F445971
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 447 | 272 | 447 | 127 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10421404|Ga0207708_104214042 |
| Length | 125 |
| Sequence | MHHSRLSTFVIDCNVEDLATAAEFWGKVFGRSVTQTDDDPNYRALVGGDGPSLVVQKVEHESRVHLDIECDDLEAEVARLEKLGAKRVRFHKRWWLMQAPTGHAFCVVNRQRPVGGRPGANEWPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 3 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 4 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 5 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 73 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 97 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 148 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 167 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 168 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 173 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 193 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 194 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 195 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 196 | 3300044661 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E | Metagenome | Unclassified |
| 197 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 198 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 223 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 224 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 225 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 226 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 231 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 232 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 233 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 236 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 237 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 260 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 261 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 262 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 264 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 265 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 266 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 267 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 269 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 272 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.61 |
| Nodule | 0 |
| Rhizoplane | 5.15 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_988365 | 2162886012 | Unclassified | 953 |
| 2 | Ga0055533_1010308 | 3300003756 | Bacteria | 1066 |
| 3 | Ga0055527_1000037 | 3300003760 | Bacteria | 124590 |
| 4 | Ga0055527_1003838 | 3300003760 | Bacteria | 2155 |
| 5 | Ga0055535_1000059 | 3300003761 | Bacteria | 124595 |
| 6 | Ga0055535_1000211 | 3300003761 | Bacteria | 61694 |
| 7 | Ga0055542_1000086 | 3300003762 | Bacteria | 124594 |
| 8 | Ga0055542_1000117 | 3300003762 | Bacteria | 105560 |
| 9 | Ga0055529_1000212 | 3300003763 | Bacteria | 76463 |
| 10 | Ga0068869_100567456 | 3300005334 | Bacteria | 955 |
| 11 | Ga0070680_100126212 | 3300005336 | Bacteria | 2138 |
| 12 | Ga0070680_100320172 | 3300005336 | Bacteria | 1316 |
| 13 | Ga0068868_100097292 | 3300005338 | Bacteria | 2378 |
| 14 | Ga0070660_100742050 | 3300005339 | Bacteria | 824 |
| 15 | Ga0070689_101372433 | 3300005340 | Bacteria | 638 |
| 16 | Ga0070687_100438221 | 3300005343 | Unclassified | 866 |
| 17 | Ga0070668_101294955 | 3300005347 | Unclassified | 662 |
| 18 | Ga0070671_100302698 | 3300005355 | Bacteria | 1361 |
| 19 | Ga0070671_101826372 | 3300005355 | Bacteria | 540 |
| 20 | Ga0070674_101021986 | 3300005356 | Bacteria | 726 |
| 21 | Ga0070674_101955405 | 3300005356 | Unclassified | 533 |
| 22 | Ga0070673_100057655 | 3300005364 | Bacteria | 3069 |
| 23 | Ga0070688_100665728 | 3300005365 | Unclassified | 803 |
| 24 | Ga0070659_100265649 | 3300005366 | Bacteria | 1424 |
| 25 | Ga0070659_101399164 | 3300005366 | Bacteria | 622 |
| 26 | Ga0070709_10640450 | 3300005434 | Bacteria | 822 |
| 27 | Ga0070709_11164117 | 3300005434 | Bacteria | 619 |
| 28 | Ga0070714_100207834 | 3300005435 | Bacteria | 1793 |
| 29 | Ga0070714_100256697 | 3300005435 | Bacteria | 1618 |
| 30 | Ga0070714_101426320 | 3300005435 | Bacteria | 676 |
| 31 | Ga0070714_101750654 | 3300005435 | Bacteria | 607 |
| 32 | Ga0070713_100044282 | 3300005436 | Bacteria | 3642 |
| 33 | Ga0070713_100144848 | 3300005436 | Bacteria | 2108 |
| 34 | Ga0070713_101041208 | 3300005436 | Bacteria | 790 |
| 35 | Ga0070713_101449207 | 3300005436 | Unclassified | 666 |
| 36 | Ga0070710_10079710 | 3300005437 | Bacteria | 1909 |
| 37 | Ga0070710_10107638 | 3300005437 | Bacteria | 1670 |
| 38 | Ga0070710_10181445 | 3300005437 | Bacteria | 1318 |
| 39 | Ga0070710_10189462 | 3300005437 | Bacteria | 1292 |
| 40 | Ga0070711_100750849 | 3300005439 | Bacteria | 824 |
| 41 | Ga0070705_100339477 | 3300005440 | Bacteria | 1091 |
| 42 | Ga0070705_101440542 | 3300005440 | Bacteria | 575 |
| 43 | Ga0070700_100047967 | 3300005441 | Bacteria | 2645 |
| 44 | Ga0070694_100011261 | 3300005444 | Bacteria | 5537 |
| 45 | Ga0070708_100078097 | 3300005445 | Bacteria | 2992 |
| 46 | Ga0070708_101473761 | 3300005445 | Unclassified | 634 |
| 47 | Ga0070678_100898347 | 3300005456 | Bacteria | 810 |
| 48 | Ga0070678_101775321 | 3300005456 | Bacteria | 581 |
| 49 | Ga0070662_101004833 | 3300005457 | Bacteria | 714 |
| 50 | Ga0070681_10044671 | 3300005458 | Bacteria | 4435 |
| 51 | Ga0070681_10164501 | 3300005458 | Bacteria | 2141 |
| 52 | Ga0070681_10608393 | 3300005458 | Bacteria | 1007 |
| 53 | Ga0070706_100557803 | 3300005467 | Bacteria | 1065 |
| 54 | Ga0070707_100704664 | 3300005468 | Bacteria | 972 |
| 55 | Ga0070707_102262117 | 3300005468 | Bacteria | 511 |
| 56 | Ga0070698_100445108 | 3300005471 | Bacteria | 1231 |
| 57 | Ga0070698_100449407 | 3300005471 | Bacteria | 1224 |
| 58 | Ga0070699_100642356 | 3300005518 | Bacteria | 968 |
| 59 | Ga0070699_101469453 | 3300005518 | Bacteria | 625 |
| 60 | Ga0070679_100007825 | 3300005530 | Bacteria | 10021 |
| 61 | Ga0070679_100083013 | 3300005530 | Bacteria | 3193 |
| 62 | Ga0070679_100340045 | 3300005530 | Bacteria | 1449 |
| 63 | Ga0070684_101808289 | 3300005535 | Bacteria | 576 |
| 64 | Ga0070697_100497943 | 3300005536 | Bacteria | 1065 |
| 65 | Ga0070697_101317980 | 3300005536 | Bacteria | 644 |
| 66 | Ga0070697_101369978 | 3300005536 | Unclassified | 631 |
| 67 | Ga0070686_101745994 | 3300005544 | Bacteria | 529 |
| 68 | Ga0070695_100007484 | 3300005545 | Bacteria | 6468 |
| 69 | Ga0070695_100201651 | 3300005545 | Bacteria | 1422 |
| 70 | Ga0070693_100326429 | 3300005547 | Bacteria | 1043 |
| 71 | Ga0070665_100001987 | 3300005548 | Bacteria | 23014 |
| 72 | Ga0070665_100281036 | 3300005548 | Bacteria | 1666 |
| 73 | Ga0070665_102601914 | 3300005548 | Unclassified | 507 |
| 74 | Ga0070704_100225701 | 3300005549 | Unclassified | 1525 |
| 75 | Ga0068855_100155403 | 3300005563 | Bacteria | 2599 |
| 76 | Ga0068855_100299237 | 3300005563 | Bacteria | 1782 |
| 77 | Ga0068855_100672615 | 3300005563 | Bacteria | 1110 |
| 78 | Ga0070664_101399843 | 3300005564 | Bacteria | 661 |
| 79 | Ga0068857_100674431 | 3300005577 | Bacteria | 981 |
| 80 | Ga0068856_100028366 | 3300005614 | Bacteria | 5465 |
| 81 | Ga0068856_100123907 | 3300005614 | Bacteria | 2587 |
| 82 | Ga0068856_100186604 | 3300005614 | Bacteria | 2087 |
| 83 | Ga0070702_100846906 | 3300005615 | Bacteria | 711 |
| 84 | Ga0068852_100521007 | 3300005616 | Bacteria | 1186 |
| 85 | Ga0068859_101162048 | 3300005617 | Bacteria | 850 |
| 86 | Ga0068866_10265228 | 3300005718 | Unclassified | 1057 |
| 87 | Ga0068861_100027380 | 3300005719 | Unclassified | 4151 |
| 88 | Ga0068861_100071036 | 3300005719 | Bacteria | 2697 |
| 89 | Ga0068861_101776835 | 3300005719 | Bacteria | 611 |
| 90 | Ga0068863_100021185 | 3300005841 | Bacteria | 6205 |
| 91 | Ga0068863_100108348 | 3300005841 | Bacteria | 2644 |
| 92 | Ga0068863_100994301 | 3300005841 | Unclassified | 841 |
