004215
628 Ga0105249_10786634
629 Ga0099796_10359578
630 Ga0105246_10172147
631 Ga0157324_1015884
632 Ga0157326_1077215
633 Ga0157371_10186532
634 Ga0157369_10222055
635 Ga0157374_10263755
636 Ga0157374_11348598
637 Ga0163162_10111762
638 Ga0157372_10439131
639 Ga0157372_11917047
640 Ga0157375_10041665
641 Ga0157375_10250140
642 Ga0157375_11172841
643 Ga0157380_10210660
644 Ga0157379_10109887
645 Ga0157376_11598163
646 Ga0163161_10351384
647 Ga0163161_10509648
648 Ga0213874_10061379
649 Ga0213876_10216829
650 Ga0207656_10028224
651 Ga0207656_10298429
652 Ga0207653_10392767
653 Ga0207692_10048037
654 Ga0207642_10067244
655 Ga0207710_10222268
656 Ga0207688_10000217
657 Ga0207647_10211659
658 Ga0207645_10014631
659 Ga0207645_10301436
660 Ga0207643_10005624
661 Ga0207643_10106247
662 Ga0207643_10408277
663 Ga0207684_10165828
664 Ga0207684_10279174
665 Ga0207707_11152453
666 Ga0207693_10193025
667 Ga0207693_10382305
668 Ga0207663_10163342
669 Ga0207662_10026697
670 Ga0207662_10027283
671 Ga0207657_10008557
672 Ga0207649_10429581
673 Ga0207652_10301922
674 Ga0207646_10108857
675 Ga0207646_10974235
676 Ga0207681_10001144
677 Ga0207681_10049189
678 Ga0207659_10006934
679 Ga0207659_10101686
680 Ga0207659_10416875
681 Ga0207659_10892570
682 Ga0207700_10027553
683 Ga0207700_10054618
684 Ga0207700_10153287
685 Ga0207664_10146883
686 Ga0207664_10176274
687 Ga0207664_10504641
688 Ga0207664_10679528
689 Ga0207644_10014821
690 Ga0207644_10225405
691 Ga0207686_10649227
692 Ga0207709_10028681
693 Ga0207709_10127355
694 Ga0207709_10252356
695 Ga0207670_10058256
696 Ga0207669_10083771
697 Ga0207665_10016034
698 Ga0207691_10041662
699 Ga0207691_10098186
700 Ga0207691_10120061
701 Ga0207711_10019333
702 Ga0207689_10005222
703 Ga0207689_10022474
704 Ga0207661_10240774
705 Ga0207661_10541039
706 Ga0207679_10134850
707 Ga0207679_10159319
708 Ga0207679_10459239
709 Ga0207679_11523002
710 Ga0207651_10112025
711 Ga0207651_10630207
712 Ga0207712_10192520
713 Ga0207668_10045801
714 Ga0207668_10068916
715 Ga0207640_10005858
716 Ga0207658_11131550
717 Ga0207677_11122502
718 Ga0207678_10249580
719 Ga0207708_10028455
720 Ga0207708_10153736
721 Ga0207702_10483325
722 Ga0207641_10025334
723 Ga0207641_10087769
724 Ga0207648_10000478
725 Ga0207648_10026883
726 Ga0207648_10774729
727 Ga0207676_10303531
728 Ga0207676_10393651
729 Ga0207674_10019242
730 Ga0207674_10220559
731 Ga0207675_100004021
732 Ga0207675_100012176
733 Ga0207675_100258370
734 Ga0207428_10002496
735 Ga0268266_10051521
736 Ga0268265_10000663
737 Ga0268265_10705307
738 Ga0268264_10119900
739 Ga0268264_10223392
740 Ga0268264_10316100
741 Ga0265327_10001348
742 Ga0307416_100224906
743 Ga0307416_102419956
744 Ga0307414_10391366
745 Ga0307411_10670167
746 Ga0307411_11734952
747 Ga0373950_0007938
748 Ga0373958_0005339
749 Ga0373959_0019800
750 Ga0373938_0000816
751 Ga0373938_0053307
752 Ga0373928_0006059
753 Ga0373940_0001081
754 Ga0373951_0008033
755 Ga0373952_0003985
756 Ga0373952_0129704
757 Ga0373932_0004883
758 Ga0373939_0000681
759 Ga0373941_0068061
760 Ga0373941_0216472
761 Ga0373954_0229018
762 Ga0373957_0086566
763 Ga0373942_0032879
764 Ga0373961_0041150
765 Ga0373962_0091928
766 Ga0373931_0000170
767 Ga0373931_0104406
768 Ga0373947_0178006
769 Ga0373937_1205999
770 Ga0436363_1534927
771 Ga0436362_0177314
772 Ga0439451_001026
773 Ga0453683_0627207
774 Ga0453684_0701353
775 Ga0451576_0038444
776 Ga0451576_0058364
777 Ga0451576_0254220
778 Ga0451576_0270486
779 Ga0495603_0015968
780 Ga0495603_0060284
781 Ga0495590_0057799
782 Ga0495629_0031832
783 Ga0495580_0148928
784 Ga0495580_0217315
785 Ga0495580_0289221
786 Ga0495582_0498667
787 Ga0495639_0424098
788 Ga0495584_0059057
789 Ga0495584_0095209
790 Ga0495643_0079454
791 Ga0495642_0051221
792 Ga0495609_0159434
793 Ga0495609_0221171
794 Ga0495621_0005467
795 Ga0495621_0012229
796 Ga0495645_0076497
797 Ga0495633_0195687
798 Ga0495656_0161738
799 Ga0495634_0058979
800 Ga0495659_0001497
801 Ga0495659_0023867
802 Ga0495659_0026868
803 Ga0495659_0076756
804 Ga0495659_0442948
805 Ga0495588_0091975
806 Ga0495658_0103592
807 Ga0495669_0199017
808 Ga0495669_0253579
809 Ga0495670_0260889
810 Ga0495581_0310292
811 Ga0495636_0007424
812 Ga0495677_0145176
813 Ga0495677_0299146
814 Ga0495686_0234657
815 Ga0495593_0251229
816 Ga0496100_0010677
817 Ga0496101_0000546
818 Ga0496102_0006792
819 Ga0496103_0016394
820 Ga0496104_0043918
821 Ga0496104_0191799
822 Ga0496105_0310814
823 Ga0496105_0440937
824 Ga0496106_0000596
825 Ga0496106_0394823
826 Ga0496107_0129506
827 Ga0496108_0041958
828 Ga0496108_0121962
829 Ga0496108_1064379
830 Ga0496109_0002259
831 Ga0496109_0088621
832 Ga0496109_0199609
833 Ga0496109_0844921
834 Ga0496109_0862581
835 Ga0496110_0008126
836 Ga0496111_0273236
837 Ga0496112_0007166
838 Ga0496112_0709764
839 Ga0496113_0009607
840 Ga0496113_0033583
841 Ga0496115_0006165
842 Ga0496115_0770872
843 Ga0496126_0029013
844 Ga0501033_0171294
845 Ga0501036_0195636
846 Ga0501038_0030226
847 Ga0501039_0357533
848 Ga0501040_0056512
849 Ga0501041_0002992
850 Ga0501046_0014724
851 Ga0501048_0013071
852 Ga0501069_0156544
853 Ga0501071_0019546
854 Ga0501072_0019303
855 Ga0501073_0012945
856 Ga0501073_0546020
857 Ga0501076_0006502
858 Ga0501079_0082501
859 Ga0501081_0004794
860 Ga0501045_0003391
861 nmdc:mga06z11_90949_c1
862 nmdc:mga07m45_551677_c1
863 nmdc:mga05p37_14640_c1
864 nmdc:mga05p37_1818177_c1
865 nmdc:mga05p37_78681_c1
866 nmdc:mga09592_1228921_c1
867 nmdc:mga09592_190304_c1
868 nmdc:mga09592_280310_c1
869 nmdc:mga08y16_10222_c1
870 nmdc:mga08y16_388460_c1
871 nmdc:mga08y16_508_c1
872 nmdc:mga0n895_116213_c1
873 nmdc:mga0n895_1289347_c1
874 nmdc:mga0n895_270757_c1
875 nmdc:mga0n895_397106_c1
876 nmdc:mga0n895_967153_c1
877 nmdc:mga0n895_977339_c1
878 nmdc:mga0rr50_10458_c1
879 nmdc:mga0rr50_137111_c1
880 nmdc:mga0rr50_882332_c1
881 nmdc:mga0rr50_906133_c1
882 nmdc:mga0rr50_91710_c1
883 nmdc:mga0rr50_986065_c1
884 nmdc:mga08x19_190226_c1
885 nmdc:mga08x19_74962_c1
886 nmdc:mga0a205_259705_c1
887 nmdc:mga0a205_277633_c1
888 nmdc:mga0a205_66654_c1
889 nmdc:mga0a205_91717_c1
890 nmdc:mga0a205_964121_c1
891 Ga0501084_0195983
892 Ga0590075_066432
893 Ga0501082_0156847
894 Ga0530510_0023863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

97

170

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9306 2 153
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9296 3 156
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9269 3 155
7dqx-assembly1.cif.gz_F crystal structure of xanthine dehydrogenase family protein 0.9206 1 150
5y6q-assembly1.cif.gz_A crystal structure of an aldehyde oxidase from methylobacillus sp. ky4400 0.9185 1 156
ID Description Score Start End Superfamily
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9456 79 154 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9335 79 153 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9258 80 155 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9184 80 153 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9135 1 77 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7Y0JE65-F1-model_v4 (2Fe-2S)-binding protein 0.9479 3 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A7K3LJ11-F1-model_v4 (2Fe-2S)-binding protein 0.9476 1 155 GO:0016491
GO:0046872
GO:0051537
AF-A0A345XY93-F1-model_v4 (2Fe-2S)-binding protein 0.9468 3 156 GO:0016491
GO:0046872
GO:0051537
AF-A0A7W0KIL1-F1-model_v4 (2Fe-2S)-binding protein 0.9467 1 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A2E9AEI4-F1-model_v4 (2Fe-2S)-binding protein 0.9459 2 155 GO:0016491
GO:0046872
GO:0051537

Map