| 93 | Ga0068862_100125299 | 3300005844 | Bacteria | 2268 |
| 94 | Ga0068862_102342868 | 3300005844 | Unclassified | 546 |
| 95 | Ga0081455_10005657 | 3300005937 | Bacteria | 13644 |
| 96 | Ga0081455_10321502 | 3300005937 | Bacteria | 1102 |
| 97 | Ga0081538_10020752 | 3300005981 | Bacteria | 4823 |
| 98 | Ga0081540_1000224 | 3300005983 | Bacteria | 59493 |
| 99 | Ga0081540_1002501 | 3300005983 | Bacteria | 14947 |
| 100 | Ga0070717_10054997 | 3300006028 | Bacteria | 3283 |
| 101 | Ga0070717_10500968 | 3300006028 | Bacteria | 1098 |
| 102 | Ga0075368_10558528 | 3300006042 | Bacteria | 515 |
| 103 | Ga0070715_10039165 | 3300006163 | Bacteria | 1973 |
| 104 | Ga0070716_100012569 | 3300006173 | Bacteria | 4294 |
| 105 | Ga0070716_100091702 | 3300006173 | Bacteria | 1840 |
| 106 | Ga0070716_101465078 | 3300006173 | Bacteria | 557 |
| 107 | Ga0070712_100027017 | 3300006175 | Bacteria | 3829 |
| 108 | Ga0070712_100073786 | 3300006175 | Bacteria | 2448 |
| 109 | Ga0070712_100216506 | 3300006175 | Bacteria | 1513 |
| 110 | Ga0070712_100375310 | 3300006175 | Bacteria | 1169 |
| 111 | Ga0075367_10600954 | 3300006178 | Unclassified | 699 |
| 112 | Ga0097621_100035913 | 3300006237 | Unclassified | 3961 |
| 113 | Ga0097621_100084235 | 3300006237 | Bacteria | 2650 |
| 114 | Ga0097621_100526944 | 3300006237 | Bacteria | 1073 |
| 115 | Ga0068871_100173035 | 3300006358 | Unclassified | 1852 |
| 116 | Ga0068871_100204978 | 3300006358 | Bacteria | 1704 |
| 117 | Ga0068871_100343531 | 3300006358 | Unclassified | 1318 |
| 118 | Ga0068871_101190011 | 3300006358 | Bacteria | 715 |
| 119 | Ga0075428_100058458 | 3300006844 | Bacteria | 4222 |
| 120 | Ga0075431_101527380 | 3300006847 | Unclassified | 626 |
| 121 | Ga0075433_10194433 | 3300006852 | Unclassified | 1804 |
| 122 | Ga0075433_10829889 | 3300006852 | Bacteria | 807 |
| 123 | Ga0075434_100379385 | 3300006871 | Bacteria | 1434 |
| 124 | Ga0068865_100009997 | 3300006881 | Bacteria | 5897 |
| 125 | Ga0068865_100044894 | 3300006881 | Bacteria | 3027 |
| 126 | Ga0068865_100071760 | 3300006881 | Unclassified | 2457 |
| 127 | Ga0097620_101161839 | 3300006931 | Bacteria | 850 |
| 128 | Ga0075435_100521755 | 3300007076 | Bacteria | 1028 |
| 129 | Ga0075435_101006153 | 3300007076 | Bacteria | 728 |
| 130 | Ga0099794_10017786 | 3300007265 | Bacteria | 3175 |
| 131 | Ga0099794_10082105 | 3300007265 | Bacteria | 1591 |
| 132 | Ga0099794_10085004 | 3300007265 | Bacteria | 1565 |
| 133 | Ga0099794_10493418 | 3300007265 | Bacteria | 644 |
| 134 | Ga0099795_10000383 | 3300007788 | Bacteria | 8014 |
| 135 | Ga0099795_10052309 | 3300007788 | Bacteria | 1491 |
| 136 | Ga0105240_10026148 | 3300009093 | Bacteria | 7659 |
| 137 | Ga0105240_10034070 | 3300009093 | Bacteria | 6573 |
| 138 | Ga0105240_10067118 | 3300009093 | Bacteria | 4447 |
| 139 | Ga0105240_10320647 | 3300009093 | Bacteria | 1766 |
| 140 | Ga0105240_10490491 | 3300009093 | Bacteria | 1368 |
| 141 | Ga0105240_12004035 | 3300009093 | Bacteria | 602 |
| 142 | Ga0111539_10155541 | 3300009094 | Unclassified | 2676 |
| 143 | Ga0105245_10469246 | 3300009098 | Unclassified | 1270 |
| 144 | Ga0105245_10856787 | 3300009098 | Bacteria | 949 |
| 145 | Ga0105247_10086945 | 3300009101 | Bacteria | 1979 |
| 146 | Ga0114129_10051094 | 3300009147 | Bacteria | 5804 |
| 147 | Ga0114129_10086707 | 3300009147 | Bacteria | 4342 |
| 148 | Ga0114129_11265802 | 3300009147 | Bacteria | 916 |
| 149 | Ga0105241_10008916 | 3300009174 | Bacteria | 7374 |
| 150 | Ga0105241_11400248 | 3300009174 | Bacteria | 669 |
| 151 | Ga0105242_10026836 | 3300009176 | Bacteria | 4567 |
| 152 | Ga0105242_10061062 | 3300009176 | Bacteria | 3099 |
| 153 | Ga0105242_10116301 | 3300009176 | Bacteria | 2288 |
| 154 | Ga0105242_11419026 | 3300009176 | Unclassified | 722 |
| 155 | Ga0105237_10131844 | 3300009545 | Bacteria | 2493 |
| 156 | Ga0105237_10156404 | 3300009545 | Bacteria | 2277 |
| 157 | Ga0105237_11095454 | 3300009545 | Bacteria | 803 |
| 158 | Ga0105238_10025022 | 3300009551 | Bacteria | 6086 |
| 159 | Ga0105238_10143285 | 3300009551 | Bacteria | 2366 |
| 160 | Ga0105238_10506068 | 3300009551 | Bacteria | 1209 |
| 161 | Ga0105238_10645731 | 3300009551 | Bacteria | 1068 |
| 162 | Ga0105249_10364634 | 3300009553 | Bacteria | 1467 |
| 163 | Ga0099796_10018428 | 3300010159 | Bacteria | 2096 |
| 164 | Ga0105239_11536766 | 3300010375 | Bacteria | 769 |
| 165 | Ga0105239_12070656 | 3300010375 | Bacteria | 661 |
| 166 | Ga0157370_10786310 | 3300013104 | Bacteria | 866 |
| 167 | Ga0157369_10082617 | 3300013105 | Bacteria | 3437 |
| 168 | Ga0157369_10491230 | 3300013105 | Bacteria | 1270 |
| 169 | Ga0157374_10583821 | 3300013296 | Bacteria | 1127 |
| 170 | Ga0157378_10061824 | 3300013297 | Bacteria | 3343 |
| 171 | Ga0157378_10205687 | 3300013297 | Bacteria | 1864 |
| 172 | Ga0157378_10948074 | 3300013297 | Bacteria | 893 |
| 173 | Ga0163162_10036550 | 3300013306 | Unclassified | 4896 |
| 174 | Ga0163162_12963023 | 3300013306 | Bacteria | 546 |
| 175 | Ga0157372_10122765 | 3300013307 | Bacteria | 2985 |
| 176 | Ga0157372_10308807 | 3300013307 | Bacteria | 1841 |
| 177 | Ga0157375_10509897 | 3300013308 | Bacteria | 1367 |
| 178 | Ga0163163_10849693 | 3300014325 | Bacteria | 976 |
| 179 | Ga0157379_10749075 | 3300014968 | Unclassified | 919 |
| 180 | Ga0157379_10928029 | 3300014968 | Unclassified | 827 |
| 181 | Ga0163161_10361681 | 3300017792 | Unclassified | 1156 |
| 182 | Ga0213871_10065044 | 3300021441 | Bacteria | 1021 |
| 183 | Ga0209674_100134 | 3300025226 | Bacteria | 114123 |
| 184 | Ga0209672_100074 | 3300025228 | Bacteria | 159792 |
| 185 | Ga0209672_100501 | 3300025228 | Bacteria | 21740 |
| 186 | Ga0209147_117440 | 3300025229 | Bacteria | 687 |
| 187 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 188 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 189 | Ga0209258_100229 | 3300025242 | Bacteria | 105671 |
| 190 | Ga0209677_102248 | 3300025253 | Bacteria | 7480 |
| 191 | Ga0209148_1000041 | 3300025254 | Bacteria | 469323 |
| 192 | Ga0209148_1000191 | 3300025254 | Bacteria | 115847 |
| 193 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 194 | Ga0209455_1003840 | 3300025272 | Bacteria | 5136 |
| 195 | Ga0207692_10182552 | 3300025898 | Bacteria | 1223 |
| 196 | Ga0207642_10354330 | 3300025899 | Unclassified | 867 |
| 197 | Ga0207642_10405150 | 3300025899 | Bacteria | 817 |
| 198 | Ga0207680_10295447 | 3300025903 | Bacteria | 1128 |
| 199 | Ga0207685_10062034 | 3300025905 | Bacteria | 1484 |
| 200 | Ga0207699_10836576 | 3300025906 | Bacteria | 677 |
| 201 | Ga0207699_10871682 | 3300025906 | Unclassified | 664 |
| 202 | Ga0207645_10427304 | 3300025907 | Bacteria | 893 |
| 203 | Ga0207684_10003987 | 3300025910 | Bacteria | 14129 |
| 204 | Ga0207684_10765806 | 3300025910 | Bacteria | 817 |
| 205 | Ga0207684_11291900 | 3300025910 | Bacteria | 601 |
| 206 | Ga0207654_11409550 | 3300025911 | Bacteria | 508 |
| 207 | Ga0207707_10067205 | 3300025912 | Unclassified | 3122 |
| 208 | Ga0207707_10245604 | 3300025912 | Bacteria | 1555 |
| 209 | Ga0207707_10534174 | 3300025912 | Unclassified | 998 |
| 210 | Ga0207695_10324493 | 3300025913 | Bacteria | 1429 |
| 211 | Ga0207693_10021536 | 3300025915 | Bacteria | 5121 |
| 212 | Ga0207693_10078359 | 3300025915 | Bacteria | 2587 |
| 213 | Ga0207663_10060723 | 3300025916 | Bacteria | 2396 |
| 214 | Ga0207663_10271265 | 3300025916 | Unclassified | 1257 |
| 215 | Ga0207663_10293868 | 3300025916 | Bacteria | 1211 |
| 216 | Ga0207663_10346350 | 3300025916 | Unclassified | 1124 |
| 217 | Ga0207663_10629496 | 3300025916 | Bacteria | 845 |
| 218 | Ga0207660_10449193 | 3300025917 | Bacteria | 1042 |
| 219 | Ga0207660_10454167 | 3300025917 | Bacteria | 1036 |
| 220 | Ga0207662_10095439 | 3300025918 | Unclassified | 1836 |
| 221 | Ga0207657_10506543 | 3300025919 | Bacteria | 945 |
| 222 | Ga0207652_10029881 | 3300025921 | Bacteria | 4561 |
| 223 | Ga0207652_11204432 | 3300025921 | Bacteria | 659 |
| 224 | Ga0207646_10045143 | 3300025922 | Bacteria | 3956 |
| 225 | Ga0207646_11001937 | 3300025922 | Bacteria | 738 |
| 226 | Ga0207694_10092349 | 3300025924 | Bacteria | 2389 |
| 227 | Ga0207694_10708043 | 3300025924 | Bacteria | 849 |
| 228 | Ga0207694_11084509 | 3300025924 | Bacteria | 678 |
| 229 | Ga0207687_10067596 | 3300025927 | Bacteria | 2543 |
| 230 | Ga0207700_10116854 | 3300025928 | Bacteria | 2156 |
| 231 | Ga0207700_10295103 | 3300025928 | Bacteria | 1398 |
| 232 | Ga0207700_10535462 | 3300025928 | Unclassified | 1038 |
| 233 | Ga0207664_10006280 | 3300025929 | Bacteria | 8166 |
| 234 | Ga0207664_10169035 | 3300025929 | Bacteria | 1870 |
| 235 | Ga0207664_10346956 | 3300025929 | Unclassified | 1313 |
| 236 | Ga0207664_11148064 | 3300025929 | Bacteria | 694 |
| 237 | Ga0207664_11946734 | 3300025929 | Bacteria | 511 |
| 238 | Ga0207644_10250486 | 3300025931 | Bacteria | 1413 |
| 239 | Ga0207686_10065041 | 3300025934 | Bacteria | 2324 |
| 240 | Ga0207686_10071843 | 3300025934 | Bacteria | 2228 |
| 241 | Ga0207686_10109723 | 3300025934 | Bacteria | 1858 |
| 242 | Ga0207670_10479014 | 3300025936 | Bacteria | 1008 |
| 243 | Ga0207704_10021976 | 3300025938 | Bacteria | 3409 |
| 244 | Ga0207704_10383551 | 3300025938 | Bacteria | 1104 |
| 245 | Ga0207704_10387126 | 3300025938 | Bacteria | 1099 |
| 246 | Ga0207665_10017873 | 3300025939 | Bacteria | 4661 |
| 247 | Ga0207665_10040924 | 3300025939 | Bacteria | 3093 |
| 248 | Ga0207711_10447713 | 3300025941 | Bacteria | 1202 |
| 249 | Ga0207689_10343386 | 3300025942 | Bacteria | 1240 |
| 250 | Ga0207689_11194947 | 3300025942 | Bacteria | 640 |
| 251 | Ga0207661_10266220 | 3300025944 | Bacteria | 1528 |
| 252 | Ga0207661_10465105 | 3300025944 | Bacteria | 1153 |
| 253 | Ga0207661_10511913 | 3300025944 | Unclassified | 1097 |
| 254 | Ga0207679_10767807 | 3300025945 | Unclassified | 877 |
| 255 | Ga0207667_10776787 | 3300025949 | Bacteria | 956 |
| 256 | Ga0207712_10324703 | 3300025961 | Bacteria | 1271 |
| 257 | Ga0207712_10715418 | 3300025961 | Unclassified | 875 |
| 258 | Ga0207712_10844579 | 3300025961 | Bacteria | 807 |
| 259 | Ga0207658_10121979 | 3300025986 | Bacteria | 2080 |
| 260 | Ga0207658_10504923 | 3300025986 | Bacteria | 1077 |
| 261 | Ga0207678_10550389 | 3300026067 | Bacteria | 1009 |
| 262 | Ga0207678_11161743 | 3300026067 | Unclassified | 684 |
| 263 | Ga0207708_10039815 | 3300026075 | Bacteria | 3582 |
| 264 | Ga0207708_10421404 | 3300026075 | Bacteria | 1107 |
| 265 | Ga0207702_10007263 | 3300026078 | Bacteria | 9474 |
| 266 | Ga0207702_10655874 | 3300026078 | Bacteria | 1032 |
| 267 | Ga0207641_10053812 | 3300026088 | Bacteria | 3414 |
| 268 | Ga0207641_10304007 | 3300026088 | Bacteria | 1507 |
| 269 | Ga0207676_11270169 | 3300026095 | Bacteria | 731 |
| 270 | Ga0207675_100020365 | 3300026118 | Bacteria | 6183 |
| 271 | Ga0207675_100075487 | 3300026118 | Bacteria | 3155 |
| 272 | Ga0207683_10009317 | 3300026121 | Bacteria | 8365 |
| 273 | Ga0207698_10716939 | 3300026142 | Bacteria | 996 |
| 274 | Ga0209179_1060096 | 3300027512 | Bacteria | 824 |
| 275 | Ga0209588_1097162 | 3300027671 | Bacteria | 948 |
| 276 | Ga0209588_1109324 | 3300027671 | Bacteria | 888 |
| 277 | Ga0207428_10051510 | 3300027907 | Unclassified | 3291 |
| 278 | Ga0268266_10000768 | 3300028379 | Bacteria | 42899 |
| 279 | Ga0268266_10303800 | 3300028379 | Bacteria | 1489 |
| 280 | Ga0268265_10254711 | 3300028380 | Bacteria | 1557 |
| 281 | Ga0268265_11482520 | 3300028380 | Unclassified | 682 |
| 282 | Ga0265334_10000010 | 3300028573 | Bacteria | 188179 |
| 283 | Ga0265334_10024571 | 3300028573 | Bacteria | 2442 |
| 284 | Ga0307515_10010605 | 3300028794 | Bacteria | 17635 |
| 285 | Ga0265338_10030563 | 3300028800 | Bacteria | 5302 |
| 286 | Ga0265760_10023448 | 3300031090 | Bacteria | 1793 |
| 287 | Ga0265328_10230454 | 3300031239 | Bacteria | 707 |
| 288 | Ga0265340_10322738 | 3300031247 | Bacteria | 683 |
| 289 | Ga0265331_10012593 | 3300031250 | Bacteria | 4574 |
| 290 | Ga0265331_10019654 | 3300031250 | Unclassified | 3485 |
| 291 | Ga0307513_10003074 | 3300031456 | Bacteria | 22759 |
| 292 | Ga0307513_10414173 | 3300031456 | Bacteria | 1079 |
| 293 | Ga0307509_10062369 | 3300031507 | Bacteria | 3931 |
| 294 | Ga0307408_100123300 | 3300031548 | Bacteria | 2011 |
| 295 | Ga0265313_10000125 | 3300031595 | Bacteria | 77022 |
| 296 | Ga0265313_10000583 | 3300031595 | Bacteria | 38024 |
| 297 | Ga0265313_10005387 | 3300031595 | Bacteria | 9440 |
| 298 | Ga0307508_10001520 | 3300031616 | Bacteria | 25886 |
| 299 | Ga0307508_10003670 | 3300031616 | Bacteria | 15380 |
| 300 | Ga0307508_10006589 | 3300031616 | Bacteria | 10904 |
| 301 | Ga0265314_10124185 | 3300031711 | Bacteria | 1620 |
| 302 | Ga0265342_10098813 | 3300031712 | Bacteria | 1665 |
| 303 | Ga0307516_10000641 | 3300031730 | Bacteria | 47311 |
| 304 | Ga0307405_11493122 | 3300031731 | Unclassified | 593 |
| 305 | Ga0307413_10028800 | 3300031824 | Unclassified | 3099 |
| 306 | Ga0307410_10006501 | 3300031852 | Bacteria | 6311 |
| 307 | Ga0307406_10075335 | 3300031901 | Bacteria | 2226 |
| 308 | Ga0307407_10232768 | 3300031903 | Bacteria | 1252 |
| 309 | Ga0307409_100097071 | 3300031995 | Bacteria | 2433 |
| 310 | Ga0307416_100085733 | 3300032002 | Unclassified | 2682 |
| 311 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 312 | Ga0307510_10103102 | 3300033180 | Bacteria | 2631 |
| 313 | Ga0307510_10160985 | 3300033180 | Bacteria | 1841 |
| 314 | Ga0373940_0240387 | 3300035088 | Unclassified | 607 |
| 315 | Ga0373936_0006893 | 3300035113 | Bacteria | 4276 |
| 316 | Ga0373954_0206918 | 3300035118 | Bacteria | 964 |
| 317 | Ga0373960_0358587 | 3300035121 | Bacteria | 554 |
| 318 | Ga0373943_0281746 | 3300035170 | Bacteria | 940 |
| 319 | Ga0373931_0642011 | 3300035691 | Bacteria | 697 |
| 320 | Ga0373927_0050670 | 3300035695 | Bacteria | 2685 |
| 321 | Ga0373927_0321462 | 3300035695 | Bacteria | 1019 |
| 322 | Ga0373933_0239938 | 3300035724 | Bacteria | 1166 |
| 323 | Ga0373937_0160438 | 3300036401 | Bacteria | 2108 |
| 324 | Ga0395899_0000051 | 3300037312 | Bacteria | 222620 |
| 325 | Ga0395900_0000047 | 3300037418 | Bacteria | 230039 |
| 326 | Ga0395898_0000090 | 3300037466 | Bacteria | 237876 |
| 327 | Ga0395898_0032247 | 3300037466 | Bacteria | 5229 |
| 328 | Ga0395905_0325201 | 3300037471 | Bacteria | 1428 |
| 329 | Ga0395901_0044863 | 3300038443 | Bacteria | 4585 |
| 330 | Ga0395901_1037032 | 3300038443 | Bacteria | 794 |
| 331 | Ga0436360_0665360 | 3300039438 | Unclassified | 1288 |
| 332 | Ga0436360_0853982 | 3300039438 | Unclassified | 517 |
| 333 | Ga0436360_0963817 | 3300039438 | Bacteria | 3436 |
| 334 | Ga0436361_0280419 | 3300039447 | Bacteria | 779 |
| 335 | Ga0436361_0569891 | 3300039447 | Bacteria | 11823 |
| 336 | Ga0436363_1605196 | 3300039450 | Bacteria | 1328 |
| 337 | Ga0436362_0546971 | 3300039453 | Bacteria | 657 |
| 338 | Ga0436362_0579364 | 3300039453 | Bacteria | 655 |
| 339 | Ga0436362_0709855 | 3300039453 | Bacteria | 699 |
| 340 | Ga0451798_0064347 | 3300041458 | Unclassified | 890 |
| 341 | Ga0451807_0650615 | 3300041486 | Unclassified | 550 |
| 342 | Ga0439450_036297 | 3300042008 | Bacteria | 1128 |
| 343 | Ga0439456_127018 | 3300042013 | Bacteria | 587 |
| 344 | Ga0466969_0046155 | 3300044656 | Bacteria | 2160 |
| 345 | Ga0466975_0290894 | 3300044661 | Bacteria | 1056 |
| 346 | Ga0466965_0028758 | 3300044683 | Bacteria | 2701 |
| 347 | Ga0466966_0012843 | 3300044684 | Bacteria | 5545 |
| 348 | Ga0466961_0000281 | 3300044693 | Bacteria | 33824 |
| 349 | Ga0466961_0000682 | 3300044693 | Bacteria | 21417 |
| 350 | Ga0466961_0007290 | 3300044693 | Bacteria | 7036 |
| 351 | Ga0466961_0409940 | 3300044693 | Bacteria | 822 |
| 352 | Ga0466971_0003509 | 3300044719 | Bacteria | 6699 |
| 353 | Ga0466971_0368080 | 3300044719 | Bacteria | 697 |
| 354 | Ga0466957_0153809 | 3300044842 | Bacteria | 1489 |
| 355 | Ga0466959_0008906 | 3300045049 | Bacteria | 7116 |
| 356 | Ga0466959_0252103 | 3300045049 | Bacteria | 1217 |
| 357 | Ga0451576_0399814 | 3300045051 | Bacteria | 1440 |
| 358 | Ga0451576_1594335 | 3300045051 | Unclassified | 677 |
| 359 | Ga0466958_0037202 | 3300045836 | Bacteria | 2916 |
| 360 | Ga0466958_0049136 | 3300045836 | Bacteria | 2551 |
| 361 | Ga0466958_0390647 | 3300045836 | Bacteria | 898 |
| 362 | Ga0466958_0401437 | 3300045836 | Unclassified | 885 |
| 363 | Ga0495580_0022404 | 3300046472 | Bacteria | 4648 |
| 364 | Ga0495580_0131171 | 3300046472 | Bacteria | 1738 |
| 365 | Ga0495606_0595813 | 3300046507 | Bacteria | 543 |
| 366 | Ga0495608_0315083 | 3300046511 | Bacteria | 967 |
| 367 | Ga0495618_0192488 | 3300046514 | Bacteria | 1293 |
| 368 | Ga0495630_0565630 | 3300046517 | Bacteria | 872 |
| 369 | Ga0495642_0420289 | 3300046528 | Bacteria | 590 |
| 370 | Ga0495622_0377656 | 3300046557 | Bacteria | 612 |
| 371 | Ga0495625_0236124 | 3300046660 | Bacteria | 1192 |
| 372 | Ga0495658_0452986 | 3300046683 | Bacteria | 820 |
| 373 | Ga0495613_0292587 | 3300046689 | Bacteria | 1129 |
| 374 | Ga0495624_0954227 | 3300046690 | Bacteria | 504 |
| 375 | Ga0495670_0834404 | 3300046691 | Unclassified | 503 |
| 376 | Ga0495636_0050418 | 3300047318 | Bacteria | 1742 |
| 377 | Ga0495636_0434977 | 3300047318 | Bacteria | 628 |
| 378 | Ga0495674_0259434 | 3300047319 | Bacteria | 1428 |
| 379 | Ga0495593_0343836 | 3300047673 | Bacteria | 746 |
| 380 | Ga0496100_0132654 | 3300048903 | Bacteria | 1756 |
| 381 | Ga0496101_1072211 | 3300048904 | Bacteria | 633 |
| 382 | Ga0496102_0181830 | 3300048905 | Bacteria | 1981 |
| 383 | Ga0496102_0362319 | 3300048905 | Bacteria | 1365 |
| 384 | Ga0496103_0313781 | 3300048906 | Bacteria | 1009 |
| 385 | Ga0496104_0033953 | 3300048907 | Bacteria | 4755 |
| 386 | Ga0496105_0023111 | 3300048908 | Bacteria | 5041 |
| 387 | Ga0496106_0107665 | 3300048909 | Bacteria | 2168 |
| 388 | Ga0496107_0043247 | 3300048910 | Bacteria | 3236 |
| 389 | Ga0496108_0014980 | 3300048911 | Bacteria | 6329 |
| 390 | Ga0496108_0458419 | 3300048911 | Bacteria | 1114 |
| 391 | Ga0496108_0563054 | 3300048911 | Bacteria | 994 |
| 392 | Ga0496109_0897120 | 3300048912 | Bacteria | 824 |
| 393 | Ga0496110_0032363 | 3300048913 | Bacteria | 4515 |
| 394 | Ga0496110_0381482 | 3300048913 | Bacteria | 1284 |
| 395 | Ga0496110_0972822 | 3300048913 | Bacteria | 756 |
| 396 | Ga0496111_0011565 | 3300048914 | Bacteria | 5951 |
| 397 | Ga0496111_0234765 | 3300048914 | Bacteria | 1362 |
| 398 | Ga0496112_0695214 | 3300048915 | Bacteria | 945 |
| 399 | Ga0496113_0317049 | 3300048916 | Bacteria | 1249 |
| 400 | Ga0496114_0238535 | 3300048917 | Bacteria | 1598 |
| 401 | Ga0496125_0680931 | 3300048928 | Bacteria | 549 |
| 402 | Ga0496126_0012505 | 3300048929 | Bacteria | 8690 |
| 403 | Ga0501036_0232284 | 3300049572 | Bacteria | 1548 |
| 404 | Ga0501037_1071620 | 3300049573 | Bacteria | 523 |
| 405 | Ga0501039_1083446 | 3300049575 | Unclassified | 621 |
| 406 | Ga0501041_0214040 | 3300049577 | Bacteria | 1209 |
| 407 | Ga0501041_0505184 | 3300049577 | Unclassified | 769 |
| 408 | Ga0501042_0233850 | 3300049578 | Bacteria | 1326 |
| 409 | Ga0501043_0130842 | 3300049579 | Bacteria | 1967 |
| 410 | Ga0501046_0430209 | 3300049580 | Bacteria | 951 |
| 411 | Ga0501047_0391100 | 3300049581 | Bacteria | 1224 |
| 412 | Ga0501071_0359330 | 3300049587 | Bacteria | 1109 |
| 413 | Ga0501072_0223619 | 3300049588 | Unclassified | 1500 |
| 414 | Ga0501076_0341380 | 3300049592 | Bacteria | 1229 |
| 415 | Ga0501079_1018100 | 3300049741 | Bacteria | 652 |
| 416 | Ga0501081_0359184 | 3300049743 | Unclassified | 1074 |
| 417 | Ga0501081_1442295 | 3300049743 | Bacteria | 523 |
| 418 | Ga0501083_0340118 | 3300049744 | Bacteria | 976 |
| 419 | Ga0501035_0907963 | 3300049822 | Bacteria | 697 |
| 420 | nmdc:mga03683_465436_c1 | 3300050489 | Bacteria | 609 |
| 421 | nmdc:mga05p37_404119_c1 | 3300050507 | Bacteria | 1594 |
| 422 | nmdc:mga05p37_64729_c2 | 3300050507 | Bacteria | 1408 |
| 423 | nmdc:mga05p37_829455_c1 | 3300050507 | Bacteria | 1007 |
| 424 | nmdc:mga06r32_1472348_c1 | 3300050510 | Unclassified | 621 |
| 425 | nmdc:mga08y16_351796_c1 | 3300050511 | Unclassified | 1513 |
| 426 | nmdc:mga0n895_535390_c1 | 3300050512 | Bacteria | 1178 |
| 427 | nmdc:mga0rr50_927912_c1 | 3300050513 | Bacteria | 742 |
| 428 | nmdc:mga0a205_1277795_c1 | 3300050515 | Bacteria | 582 |
| 429 | nmdc:mga0a205_1299833_c1 | 3300050515 | Bacteria | 575 |
| 430 | nmdc:mga0a205_142927_c1 | 3300050515 | Unclassified | 2293 |
| 431 | Ga0500583_0061958 | 3300053092 | Bacteria | 1768 |
| 432 | Ga0500566_0092968 | 3300053094 | Unclassified | 1665 |
| 433 | Ga0500554_044379 | 3300053102 | Unclassified | 1378 |
| 434 | Ga0500597_086086 | 3300053120 | Unclassified | 1364 |
| 435 | Ga0500614_036436 | 3300053123 | Unclassified | 1230 |
| 436 | Ga0500642_0284448 | 3300053130 | Bacteria | 750 |
| 437 | Ga0500588_0018732 | 3300053146 | Unclassified | 1829 |
| 438 | Ga0500604_0000444 | 3300053151 | Bacteria | 11373 |
| 439 | Ga0500636_0203576 | 3300053177 | Bacteria | 1045 |
| 440 | Ga0500637_0029355 | 3300053178 | Bacteria | 3050 |
| 441 | Ga0500637_0469936 | 3300053178 | Bacteria | 632 |
| 442 | Ga0501084_0311111 | 3300054114 | Bacteria | 1330 |
| 443 | Ga0501082_0446496 | 3300060353 | Bacteria | 1130 |
| 444 | Ga0466962_0001709 | 3300061719 | Bacteria | 10307 |
| 445 | Ga0466962_0193272 | 3300061719 | Bacteria | 993 |
| 446 | Ga0530510_0103531 | 3300061734 | Bacteria | 2082 |
| 447 | Ga0530510_0349682 | 3300061734 | Unclassified | 1110 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005334 | Ga0068869_100567456 | Ga0068869_1005674561 | 116 |
| 2 | 3300006358 | Ga0068871_100173035 | Ga0068871_1001730352 | 116 |
| 3 | 3300025942 | Ga0207689_11194947 | Ga0207689_111949472 | 116 |
| 4 | 3300050515 | nmdc:mga0a205_142927_c1 | nmdc:mga0a205_142927_c1_587_964 | 118 |
| 5 | 3300026075 | Ga0207708_10421404 | Ga0207708_104214042 | 123 |
| 6 | 3300031507 | Ga0307509_10062369 | Ga0307509_100623692 | 124 |
| 7 | 3300046507 | Ga0495606_0595813 | Ga0495606_0595813_27_416 | 124 |
| 8 | 3300046528 | Ga0495642_0420289 | Ga0495642_0420289_97_486 | 124 |
| 9 | 3300046557 | Ga0495622_0377656 | Ga0495622_0377656_153_533 | 124 |
| 10 | 3300046660 | Ga0495625_0236124 | Ga0495625_0236124_351_740 | 124 |
| 11 | 3300046683 | Ga0495658_0452986 | Ga0495658_0452986_319_693 | 124 |
| 12 | 3300053102 | Ga0500554_044379 | Ga0500554_044379_410_790 | 124 |
| 13 | 3300053120 | Ga0500597_086086 | Ga0500597_086086_892_1272 | 124 |
| 14 | 3300053123 | Ga0500614_036436 | Ga0500614_036436_424_804 | 124 |
| 15 | 3300053178 | Ga0500637_0029355 | Ga0500637_0029355_1675_2055 | 124 |
| 16 | 3300005343 | Ga0070687_100438221 | Ga0070687_1004382211 | 125 |
| 17 | 3300005365 | Ga0070688_100665728 | Ga0070688_1006657282 | 125 |
| 18 | 3300005564 | Ga0070664_101399843 | Ga0070664_1013998431 | 125 |
| 19 | 3300025918 | Ga0207662_10095439 | Ga0207662_100954393 | 125 |
| 20 | 3300028794 | Ga0307515_10010605 | Ga0307515_100106055 | 125 |
| 21 | 3300053092 | Ga0500583_0061958 | Ga0500583_0061958_197_577 | 125 |
| 22 | 3300053094 | Ga0500566_0092968 | Ga0500566_0092968_843_1223 | 125 |
| 23 | 3300053130 | Ga0500642_0284448 | Ga0500642_0284448_311_691 | 125 |
| 24 | 2162886012 | MBSR1b_contig_988365 | MBSR1b_0644.00002890 | 126 |
| 25 | 3300003756 | Ga0055533_1010308 | Ga0055533_10103082 | 126 |
| 26 | 3300003760 | Ga0055527_1000037 | Ga0055527_100003779 | 126 |
| 27 | 3300003760 | Ga0055527_1003838 | Ga0055527_10038383 | 126 |
| 28 | 3300003761 | Ga0055535_1000059 | Ga0055535_100005979 | 126 |
| 29 | 3300003761 | Ga0055535_1000211 | Ga0055535_100021128 | 126 |
| 30 | 3300003762 | Ga0055542_1000086 | Ga0055542_100008617 | 126 |
| 31 | 3300003762 | Ga0055542_1000117 | Ga0055542_100011727 | 126 |
| 32 | 3300003763 | Ga0055529_1000212 | Ga0055529_100021217 | 126 |
| 33 | 3300005336 | Ga0070680_100126212 | Ga0070680_1001262122 | 126 |
| 34 | 3300005336 | Ga0070680_100320172 | Ga0070680_1003201721 | 126 |
| 35 | 3300005338 | Ga0068868_100097292 | Ga0068868_1000972923 | 126 |
| 36 | 3300005339 | Ga0070660_100742050 | Ga0070660_1007420501 | 126 |
| 37 | 3300005340 | Ga0070689_101372433 | Ga0070689_1013724332 | 126 |
| 38 | 3300005347 | Ga0070668_101294955 | Ga0070668_1012949552 | 126 |
| 39 | 3300005355 | Ga0070671_100302698 | Ga0070671_1003026982 | 126 |
| 40 | 3300005355 | Ga0070671_101826372 | Ga0070671_1018263721 | 126 |
| 41 | 3300005356 | Ga0070674_101021986 | Ga0070674_1010219861 | 126 |
| 42 | 3300005356 | Ga0070674_101955405 | Ga0070674_1019554051 | 126 |
| 43 | 3300005364 | Ga0070673_100057655 | Ga0070673_1000576552 | 126 |
| 44 | 3300005366 | Ga0070659_100265649 | Ga0070659_1002656492 | 126 |
| 45 | 3300005366 | Ga0070659_101399164 | Ga0070659_1013991641 | 126 |
| 46 | 3300005434 | Ga0070709_10640450 | Ga0070709_106404502 | 126 |
| 47 | 3300005434 | Ga0070709_11164117 | Ga0070709_111641171 | 126 |
| 48 | 3300005435 | Ga0070714_100207834 | Ga0070714_1002078341 | 126 |
| 49 | 3300005435 | Ga0070714_100256697 | Ga0070714_1002566972 | 126 |
| 50 | 3300005435 | Ga0070714_101426320 | Ga0070714_1014263202 | 126 |
| 51 | 3300005435 | Ga0070714_101750654 | Ga0070714_1017506542 | 126 |
| 52 | 3300005436 | Ga0070713_100044282 | Ga0070713_1000442822 | 126 |
| 53 | 3300005436 | Ga0070713_100144848 | Ga0070713_1001448482 | 126 |
| 54 | 3300005436 | Ga0070713_101041208 | Ga0070713_1010412082 | 126 |
| 55 | 3300005436 | Ga0070713_101449207 | Ga0070713_1014492071 | 126 |
| 56 | 3300005437 | Ga0070710_10079710 | Ga0070710_100797103 | 126 |
| 57 | 3300005437 | Ga0070710_10107638 | Ga0070710_101076382 | 126 |
| 58 | 3300005437 | Ga0070710_10181445 | Ga0070710_101814452 | 126 |
| 59 | 3300005437 | Ga0070710_10189462 | Ga0070710_101894622 | 126 |
| 60 | 3300005439 | Ga0070711_100750849 | Ga0070711_1007508491 | 126 |
| 61 | 3300005440 | Ga0070705_100339477 | Ga0070705_1003394772 | 126 |
| 62 | 3300005440 | Ga0070705_101440542 | Ga0070705_1014405421 | 126 |
| 63 | 3300005441 | Ga0070700_100047967 | Ga0070700_1000479673 | 126 |
| 64 | 3300005444 | Ga0070694_100011261 | Ga0070694_1000112618 | 126 |
| 65 | 3300005445 | Ga0070708_100078097 | Ga0070708_1000780974 | 126 |
| 66 | 3300005445 | Ga0070708_101473761 | Ga0070708_1014737611 | 126 |
| 67 | 3300005456 | Ga0070678_100898347 | Ga0070678_1008983472 | 126 |
| 68 | 3300005456 | Ga0070678_101775321 | Ga0070678_1017753211 | 126 |
| 69 | 3300005457 | Ga0070662_101004833 | Ga0070662_1010048332 | 126 |
| 70 | 3300005458 | Ga0070681_10044671 | Ga0070681_100446714 | 126 |
| 71 | 3300005458 | Ga0070681_10164501 | Ga0070681_101645012 | 126 |
| 72 | 3300005458 | Ga0070681_10608393 | Ga0070681_106083932 | 126 |
| 73 | 3300005467 | Ga0070706_100557803 | Ga0070706_1005578033 | 126 |
| 74 | 3300005468 | Ga0070707_100704664 | Ga0070707_1007046642 | 126 |
| 75 | 3300005468 | Ga0070707_102262117 | Ga0070707_1022621171 | 126 |
| 76 | 3300005471 | Ga0070698_100445108 | Ga0070698_1004451081 | 126 |
| 77 | 3300005471 | Ga0070698_100449407 | Ga0070698_1004494071 | 126 |
| 78 | 3300005518 | Ga0070699_100642356 | Ga0070699_1006423561 | 126 |
| 79 | 3300005518 | Ga0070699_101469453 | Ga0070699_1014694531 | 126 |
| 80 | 3300005530 | Ga0070679_100007825 | Ga0070679_1000078259 | 126 |
| 81 | 3300005530 | Ga0070679_100083013 | Ga0070679_1000830135 | 126 |
| 82 | 3300005530 | Ga0070679_100340045 | Ga0070679_1003400452 | 126 |
| 83 | 3300005535 | Ga0070684_101808289 | Ga0070684_1018082891 | 126 |
| 84 | 3300005536 | Ga0070697_100497943 | Ga0070697_1004979432 | 126 |
| 85 | 3300005536 | Ga0070697_101317980 | Ga0070697_1013179802 | 126 |
| 86 | 3300005536 | Ga0070697_101369978 | Ga0070697_1013699781 | 126 |
| 87 | 3300005544 | Ga0070686_101745994 | Ga0070686_1017459941 | 126 |
| 88 | 3300005545 | Ga0070695_100007484 | Ga0070695_1000074847 | 126 |
| 89 | 3300005545 | Ga0070695_100201651 | Ga0070695_1002016511 | 126 |
| 90 | 3300005547 | Ga0070693_100326429 | Ga0070693_1003264292 | 126 |
| 91 | 3300005548 | Ga0070665_100001987 | Ga0070665_10000198720 | 126 |
| 92 | 3300005548 | Ga0070665_100281036 | Ga0070665_1002810362 | 126 |
| 93 | 3300005548 | Ga0070665_102601914 | Ga0070665_1026019141 | 126 |
| 94 | 3300005549 | Ga0070704_100225701 | Ga0070704_1002257012 | 126 |
| 95 | 3300005563 | Ga0068855_100155403 | Ga0068855_1001554032 | 126 |
| 96 | 3300005563 | Ga0068855_100299237 | Ga0068855_1002992372 | 126 |
| 97 | 3300005563 | Ga0068855_100672615 | Ga0068855_1006726151 | 126 |
| 98 | 3300005577 | Ga0068857_100674431 | Ga0068857_1006744312 | 126 |
| 99 | 3300005614 | Ga0068856_100028366 | Ga0068856_1000283663 | 126 |
| 100 | 3300005614 | Ga0068856_100123907 | Ga0068856_1001239073 | 126 |
| 101 | 3300005614 | Ga0068856_100186604 | Ga0068856_1001866043 | 126 |
| 102 | 3300005615 | Ga0070702_100846906 | Ga0070702_1008469062 | 126 |
| 103 | 3300005616 | Ga0068852_100521007 | Ga0068852_1005210072 | 126 |
| 104 | 3300005617 | Ga0068859_101162048 | Ga0068859_1011620482 | 126 |
| 105 | 3300005718 | Ga0068866_10265228 | Ga0068866_102652282 | 126 |
| 106 | 3300005719 | Ga0068861_100027380 | Ga0068861_1000273806 | 126 |
| 107 | 3300005719 | Ga0068861_100071036 | Ga0068861_1000710361 | 126 |
| 108 | 3300005719 | Ga0068861_101776835 | Ga0068861_1017768352 | 126 |
| 109 | 3300005841 | Ga0068863_100021185 | Ga0068863_1000211855 | 126 |
| 110 | 3300005841 | Ga0068863_100108348 | Ga0068863_1001083483 | 126 |
| 111 | 3300005841 | Ga0068863_100994301 | Ga0068863_1009943011 | 126 |
| 112 | 3300005844 | Ga0068862_100125299 | Ga0068862_1001252992 | 126 |
| 113 | 3300005844 | Ga0068862_102342868 | Ga0068862_1023428681 | 126 |
| 114 | 3300005937 | Ga0081455_10005657 | Ga0081455_100056571 | 126 |
| 115 | 3300005937 | Ga0081455_10321502 | Ga0081455_103215022 | 126 |
| 116 | 3300005981 | Ga0081538_10020752 | Ga0081538_100207526 | 126 |
| 117 | 3300005983 | Ga0081540_1000224 | Ga0081540_100022432 | 126 |
| 118 | 3300005983 | Ga0081540_1002501 | Ga0081540_10025016 | 126 |
| 119 | 3300006028 | Ga0070717_10054997 | Ga0070717_100549973 | 126 |
| 120 | 3300006028 | Ga0070717_10500968 | Ga0070717_105009681 | 126 |
| 121 | 3300006042 | Ga0075368_10558528 | Ga0075368_105585281 | 126 |
| 122 | 3300006163 | Ga0070715_10039165 | Ga0070715_100391652 | 126 |
| 123 | 3300006173 | Ga0070716_100012569 | Ga0070716_1000125695 | 126 |
| 124 | 3300006173 | Ga0070716_100091702 | Ga0070716_1000917023 | 126 |
| 125 | 3300006173 | Ga0070716_101465078 | Ga0070716_1014650781 | 126 |
| 126 | 3300006175 | Ga0070712_100027017 | Ga0070712_1000270176 | 126 |
| 127 | 3300006175 | Ga0070712_100073786 | Ga0070712_1000737862 | 126 |
| 128 | 3300006175 | Ga0070712_100216506 | Ga0070712_1002165063 | 126 |
| 129 | 3300006175 | Ga0070712_100375310 | Ga0070712_1003753102 | 126 |
| 130 | 3300006178 | Ga0075367_10600954 | Ga0075367_106009542 | 126 |
| 131 | 3300006237 | Ga0097621_100035913 | Ga0097621_1000359136 | 126 |
| 132 | 3300006237 | Ga0097621_100084235 | Ga0097621_1000842353 | 126 |
| 133 | 3300006237 | Ga0097621_100526944 | Ga0097621_1005269441 | 126 |
| 134 | 3300006358 | Ga0068871_100204978 | Ga0068871_1002049783 | 126 |
| 135 | 3300006358 | Ga0068871_100343531 | Ga0068871_1003435312 | 126 |
| 136 | 3300006358 | Ga0068871_101190011 | Ga0068871_1011900111 | 126 |
| 137 | 3300006844 | Ga0075428_100058458 | Ga0075428_1000584582 | 126 |
| 138 | 3300006847 | Ga0075431_101527380 | Ga0075431_1015273802 | 126 |
| 139 | 3300006852 | Ga0075433_10194433 | Ga0075433_101944332 | 126 |
| 140 | 3300006852 | Ga0075433_10829889 | Ga0075433_108298891 | 126 |
| 141 | 3300006871 | Ga0075434_100379385 | Ga0075434_1003793852 | 126 |
| 142 | 3300006881 | Ga0068865_100009997 | Ga0068865_1000099976 | 126 |
| 143 | 3300006881 | Ga0068865_100044894 | Ga0068865_1000448944 | 126 |
| 144 | 3300006881 | Ga0068865_100071760 | Ga0068865_1000717604 | 126 |
| 145 | 3300006931 | Ga0097620_101161839 | Ga0097620_1011618391 | 126 |
| 146 | 3300007076 | Ga0075435_100521755 | Ga0075435_1005217552 | 126 |
| 147 | 3300007076 | Ga0075435_101006153 | Ga0075435_1010061532 | 126 |
| 148 | 3300007265 | Ga0099794_10017786 | Ga0099794_100177861 | 126 |
| 149 | 3300007265 | Ga0099794_10082105 | Ga0099794_100821052 | 126 |
| 150 | 3300007265 | Ga0099794_10085004 | Ga0099794_100850042 | 126 |
| 151 | 3300007265 | Ga0099794_10493418 | Ga0099794_104934181 | 126 |
| 152 | 3300007788 | Ga0099795_10000383 | Ga0099795_100003836 | 126 |
| 153 | 3300007788 | Ga0099795_10052309 | Ga0099795_100523092 | 126 |
| 154 | 3300009093 | Ga0105240_10026148 | Ga0105240_100261488 | 126 |
| 155 | 3300009093 | Ga0105240_10034070 | Ga0105240_100340706 | 126 |
| 156 | 3300009093 | Ga0105240_10067118 | Ga0105240_100671183 | 126 |
| 157 | 3300009093 | Ga0105240_10320647 | Ga0105240_103206473 | 126 |
| 158 | 3300009093 | Ga0105240_10490491 | Ga0105240_104904913 | 126 |
| 159 | 3300009093 | Ga0105240_12004035 | Ga0105240_120040351 | 126 |
| 160 | 3300009094 | Ga0111539_10155541 | Ga0111539_101555414 | 126 |
| 161 | 3300009098 | Ga0105245_10469246 | Ga0105245_104692462 | 126 |
| 162 | 3300009098 | Ga0105245_10856787 | Ga0105245_108567872 | 126 |
| 163 | 3300009101 | Ga0105247_10086945 | Ga0105247_100869452 | 126 |
| 164 | 3300009147 | Ga0114129_10051094 | Ga0114129_100510945 | 126 |
| 165 | 3300009147 | Ga0114129_10086707 | Ga0114129_100867075 | 126 |
| 166 | 3300009147 | Ga0114129_11265802 | Ga0114129_112658022 | 126 |
| 167 | 3300009174 | Ga0105241_10008916 | Ga0105241_100089168 | 126 |
| 168 | 3300009174 | Ga0105241_11400248 | Ga0105241_114002481 | 126 |
| 169 | 3300009176 | Ga0105242_10026836 | Ga0105242_100268364 | 126 |
| 170 | 3300009176 | Ga0105242_10061062 | Ga0105242_100610626 | 126 |
| 171 | 3300009176 | Ga0105242_10116301 | Ga0105242_101163014 | 126 |
| 172 | 3300009176 | Ga0105242_11419026 | Ga0105242_114190262 | 126 |
| 173 | 3300009545 | Ga0105237_10131844 | Ga0105237_101318445 | 126 |
| 174 | 3300009545 | Ga0105237_10156404 | Ga0105237_101564041 | 126 |
| 175 | 3300009545 | Ga0105237_11095454 | Ga0105237_110954541 | 126 |
| 176 | 3300009551 | Ga0105238_10025022 | Ga0105238_100250221 | 126 |
| 177 | 3300009551 | Ga0105238_10143285 | Ga0105238_101432855 | 126 |
| 178 | 3300009551 | Ga0105238_10506068 | Ga0105238_105060682 | 126 |
| 179 | 3300009551 | Ga0105238_10645731 | Ga0105238_106457312 | 126 |
| 180 | 3300009553 | Ga0105249_10364634 | Ga0105249_103646342 | 126 |
| 181 | 3300010159 | Ga0099796_10018428 | Ga0099796_100184282 | 126 |
| 182 | 3300010375 | Ga0105239_11536766 | Ga0105239_115367661 | 126 |
| 183 | 3300010375 | Ga0105239_12070656 | Ga0105239_120706562 | 126 |
| 184 | 3300013104 | Ga0157370_10786310 | Ga0157370_107863101 | 126 |
| 185 | 3300013105 | Ga0157369_10082617 | Ga0157369_100826174 | 126 |
| 186 | 3300013105 | Ga0157369_10491230 | Ga0157369_104912301 | 126 |
| 187 | 3300013296 | Ga0157374_10583821 | Ga0157374_105838211 | 126 |
| 188 | 3300013297 | Ga0157378_10061824 | Ga0157378_100618245 | 126 |
| 189 | 3300013297 | Ga0157378_10205687 | Ga0157378_102056872 | 126 |
| 190 | 3300013297 | Ga0157378_10948074 | Ga0157378_109480741 | 126 |
| 191 | 3300013306 | Ga0163162_10036550 | Ga0163162_100365506 | 126 |
| 192 | 3300013306 | Ga0163162_12963023 | Ga0163162_129630231 | 126 |
| 193 | 3300013307 | Ga0157372_10122765 | Ga0157372_101227653 | 126 |
| 194 | 3300013307 | Ga0157372_10308807 | Ga0157372_103088072 | 126 |
| 195 | 3300013308 | Ga0157375_10509897 | Ga0157375_105098972 | 126 |
| 196 | 3300014325 | Ga0163163_10849693 | Ga0163163_108496932 | 126 |
| 197 | 3300014968 | Ga0157379_10749075 | Ga0157379_107490751 | 126 |
| 198 | 3300014968 | Ga0157379_10928029 | Ga0157379_109280292 | 126 |
| 199 | 3300017792 | Ga0163161_10361681 | Ga0163161_103616812 | 126 |
| 200 | 3300021441 | Ga0213871_10065044 | Ga0213871_100650441 | 126 |
| 201 | 3300025226 | Ga0209674_100134 | Ga0209674_10013454 | 126 |
| 202 | 3300025228 | Ga0209672_100074 | Ga0209672_10007417 | 126 |
| 203 | 3300025228 | Ga0209672_100501 | Ga0209672_10050110 | 126 |
| 204 | 3300025229 | Ga0209147_117440 | Ga0209147_1174402 | 126 |
| 205 | 3300025242 | Ga0209258_100004 | Ga0209258_1000041157 | 126 |
| 206 | 3300025242 | Ga0209258_100008 | Ga0209258_100008782 | 126 |
| 207 | 3300025242 | Ga0209258_100229 | Ga0209258_10022947 | 126 |
| 208 | 3300025253 | Ga0209677_102248 | Ga0209677_1022485 | 126 |
| 209 | 3300025254 | Ga0209148_1000041 | Ga0209148_1000041284 | 126 |
| 210 | 3300025254 | Ga0209148_1000191 | Ga0209148_100019147 | 126 |
| 211 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007902 | 126 |
| 212 | 3300025272 | Ga0209455_1003840 | Ga0209455_10038403 | 126 |
| 213 | 3300025898 | Ga0207692_10182552 | Ga0207692_101825522 | 126 |
| 214 | 3300025899 | Ga0207642_10354330 | Ga0207642_103543302 | 126 |
| 215 | 3300025899 | Ga0207642_10405150 | Ga0207642_104051501 | 126 |
| 216 | 3300025903 | Ga0207680_10295447 | Ga0207680_102954471 | 126 |
| 217 | 3300025905 | Ga0207685_10062034 | Ga0207685_100620341 | 126 |
| 218 | 3300025906 | Ga0207699_10836576 | Ga0207699_108365761 | 126 |
| 219 | 3300025906 | Ga0207699_10871682 | Ga0207699_108716822 | 126 |
| 220 | 3300025907 | Ga0207645_10427304 | Ga0207645_104273042 | 126 |
| 221 | 3300025910 | Ga0207684_10003987 | Ga0207684_100039879 | 126 |
| 222 | 3300025910 | Ga0207684_10765806 | Ga0207684_107658062 | 126 |
| 223 | 3300025910 | Ga0207684_11291900 | Ga0207684_112919001 | 126 |
| 224 | 3300025911 | Ga0207654_11409550 | Ga0207654_114095501 | 126 |
| 225 | 3300025912 | Ga0207707_10067205 | Ga0207707_100672054 | 126 |
| 226 | 3300025912 | Ga0207707_10245604 | Ga0207707_102456042 | 126 |
| 227 | 3300025912 | Ga0207707_10534174 | Ga0207707_105341742 | 126 |
| 228 | 3300025913 | Ga0207695_10324493 | Ga0207695_103244931 | 126 |
| 229 | 3300025915 | Ga0207693_10021536 | Ga0207693_100215366 | 126 |
| 230 | 3300025915 | Ga0207693_10078359 | Ga0207693_100783592 | 126 |
| 231 | 3300025916 | Ga0207663_10060723 | Ga0207663_100607234 | 126 |
| 232 | 3300025916 | Ga0207663_10271265 | Ga0207663_102712653 | 126 |
| 233 | 3300025916 | Ga0207663_10293868 | Ga0207663_102938682 | 126 |
| 234 | 3300025916 | Ga0207663_10346350 | Ga0207663_103463501 | 126 |
| 235 | 3300025916 | Ga0207663_10629496 | Ga0207663_106294962 | 126 |
| 236 | 3300025917 | Ga0207660_10449193 | Ga0207660_104491931 | 126 |
| 237 | 3300025917 | Ga0207660_10454167 | Ga0207660_104541672 | 126 |
| 238 | 3300025919 | Ga0207657_10506543 | Ga0207657_105065432 | 126 |
| 239 | 3300025921 | Ga0207652_10029881 | Ga0207652_100298813 | 126 |
| 240 | 3300025921 | Ga0207652_11204432 | Ga0207652_112044322 | 126 |
| 241 | 3300025922 | Ga0207646_10045143 | Ga0207646_100451435 | 126 |
| 242 | 3300025922 | Ga0207646_11001937 | Ga0207646_110019371 | 126 |
| 243 | 3300025924 | Ga0207694_10092349 | Ga0207694_100923495 | 126 |
| 244 | 3300025924 | Ga0207694_10708043 | Ga0207694_107080432 | 126 |
| 245 | 3300025924 | Ga0207694_11084509 | Ga0207694_110845092 | 126 |
| 246 | 3300025927 | Ga0207687_10067596 | Ga0207687_100675963 | 126 |
| 247 | 3300025928 | Ga0207700_10116854 | Ga0207700_101168542 | 126 |
| 248 | 3300025928 | Ga0207700_10295103 | Ga0207700_102951032 | 126 |
| 249 | 3300025928 | Ga0207700_10535462 | Ga0207700_105354622 | 126 |
| 250 | 3300025929 | Ga0207664_10006280 | Ga0207664_100062802 | 126 |
| 251 | 3300025929 | Ga0207664_10169035 | Ga0207664_101690352 | 126 |
| 252 | 3300025929 | Ga0207664_10346956 | Ga0207664_103469562 | 126 |
| 253 | 3300025929 | Ga0207664_11148064 | Ga0207664_111480642 | 126 |
| 254 | 3300025929 | Ga0207664_11946734 | Ga0207664_119467341 | 126 |
| 255 | 3300025931 | Ga0207644_10250486 | Ga0207644_102504862 | 126 |
| 256 | 3300025934 | Ga0207686_10065041 | Ga0207686_100650414 | 126 |
| 257 | 3300025934 | Ga0207686_10071843 | Ga0207686_100718432 | 126 |
| 258 | 3300025934 | Ga0207686_10109723 | Ga0207686_101097232 | 126 |
| 259 | 3300025936 | Ga0207670_10479014 | Ga0207670_104790142 | 126 |
| 260 | 3300025938 | Ga0207704_10021976 | Ga0207704_100219766 | 126 |
| 261 | 3300025938 | Ga0207704_10383551 | Ga0207704_103835512 | 126 |
| 262 | 3300025938 | Ga0207704_10387126 | Ga0207704_103871261 | 126 |
| 263 | 3300025939 | Ga0207665_10017873 | Ga0207665_100178732 | 126 |
| 264 | 3300025939 | Ga0207665_10040924 | Ga0207665_100409243 | 126 |
| 265 | 3300025941 | Ga0207711_10447713 | Ga0207711_104477132 | 126 |
| 266 | 3300025942 | Ga0207689_10343386 | Ga0207689_103433862 | 126 |
| 267 | 3300025944 | Ga0207661_10266220 | Ga0207661_102662202 | 126 |
| 268 | 3300025944 | Ga0207661_10465105 | Ga0207661_104651053 | 126 |
| 269 | 3300025944 | Ga0207661_10511913 | Ga0207661_105119132 | 126 |
| 270 | 3300025945 | Ga0207679_10767807 | Ga0207679_107678072 | 126 |
| 271 | 3300025949 | Ga0207667_10776787 | Ga0207667_107767871 | 126 |
| 272 | 3300025961 | Ga0207712_10324703 | Ga0207712_103247032 | 126 |
| 273 | 3300025961 | Ga0207712_10715418 | Ga0207712_107154182 | 126 |
| 274 | 3300025961 | Ga0207712_10844579 | Ga0207712_108445791 | 126 |
| 275 | 3300025986 | Ga0207658_10121979 | Ga0207658_101219794 | 126 |
| 276 | 3300025986 | Ga0207658_10504923 | Ga0207658_105049232 | 126 |
| 277 | 3300026067 | Ga0207678_10550389 | Ga0207678_105503891 | 126 |
| 278 | 3300026067 | Ga0207678_11161743 | Ga0207678_111617432 | 126 |
| 279 | 3300026075 | Ga0207708_10039815 | Ga0207708_100398153 | 126 |
| 280 | 3300026078 | Ga0207702_10007263 | Ga0207702_100072635 | 126 |
| 281 | 3300026078 | Ga0207702_10655874 | Ga0207702_106558742 | 126 |
| 282 | 3300026088 | Ga0207641_10053812 | Ga0207641_100538122 | 126 |
| 283 | 3300026088 | Ga0207641_10304007 | Ga0207641_103040073 | 126 |
| 284 | 3300026095 | Ga0207676_11270169 | Ga0207676_112701691 | 126 |
| 285 | 3300026118 | Ga0207675_100020365 | Ga0207675_10002036510 | 126 |
| 286 | 3300026118 | Ga0207675_100075487 | Ga0207675_1000754871 | 126 |
| 287 | 3300026121 | Ga0207683_10009317 | Ga0207683_100093173 | 126 |
| 288 | 3300026142 | Ga0207698_10716939 | Ga0207698_107169392 | 126 |
| 289 | 3300027512 | Ga0209179_1060096 | Ga0209179_10600961 | 126 |
| 290 | 3300027671 | Ga0209588_1097162 | Ga0209588_10971621 | 126 |
| 291 | 3300027671 | Ga0209588_1109324 | Ga0209588_11093241 | 126 |
| 292 | 3300027907 | Ga0207428_10051510 | Ga0207428_100515102 | 126 |
| 293 | 3300028379 | Ga0268266_10000768 | Ga0268266_1000076832 | 126 |
| 294 | 3300028379 | Ga0268266_10303800 | Ga0268266_103038002 | 126 |
| 295 | 3300028380 | Ga0268265_10254711 | Ga0268265_102547112 | 126 |
| 296 | 3300028380 | Ga0268265_11482520 | Ga0268265_114825201 | 126 |
| 297 | 3300028573 | Ga0265334_10000010 | Ga0265334_10000010176 | 126 |
| 298 | 3300028573 | Ga0265334_10024571 | Ga0265334_100245712 | 126 |
| 299 | 3300028800 | Ga0265338_10030563 | Ga0265338_100305636 | 126 |
| 300 | 3300031090 | Ga0265760_10023448 | Ga0265760_100234483 | 126 |
| 301 | 3300031239 | Ga0265328_10230454 | Ga0265328_102304541 | 126 |
| 302 | 3300031247 | Ga0265340_10322738 | Ga0265340_103227382 | 126 |
| 303 | 3300031250 | Ga0265331_10012593 | Ga0265331_100125932 | 126 |
| 304 | 3300031250 | Ga0265331_10019654 | Ga0265331_100196545 | 126 |
| 305 | 3300031456 | Ga0307513_10003074 | Ga0307513_1000307422 | 126 |
| 306 | 3300031456 | Ga0307513_10414173 | Ga0307513_104141733 | 126 |
| 307 | 3300031548 | Ga0307408_100123300 | Ga0307408_1001233003 | 126 |
| 308 | 3300031595 | Ga0265313_10000125 | Ga0265313_1000012571 | 126 |
| 309 | 3300031595 | Ga0265313_10000583 | Ga0265313_1000058315 | 126 |
| 310 | 3300031595 | Ga0265313_10005387 | Ga0265313_100053873 | 126 |
| 311 | 3300031616 | Ga0307508_10001520 | Ga0307508_1000152040 | 126 |
| 312 | 3300031616 | Ga0307508_10003670 | Ga0307508_1000367010 | 126 |
| 313 | 3300031616 | Ga0307508_10006589 | Ga0307508_1000658910 | 126 |
| 314 | 3300031711 | Ga0265314_10124185 | Ga0265314_101241852 | 126 |
| 315 | 3300031712 | Ga0265342_10098813 | Ga0265342_100988132 | 126 |
| 316 | 3300031730 | Ga0307516_10000641 | Ga0307516_1000064133 | 126 |
| 317 | 3300031731 | Ga0307405_11493122 | Ga0307405_114931222 | 126 |
| 318 | 3300031824 | Ga0307413_10028800 | Ga0307413_100288006 | 126 |
| 319 | 3300031852 | Ga0307410_10006501 | Ga0307410_100065016 | 126 |
| 320 | 3300031901 | Ga0307406_10075335 | Ga0307406_100753353 | 126 |
| 321 | 3300031903 | Ga0307407_10232768 | Ga0307407_102327682 | 126 |
| 322 | 3300031995 | Ga0307409_100097071 | Ga0307409_1000970714 | 126 |
| 323 | 3300032002 | Ga0307416_100085733 | Ga0307416_1000857332 | 126 |
| 324 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001387 | 126 |
| 325 | 3300033180 | Ga0307510_10103102 | Ga0307510_101031021 | 126 |
| 326 | 3300033180 | Ga0307510_10160985 | Ga0307510_101609852 | 126 |
| 327 | 3300035088 | Ga0373940_0240387 | Ga0373940_0240387_98_478 | 126 |
| 328 | 3300035113 | Ga0373936_0006893 | Ga0373936_0006893_110_490 | 126 |
| 329 | 3300035118 | Ga0373954_0206918 | Ga0373954_0206918_547_927 | 126 |
| 330 | 3300035121 | Ga0373960_0358587 | Ga0373960_0358587_11_391 | 126 |
| 331 | 3300035170 | Ga0373943_0281746 | Ga0373943_0281746_291_671 | 126 |
| 332 | 3300035691 | Ga0373931_0642011 | Ga0373931_0642011_279_659 | 126 |
| 333 | 3300035695 | Ga0373927_0050670 | Ga0373927_0050670_582_962 | 126 |
| 334 | 3300035695 | Ga0373927_0321462 | Ga0373927_0321462_375_770 | 126 |
| 335 | 3300035724 | Ga0373933_0239938 | Ga0373933_0239938_207_587 | 126 |
| 336 | 3300036401 | Ga0373937_0160438 | Ga0373937_0160438_1440_1820 | 126 |
| 337 | 3300037312 | Ga0395899_0000051 | Ga0395899_0000051_61004_61384 | 126 |
| 338 | 3300037418 | Ga0395900_0000047 | Ga0395900_0000047_158415_158795 | 126 |
| 339 | 3300037466 | Ga0395898_0000090 | Ga0395898_0000090_161237_161617 | 126 |
| 340 | 3300037466 | Ga0395898_0032247 | Ga0395898_0032247_1099_1479 | 126 |
| 341 | 3300037471 | Ga0395905_0325201 | Ga0395905_0325201_247_666 | 126 |
| 342 | 3300038443 | Ga0395901_0044863 | Ga0395901_0044863_1984_2364 | 126 |
| 343 | 3300038443 | Ga0395901_1037032 | Ga0395901_1037032_176_595 | 126 |
| 344 | 3300039438 | Ga0436360_0665360 | Ga0436360_0665360_208_588 | 126 |
| 345 | 3300039438 | Ga0436360_0853982 | Ga0436360_0853982_86_466 | 126 |
| 346 | 3300039438 | Ga0436360_0963817 | Ga0436360_0963817_1823_2203 | 126 |
| 347 | 3300039447 | Ga0436361_0280419 | Ga0436361_0280419_92_472 | 126 |
| 348 | 3300039447 | Ga0436361_0569891 | Ga0436361_0569891_9455_9835 | 126 |
| 349 | 3300039450 | Ga0436363_1605196 | Ga0436363_1605196_496_876 | 126 |
| 350 | 3300039453 | Ga0436362_0546971 | Ga0436362_0546971_46_426 | 126 |
| 351 | 3300039453 | Ga0436362_0579364 | Ga0436362_0579364_32_412 | 126 |
| 352 | 3300039453 | Ga0436362_0709855 | Ga0436362_0709855_171_551 | 126 |
| 353 | 3300041458 | Ga0451798_0064347 | Ga0451798_0064347_457_837 | 126 |
| 354 | 3300041486 | Ga0451807_0650615 | Ga0451807_0650615_117_497 | 126 |
| 355 | 3300042008 | Ga0439450_036297 | Ga0439450_036297_173_553 | 126 |
| 356 | 3300042013 | Ga0439456_127018 | Ga0439456_127018_67_447 | 126 |
| 357 | 3300044656 | Ga0466969_0046155 | Ga0466969_0046155_1260_1640 | 126 |
| 358 | 3300044661 | Ga0466975_0290894 | Ga0466975_0290894_83_463 | 126 |
| 359 | 3300044683 | Ga0466965_0028758 | Ga0466965_0028758_601_981 | 126 |
| 360 | 3300044684 | Ga0466966_0012843 | Ga0466966_0012843_4191_4571 | 126 |
| 361 | 3300044693 | Ga0466961_0000281 | Ga0466961_0000281_7106_7486 | 126 |
| 362 | 3300044693 | Ga0466961_0000682 | Ga0466961_0000682_11289_11669 | 126 |
| 363 | 3300044693 | Ga0466961_0007290 | Ga0466961_0007290_5594_5974 | 126 |
| 364 | 3300044693 | Ga0466961_0409940 | Ga0466961_0409940_392_772 | 126 |
| 365 | 3300044719 | Ga0466971_0003509 | Ga0466971_0003509_2807_3187 | 126 |
| 366 | 3300044719 | Ga0466971_0368080 | Ga0466971_0368080_43_423 | 126 |
| 367 | 3300044842 | Ga0466957_0153809 | Ga0466957_0153809_174_554 | 126 |
| 368 | 3300045049 | Ga0466959_0008906 | Ga0466959_0008906_2379_2759 | 126 |
| 369 | 3300045049 | Ga0466959_0252103 | Ga0466959_0252103_764_1144 | 126 |
| 370 | 3300045051 | Ga0451576_0399814 | Ga0451576_0399814_182_562 | 126 |
| 371 | 3300045051 | Ga0451576_1594335 | Ga0451576_1594335_177_557 | 126 |
| 372 | 3300045836 | Ga0466958_0037202 | Ga0466958_0037202_1412_1792 | 126 |
| 373 | 3300045836 | Ga0466958_0049136 | Ga0466958_0049136_1492_1872 | 126 |
| 374 | 3300045836 | Ga0466958_0390647 | Ga0466958_0390647_29_409 | 126 |
| 375 | 3300045836 | Ga0466958_0401437 | Ga0466958_0401437_111_491 | 126 |
| 376 | 3300046472 | Ga0495580_0022404 | Ga0495580_0022404_1625_2005 | 126 |
| 377 | 3300046472 | Ga0495580_0131171 | Ga0495580_0131171_1290_1670 | 126 |
| 378 | 3300046511 | Ga0495608_0315083 | Ga0495608_0315083_387_767 | 126 |
| 379 | 3300046514 | Ga0495618_0192488 | Ga0495618_0192488_824_1204 | 126 |
| 380 | 3300046517 | Ga0495630_0565630 | Ga0495630_0565630_304_684 | 126 |
| 381 | 3300046689 | Ga0495613_0292587 | Ga0495613_0292587_721_1101 | 126 |
| 382 | 3300046690 | Ga0495624_0954227 | Ga0495624_0954227_66_446 | 126 |
| 383 | 3300046691 | Ga0495670_0834404 | Ga0495670_0834404_61_453 | 126 |
| 384 | 3300047318 | Ga0495636_0050418 | Ga0495636_0050418_1271_1651 | 126 |
| 385 | 3300047318 | Ga0495636_0434977 | Ga0495636_0434977_178_558 | 126 |
| 386 | 3300047319 | Ga0495674_0259434 | Ga0495674_0259434_967_1347 | 126 |
| 387 | 3300047673 | Ga0495593_0343836 | Ga0495593_0343836_86_466 | 126 |
| 388 | 3300048903 | Ga0496100_0132654 | Ga0496100_0132654_1068_1448 | 126 |
| 389 | 3300048904 | Ga0496101_1072211 | Ga0496101_1072211_214_594 | 126 |
| 390 | 3300048905 | Ga0496102_0181830 | Ga0496102_0181830_362_742 | 126 |
| 391 | 3300048905 | Ga0496102_0362319 | Ga0496102_0362319_195_575 | 126 |
| 392 | 3300048906 | Ga0496103_0313781 | Ga0496103_0313781_432_812 | 126 |
| 393 | 3300048907 | Ga0496104_0033953 | Ga0496104_0033953_472_852 | 126 |
| 394 | 3300048908 | Ga0496105_0023111 | Ga0496105_0023111_4639_5019 | 126 |
| 395 | 3300048909 | Ga0496106_0107665 | Ga0496106_0107665_1543_1923 | 126 |
| 396 | 3300048910 | Ga0496107_0043247 | Ga0496107_0043247_1329_1709 | 126 |
| 397 | 3300048911 | Ga0496108_0014980 | Ga0496108_0014980_4985_5365 | 126 |
| 398 | 3300048911 | Ga0496108_0458419 | Ga0496108_0458419_312_692 | 126 |
| 399 | 3300048911 | Ga0496108_0563054 | Ga0496108_0563054_298_678 | 126 |
| 400 | 3300048912 | Ga0496109_0897120 | Ga0496109_0897120_34_414 | 126 |
| 401 | 3300048913 | Ga0496110_0032363 | Ga0496110_0032363_2837_3217 | 126 |
| 402 | 3300048913 | Ga0496110_0381482 | Ga0496110_0381482_731_1111 | 126 |
| 403 | 3300048913 | Ga0496110_0972822 | Ga0496110_0972822_127_507 | 126 |
| 404 | 3300048914 | Ga0496111_0011565 | Ga0496111_0011565_1106_1486 | 126 |
| 405 | 3300048914 | Ga0496111_0234765 | Ga0496111_0234765_866_1246 | 126 |
| 406 | 3300048915 | Ga0496112_0695214 | Ga0496112_0695214_524_904 | 126 |
| 407 | 3300048916 | Ga0496113_0317049 | Ga0496113_0317049_633_1013 | 126 |
| 408 | 3300048917 | Ga0496114_0238535 | Ga0496114_0238535_564_944 | 126 |
| 409 | 3300048928 | Ga0496125_0680931 | Ga0496125_0680931_21_401 | 126 |
| 410 | 3300048929 | Ga0496126_0012505 | Ga0496126_0012505_1383_1763 | 126 |
| 411 | 3300049572 | Ga0501036_0232284 | Ga0501036_0232284_1144_1524 | 126 |
| 412 | 3300049573 | Ga0501037_1071620 | Ga0501037_1071620_92_472 | 126 |
| 413 | 3300049575 | Ga0501039_1083446 | Ga0501039_1083446_94_474 | 126 |
| 414 | 3300049577 | Ga0501041_0214040 | Ga0501041_0214040_415_795 | 126 |
| 415 | 3300049577 | Ga0501041_0505184 | Ga0501041_0505184_298_678 | 126 |
| 416 | 3300049578 | Ga0501042_0233850 | Ga0501042_0233850_19_399 | 126 |
| 417 | 3300049579 | Ga0501043_0130842 | Ga0501043_0130842_144_524 | 126 |
| 418 | 3300049580 | Ga0501046_0430209 | Ga0501046_0430209_488_868 | 126 |
| 419 | 3300049581 | Ga0501047_0391100 | Ga0501047_0391100_250_630 | 126 |
| 420 | 3300049587 | Ga0501071_0359330 | Ga0501071_0359330_156_536 | 126 |
| 421 | 3300049588 | Ga0501072_0223619 | Ga0501072_0223619_44_424 | 126 |
| 422 | 3300049592 | Ga0501076_0341380 | Ga0501076_0341380_701_1081 | 126 |
| 423 | 3300049741 | Ga0501079_1018100 | Ga0501079_1018100_138_518 | 126 |
| 424 | 3300049743 | Ga0501081_0359184 | Ga0501081_0359184_334_714 | 126 |
| 425 | 3300049743 | Ga0501081_1442295 | Ga0501081_1442295_24_404 | 126 |
| 426 | 3300049744 | Ga0501083_0340118 | Ga0501083_0340118_365_745 | 126 |
| 427 | 3300049822 | Ga0501035_0907963 | Ga0501035_0907963_293_673 | 126 |
| 428 | 3300050489 | nmdc:mga03683_465436_c1 | nmdc:mga03683_465436_c1_218_598 | 126 |
| 429 | 3300050507 | nmdc:mga05p37_404119_c1 | nmdc:mga05p37_404119_c1_1073_1537 | 126 |
| 430 | 3300050507 | nmdc:mga05p37_64729_c2 | nmdc:mga05p37_64729_c2_27_407 | 126 |
| 431 | 3300050507 | nmdc:mga05p37_829455_c1 | nmdc:mga05p37_829455_c1_298_678 | 126 |
| 432 | 3300050510 | nmdc:mga06r32_1472348_c1 | nmdc:mga06r32_1472348_c1_153_533 | 126 |
| 433 | 3300050511 | nmdc:mga08y16_351796_c1 | nmdc:mga08y16_351796_c1_310_690 | 126 |
| 434 | 3300050512 | nmdc:mga0n895_535390_c1 | nmdc:mga0n895_535390_c1_422_802 | 126 |
| 435 | 3300050513 | nmdc:mga0rr50_927912_c1 | nmdc:mga0rr50_927912_c1_243_635 | 126 |
| 436 | 3300050515 | nmdc:mga0a205_1277795_c1 | nmdc:mga0a205_1277795_c1_135_515 | 126 |
| 437 | 3300050515 | nmdc:mga0a205_1299833_c1 | nmdc:mga0a205_1299833_c1_142_522 | 126 |
| 438 | 3300053146 | Ga0500588_0018732 | Ga0500588_0018732_150_530 | 126 |
| 439 | 3300053151 | Ga0500604_0000444 | Ga0500604_0000444_5512_5892 | 126 |
| 440 | 3300053177 | Ga0500636_0203576 | Ga0500636_0203576_88_468 | 126 |
| 441 | 3300053178 | Ga0500637_0469936 | Ga0500637_0469936_179_559 | 126 |
| 442 | 3300054114 | Ga0501084_0311111 | Ga0501084_0311111_17_397 | 126 |
| 443 | 3300060353 | Ga0501082_0446496 | Ga0501082_0446496_573_953 | 126 |
| 444 | 3300061719 | Ga0466962_0001709 | Ga0466962_0001709_2483_2863 | 126 |
| 445 | 3300061719 | Ga0466962_0193272 | Ga0466962_0193272_296_676 | 126 |
| 446 | 3300061734 | Ga0530510_0103531 | Ga0530510_0103531_928_1308 | 126 |
| 447 | 3300061734 | Ga0530510_0349682 | Ga0530510_0349682_582_962 | 126 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z7t-assembly1.cif.gz_A | nucleotide-free myosin-ii motor domain | 0.9009 | 88 | 111 |
| 3ue0-assembly1.cif.gz_B | crystal structure of acinetobacter baumannii pbp1a in complex with aztreonam | 0.8922 | 88 | 111 |
| 3udf-assembly1.cif.gz_A | crystal structure of apo pbp1a from acinetobacter baumannii | 0.8911 | 88 | 111 |
| 3udi-assembly1.cif.gz_B | crystal structure of acinetobacter baumannii pbp1a in complex with penicillin g | 0.8888 | 88 | 111 |
| 3udx-assembly1.cif.gz_A | crystal structure of acinetobacter baumannii pbp1a in complex with imipenem | 0.8877 | 88 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O74839_657_709_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9499 | 88 | 111 | 2.30.30.60 |
| af_Q55A48_1158_1269_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9162 | 88 | 111 | 2.40.50.140 |
| af_Q8CJE3_1_67_2.30.30.100 | Mainly Beta;Roll;SH3 type barrels.; | 0.9061 | 88 | 111 | 2.30.30.100 |
| af_P75783_574_621_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.9056 | 88 | 111 | 2.30.30.60 |
| af_P0C0S1_129_178_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.8996 | 88 | 111 | 2.30.30.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534AGY9-F1-model_v4 | VOC family protein | 0.9905 | 70 | 126 |
|
| AF-A0A1V3QK24-F1-model_v4 | Glyoxalase | 0.9896 | 33 | 126 |
|
| AF-A0A369ULU2-F1-model_v4 | VOC family protein | 0.9857 | 1 | 126 |
|
| AF-A0A7Y2YD13-F1-model_v4 | VOC family protein | 0.9614 | 62 | 126 |
|
| AF-A0A5C5TGV8-F1-model_v4 | VOC family protein | 0.9493 | 1 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar