F445971

General Info

Members Datasets Scaffolds Average Seq Length
447 272 447 127

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10421404|Ga0207708_104214042
Length 125
Sequence MHHSRLSTFVIDCNVEDLATAAEFWGKVFGRSVTQTDDDPNYRALVGGDGPSLVVQKVEHESRVHLDIECDDLEAEVARLEKLGAKRVRFHKRWWLMQAPTGHAFCVVNRQRPVGGRPGANEWPD

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
3 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
194 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
195 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
196 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
262 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
263 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
264 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
265 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
266 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
267 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.61
Nodule 0
Rhizoplane 5.15
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 3.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_988365 2162886012 Unclassified 953
2 Ga0055533_1010308 3300003756 Bacteria 1066
3 Ga0055527_1000037 3300003760 Bacteria 124590
4 Ga0055527_1003838 3300003760 Bacteria 2155
5 Ga0055535_1000059 3300003761 Bacteria 124595
6 Ga0055535_1000211 3300003761 Bacteria 61694
7 Ga0055542_1000086 3300003762 Bacteria 124594
8 Ga0055542_1000117 3300003762 Bacteria 105560
9 Ga0055529_1000212 3300003763 Bacteria 76463
10 Ga0068869_100567456 3300005334 Bacteria 955
11 Ga0070680_100126212 3300005336 Bacteria 2138
12 Ga0070680_100320172 3300005336 Bacteria 1316
13 Ga0068868_100097292 3300005338 Bacteria 2378
14 Ga0070660_100742050 3300005339 Bacteria 824
15 Ga0070689_101372433 3300005340 Bacteria 638
16 Ga0070687_100438221 3300005343 Unclassified 866
17 Ga0070668_101294955 3300005347 Unclassified 662
18 Ga0070671_100302698 3300005355 Bacteria 1361
19 Ga0070671_101826372 3300005355 Bacteria 540
20 Ga0070674_101021986 3300005356 Bacteria 726
21 Ga0070674_101955405 3300005356 Unclassified 533
22 Ga0070673_100057655 3300005364 Bacteria 3069
23 Ga0070688_100665728 3300005365 Unclassified 803
24 Ga0070659_100265649 3300005366 Bacteria 1424
25 Ga0070659_101399164 3300005366 Bacteria 622
26 Ga0070709_10640450 3300005434 Bacteria 822
27 Ga0070709_11164117 3300005434 Bacteria 619
28 Ga0070714_100207834 3300005435 Bacteria 1793
29 Ga0070714_100256697 3300005435 Bacteria 1618
30 Ga0070714_101426320 3300005435 Bacteria 676
31 Ga0070714_101750654 3300005435 Bacteria 607
32 Ga0070713_100044282 3300005436 Bacteria 3642
33 Ga0070713_100144848 3300005436 Bacteria 2108
34 Ga0070713_101041208 3300005436 Bacteria 790
35 Ga0070713_101449207 3300005436 Unclassified 666
36 Ga0070710_10079710 3300005437 Bacteria 1909
37 Ga0070710_10107638 3300005437 Bacteria 1670
38 Ga0070710_10181445 3300005437 Bacteria 1318
39 Ga0070710_10189462 3300005437 Bacteria 1292
40 Ga0070711_100750849 3300005439 Bacteria 824
41 Ga0070705_100339477 3300005440 Bacteria 1091
42 Ga0070705_101440542 3300005440 Bacteria 575
43 Ga0070700_100047967 3300005441 Bacteria 2645
44 Ga0070694_100011261 3300005444 Bacteria 5537
45 Ga0070708_100078097 3300005445 Bacteria 2992
46 Ga0070708_101473761 3300005445 Unclassified 634
47 Ga0070678_100898347 3300005456 Bacteria 810
48 Ga0070678_101775321 3300005456 Bacteria 581
49 Ga0070662_101004833 3300005457 Bacteria 714
50 Ga0070681_10044671 3300005458 Bacteria 4435
51 Ga0070681_10164501 3300005458 Bacteria 2141
52 Ga0070681_10608393 3300005458 Bacteria 1007
53 Ga0070706_100557803 3300005467 Bacteria 1065
54 Ga0070707_100704664 3300005468 Bacteria 972
55 Ga0070707_102262117 3300005468 Bacteria 511
56 Ga0070698_100445108 3300005471 Bacteria 1231
57 Ga0070698_100449407 3300005471 Bacteria 1224
58 Ga0070699_100642356 3300005518 Bacteria 968
59 Ga0070699_101469453 3300005518 Bacteria 625
60 Ga0070679_100007825 3300005530 Bacteria 10021
61 Ga0070679_100083013 3300005530 Bacteria 3193
62 Ga0070679_100340045 3300005530 Bacteria 1449
63 Ga0070684_101808289 3300005535 Bacteria 576
64 Ga0070697_100497943 3300005536 Bacteria 1065
65 Ga0070697_101317980 3300005536 Bacteria 644
66 Ga0070697_101369978 3300005536 Unclassified 631
67 Ga0070686_101745994 3300005544 Bacteria 529
68 Ga0070695_100007484 3300005545 Bacteria 6468
69 Ga0070695_100201651 3300005545 Bacteria 1422
70 Ga0070693_100326429 3300005547 Bacteria 1043
71 Ga0070665_100001987 3300005548 Bacteria 23014
72 Ga0070665_100281036 3300005548 Bacteria 1666
73 Ga0070665_102601914 3300005548 Unclassified 507
74 Ga0070704_100225701 3300005549 Unclassified 1525
75 Ga0068855_100155403 3300005563 Bacteria 2599
76 Ga0068855_100299237 3300005563 Bacteria 1782
77 Ga0068855_100672615 3300005563 Bacteria 1110
78 Ga0070664_101399843 3300005564 Bacteria 661
79 Ga0068857_100674431 3300005577 Bacteria 981
80 Ga0068856_100028366 3300005614 Bacteria 5465
81 Ga0068856_100123907 3300005614 Bacteria 2587
82 Ga0068856_100186604 3300005614 Bacteria 2087
83 Ga0070702_100846906 3300005615 Bacteria 711
84 Ga0068852_100521007 3300005616 Bacteria 1186
85 Ga0068859_101162048 3300005617 Bacteria 850
86 Ga0068866_10265228 3300005718 Unclassified 1057
87 Ga0068861_100027380 3300005719 Unclassified 4151
88 Ga0068861_100071036 3300005719 Bacteria 2697
89 Ga0068861_101776835 3300005719 Bacteria 611
90 Ga0068863_100021185 3300005841 Bacteria 6205
91 Ga0068863_100108348 3300005841 Bacteria 2644
92 Ga0068863_100994301 3300005841 Unclassified 841
93 Ga0068862_100125299 3300005844 Bacteria 2268
94 Ga0068862_102342868 3300005844 Unclassified 546
95 Ga0081455_10005657 3300005937 Bacteria 13644
96 Ga0081455_10321502 3300005937 Bacteria 1102
97 Ga0081538_10020752 3300005981 Bacteria 4823
98 Ga0081540_1000224 3300005983 Bacteria 59493
99 Ga0081540_1002501 3300005983 Bacteria 14947
100 Ga0070717_10054997 3300006028 Bacteria 3283
101 Ga0070717_10500968 3300006028 Bacteria 1098
102 Ga0075368_10558528 3300006042 Bacteria 515
103 Ga0070715_10039165 3300006163 Bacteria 1973
104 Ga0070716_100012569 3300006173 Bacteria 4294
105 Ga0070716_100091702 3300006173 Bacteria 1840
106 Ga0070716_101465078 3300006173 Bacteria 557
107 Ga0070712_100027017 3300006175 Bacteria 3829
108 Ga0070712_100073786 3300006175 Bacteria 2448
109 Ga0070712_100216506 3300006175 Bacteria 1513
110 Ga0070712_100375310 3300006175 Bacteria 1169
111 Ga0075367_10600954 3300006178 Unclassified 699
112 Ga0097621_100035913 3300006237 Unclassified 3961
113 Ga0097621_100084235 3300006237 Bacteria 2650
114 Ga0097621_100526944 3300006237 Bacteria 1073
115 Ga0068871_100173035 3300006358 Unclassified 1852
116 Ga0068871_100204978 3300006358 Bacteria 1704
117 Ga0068871_100343531 3300006358 Unclassified 1318
118 Ga0068871_101190011 3300006358 Bacteria 715
119 Ga0075428_100058458 3300006844 Bacteria 4222
120 Ga0075431_101527380 3300006847 Unclassified 626
121 Ga0075433_10194433 3300006852 Unclassified 1804
122 Ga0075433_10829889 3300006852 Bacteria 807
123 Ga0075434_100379385 3300006871 Bacteria 1434
124 Ga0068865_100009997 3300006881 Bacteria 5897
125 Ga0068865_100044894 3300006881 Bacteria 3027
126 Ga0068865_100071760 3300006881 Unclassified 2457
127 Ga0097620_101161839 3300006931 Bacteria 850
128 Ga0075435_100521755 3300007076 Bacteria 1028
129 Ga0075435_101006153 3300007076 Bacteria 728
130 Ga0099794_10017786 3300007265 Bacteria 3175
131 Ga0099794_10082105 3300007265 Bacteria 1591
132 Ga0099794_10085004 3300007265 Bacteria 1565
133 Ga0099794_10493418 3300007265 Bacteria 644
134 Ga0099795_10000383 3300007788 Bacteria 8014
135 Ga0099795_10052309 3300007788 Bacteria 1491
136 Ga0105240_10026148 3300009093 Bacteria 7659
137 Ga0105240_10034070 3300009093 Bacteria 6573
138 Ga0105240_10067118 3300009093 Bacteria 4447
139 Ga0105240_10320647 3300009093 Bacteria 1766
140 Ga0105240_10490491 3300009093 Bacteria 1368
141 Ga0105240_12004035 3300009093 Bacteria 602
142 Ga0111539_10155541 3300009094 Unclassified 2676
143 Ga0105245_10469246 3300009098 Unclassified 1270
144 Ga0105245_10856787 3300009098 Bacteria 949
145 Ga0105247_10086945 3300009101 Bacteria 1979
146 Ga0114129_10051094 3300009147 Bacteria 5804
147 Ga0114129_10086707 3300009147 Bacteria 4342
148 Ga0114129_11265802 3300009147 Bacteria 916
149 Ga0105241_10008916 3300009174 Bacteria 7374
150 Ga0105241_11400248 3300009174 Bacteria 669
151 Ga0105242_10026836 3300009176 Bacteria 4567
152 Ga0105242_10061062 3300009176 Bacteria 3099
153 Ga0105242_10116301 3300009176 Bacteria 2288
154 Ga0105242_11419026 3300009176 Unclassified 722
155 Ga0105237_10131844 3300009545 Bacteria 2493
156 Ga0105237_10156404 3300009545 Bacteria 2277
157 Ga0105237_11095454 3300009545 Bacteria 803
158 Ga0105238_10025022 3300009551 Bacteria 6086
159 Ga0105238_10143285 3300009551 Bacteria 2366
160 Ga0105238_10506068 3300009551 Bacteria 1209
161 Ga0105238_10645731 3300009551 Bacteria 1068
162 Ga0105249_10364634 3300009553 Bacteria 1467
163 Ga0099796_10018428 3300010159 Bacteria 2096
164 Ga0105239_11536766 3300010375 Bacteria 769
165 Ga0105239_12070656 3300010375 Bacteria 661
166 Ga0157370_10786310 3300013104 Bacteria 866
167 Ga0157369_10082617 3300013105 Bacteria 3437
168 Ga0157369_10491230 3300013105 Bacteria 1270
169 Ga0157374_10583821 3300013296 Bacteria 1127
170 Ga0157378_10061824 3300013297 Bacteria 3343
171 Ga0157378_10205687 3300013297 Bacteria 1864
172 Ga0157378_10948074 3300013297 Bacteria 893
173 Ga0163162_10036550 3300013306 Unclassified 4896
174 Ga0163162_12963023 3300013306 Bacteria 546
175 Ga0157372_10122765 3300013307 Bacteria 2985
176 Ga0157372_10308807 3300013307 Bacteria 1841
177 Ga0157375_10509897 3300013308 Bacteria 1367
178 Ga0163163_10849693 3300014325 Bacteria 976
179 Ga0157379_10749075 3300014968 Unclassified 919
180 Ga0157379_10928029 3300014968 Unclassified 827
181 Ga0163161_10361681 3300017792 Unclassified 1156
182 Ga0213871_10065044 3300021441 Bacteria 1021
183 Ga0209674_100134 3300025226 Bacteria 114123
184 Ga0209672_100074 3300025228 Bacteria 159792
185 Ga0209672_100501 3300025228 Bacteria 21740
186 Ga0209147_117440 3300025229 Bacteria 687
187 Ga0209258_100004 3300025242 Bacteria 1376422
188 Ga0209258_100008 3300025242 Bacteria 1009355
189 Ga0209258_100229 3300025242 Bacteria 105671
190 Ga0209677_102248 3300025253 Bacteria 7480
191 Ga0209148_1000041 3300025254 Bacteria 469323
192 Ga0209148_1000191 3300025254 Bacteria 115847
193 Ga0209455_1000007 3300025272 Bacteria 1157983
194 Ga0209455_1003840 3300025272 Bacteria 5136
195 Ga0207692_10182552 3300025898 Bacteria 1223
196 Ga0207642_10354330 3300025899 Unclassified 867
197 Ga0207642_10405150 3300025899 Bacteria 817
198 Ga0207680_10295447 3300025903 Bacteria 1128
199 Ga0207685_10062034 3300025905 Bacteria 1484
200 Ga0207699_10836576 3300025906 Bacteria 677
201 Ga0207699_10871682 3300025906 Unclassified 664
202 Ga0207645_10427304 3300025907 Bacteria 893
203 Ga0207684_10003987 3300025910 Bacteria 14129
204 Ga0207684_10765806 3300025910 Bacteria 817
205 Ga0207684_11291900 3300025910 Bacteria 601
206 Ga0207654_11409550 3300025911 Bacteria 508
207 Ga0207707_10067205 3300025912 Unclassified 3122
208 Ga0207707_10245604 3300025912 Bacteria 1555
209 Ga0207707_10534174 3300025912 Unclassified 998
210 Ga0207695_10324493 3300025913 Bacteria 1429
211 Ga0207693_10021536 3300025915 Bacteria 5121
212 Ga0207693_10078359 3300025915 Bacteria 2587
213 Ga0207663_10060723 3300025916 Bacteria 2396
214 Ga0207663_10271265 3300025916 Unclassified 1257
215 Ga0207663_10293868 3300025916 Bacteria 1211
216 Ga0207663_10346350 3300025916 Unclassified 1124
217 Ga0207663_10629496 3300025916 Bacteria 845
218 Ga0207660_10449193 3300025917 Bacteria 1042
219 Ga0207660_10454167 3300025917 Bacteria 1036
220 Ga0207662_10095439 3300025918 Unclassified 1836
221 Ga0207657_10506543 3300025919 Bacteria 945
222 Ga0207652_10029881 3300025921 Bacteria 4561
223 Ga0207652_11204432 3300025921 Bacteria 659
224 Ga0207646_10045143 3300025922 Bacteria 3956
225 Ga0207646_11001937 3300025922 Bacteria 738
226 Ga0207694_10092349 3300025924 Bacteria 2389
227 Ga0207694_10708043 3300025924 Bacteria 849
228 Ga0207694_11084509 3300025924 Bacteria 678
229 Ga0207687_10067596 3300025927 Bacteria 2543
230 Ga0207700_10116854 3300025928 Bacteria 2156
231 Ga0207700_10295103 3300025928 Bacteria 1398
232 Ga0207700_10535462 3300025928 Unclassified 1038
233 Ga0207664_10006280 3300025929 Bacteria 8166
234 Ga0207664_10169035 3300025929 Bacteria 1870
235 Ga0207664_10346956 3300025929 Unclassified 1313
236 Ga0207664_11148064 3300025929 Bacteria 694
237 Ga0207664_11946734 3300025929 Bacteria 511
238 Ga0207644_10250486 3300025931 Bacteria 1413
239 Ga0207686_10065041 3300025934 Bacteria 2324
240 Ga0207686_10071843 3300025934 Bacteria 2228
241 Ga0207686_10109723 3300025934 Bacteria 1858
242 Ga0207670_10479014 3300025936 Bacteria 1008
243 Ga0207704_10021976 3300025938 Bacteria 3409
244 Ga0207704_10383551 3300025938 Bacteria 1104
245 Ga0207704_10387126 3300025938 Bacteria 1099
246 Ga0207665_10017873 3300025939 Bacteria 4661
247 Ga0207665_10040924 3300025939 Bacteria 3093
248 Ga0207711_10447713 3300025941 Bacteria 1202
249 Ga0207689_10343386 3300025942 Bacteria 1240
250 Ga0207689_11194947 3300025942 Bacteria 640
251 Ga0207661_10266220 3300025944 Bacteria 1528
252 Ga0207661_10465105 3300025944 Bacteria 1153
253 Ga0207661_10511913 3300025944 Unclassified 1097
254 Ga0207679_10767807 3300025945 Unclassified 877
255 Ga0207667_10776787 3300025949 Bacteria 956
256 Ga0207712_10324703 3300025961 Bacteria 1271
257 Ga0207712_10715418 3300025961 Unclassified 875
258 Ga0207712_10844579 3300025961 Bacteria 807
259 Ga0207658_10121979 3300025986 Bacteria 2080
260 Ga0207658_10504923 3300025986 Bacteria 1077
261 Ga0207678_10550389 3300026067 Bacteria 1009
262 Ga0207678_11161743 3300026067 Unclassified 684
263 Ga0207708_10039815 3300026075 Bacteria 3582
264 Ga0207708_10421404 3300026075 Bacteria 1107
265 Ga0207702_10007263 3300026078 Bacteria 9474
266 Ga0207702_10655874 3300026078 Bacteria 1032
267 Ga0207641_10053812 3300026088 Bacteria 3414
268 Ga0207641_10304007 3300026088 Bacteria 1507
269 Ga0207676_11270169 3300026095 Bacteria 731
270 Ga0207675_100020365 3300026118 Bacteria 6183
271 Ga0207675_100075487 3300026118 Bacteria 3155
272 Ga0207683_10009317 3300026121 Bacteria 8365
273 Ga0207698_10716939 3300026142 Bacteria 996
274 Ga0209179_1060096 3300027512 Bacteria 824
275 Ga0209588_1097162 3300027671 Bacteria 948
276 Ga0209588_1109324 3300027671 Bacteria 888
277 Ga0207428_10051510 3300027907 Unclassified 3291
278 Ga0268266_10000768 3300028379 Bacteria 42899
279 Ga0268266_10303800 3300028379 Bacteria 1489
280 Ga0268265_10254711 3300028380 Bacteria 1557
281 Ga0268265_11482520 3300028380 Unclassified 682
282 Ga0265334_10000010 3300028573 Bacteria 188179
283 Ga0265334_10024571 3300028573 Bacteria 2442
284 Ga0307515_10010605 3300028794 Bacteria 17635
285 Ga0265338_10030563 3300028800 Bacteria 5302
286 Ga0265760_10023448 3300031090 Bacteria 1793
287 Ga0265328_10230454 3300031239 Bacteria 707
288 Ga0265340_10322738 3300031247 Bacteria 683
289 Ga0265331_10012593 3300031250 Bacteria 4574
290 Ga0265331_10019654 3300031250 Unclassified 3485
291 Ga0307513_10003074 3300031456 Bacteria 22759
292 Ga0307513_10414173 3300031456 Bacteria 1079
293 Ga0307509_10062369 3300031507 Bacteria 3931
294 Ga0307408_100123300 3300031548 Bacteria 2011
295 Ga0265313_10000125 3300031595 Bacteria 77022
296 Ga0265313_10000583 3300031595 Bacteria 38024
297 Ga0265313_10005387 3300031595 Bacteria 9440
298 Ga0307508_10001520 3300031616 Bacteria 25886
299 Ga0307508_10003670 3300031616 Bacteria 15380
300 Ga0307508_10006589 3300031616 Bacteria 10904
301 Ga0265314_10124185 3300031711 Bacteria 1620
302 Ga0265342_10098813 3300031712 Bacteria 1665
303 Ga0307516_10000641 3300031730 Bacteria 47311
304 Ga0307405_11493122 3300031731 Unclassified 593
305 Ga0307413_10028800 3300031824 Unclassified 3099
306 Ga0307410_10006501 3300031852 Bacteria 6311
307 Ga0307406_10075335 3300031901 Bacteria 2226
308 Ga0307407_10232768 3300031903 Bacteria 1252
309 Ga0307409_100097071 3300031995 Bacteria 2433
310 Ga0307416_100085733 3300032002 Unclassified 2682
311 Ga0307510_10000001 3300033180 Bacteria 1172244
312 Ga0307510_10103102 3300033180 Bacteria 2631
313 Ga0307510_10160985 3300033180 Bacteria 1841
314 Ga0373940_0240387 3300035088 Unclassified 607
315 Ga0373936_0006893 3300035113 Bacteria 4276
316 Ga0373954_0206918 3300035118 Bacteria 964
317 Ga0373960_0358587 3300035121 Bacteria 554
318 Ga0373943_0281746 3300035170 Bacteria 940
319 Ga0373931_0642011 3300035691 Bacteria 697
320 Ga0373927_0050670 3300035695 Bacteria 2685
321 Ga0373927_0321462 3300035695 Bacteria 1019
322 Ga0373933_0239938 3300035724 Bacteria 1166
323 Ga0373937_0160438 3300036401 Bacteria 2108
324 Ga0395899_0000051 3300037312 Bacteria 222620
325 Ga0395900_0000047 3300037418 Bacteria 230039
326 Ga0395898_0000090 3300037466 Bacteria 237876
327 Ga0395898_0032247 3300037466 Bacteria 5229
328 Ga0395905_0325201 3300037471 Bacteria 1428
329 Ga0395901_0044863 3300038443 Bacteria 4585
330 Ga0395901_1037032 3300038443 Bacteria 794
331 Ga0436360_0665360 3300039438 Unclassified 1288
332 Ga0436360_0853982 3300039438 Unclassified 517
333 Ga0436360_0963817 3300039438 Bacteria 3436
334 Ga0436361_0280419 3300039447 Bacteria 779
335 Ga0436361_0569891 3300039447 Bacteria 11823
336 Ga0436363_1605196 3300039450 Bacteria 1328
337 Ga0436362_0546971 3300039453 Bacteria 657
338 Ga0436362_0579364 3300039453 Bacteria 655
339 Ga0436362_0709855 3300039453 Bacteria 699
340 Ga0451798_0064347 3300041458 Unclassified 890
341 Ga0451807_0650615 3300041486 Unclassified 550
342 Ga0439450_036297 3300042008 Bacteria 1128
343 Ga0439456_127018 3300042013 Bacteria 587
344 Ga0466969_0046155 3300044656 Bacteria 2160
345 Ga0466975_0290894 3300044661 Bacteria 1056
346 Ga0466965_0028758 3300044683 Bacteria 2701
347 Ga0466966_0012843 3300044684 Bacteria 5545
348 Ga0466961_0000281 3300044693 Bacteria 33824
349 Ga0466961_0000682 3300044693 Bacteria 21417
350 Ga0466961_0007290 3300044693 Bacteria 7036
351 Ga0466961_0409940 3300044693 Bacteria 822
352 Ga0466971_0003509 3300044719 Bacteria 6699
353 Ga0466971_0368080 3300044719 Bacteria 697
354 Ga0466957_0153809 3300044842 Bacteria 1489
355 Ga0466959_0008906 3300045049 Bacteria 7116
356 Ga0466959_0252103 3300045049 Bacteria 1217
357 Ga0451576_0399814 3300045051 Bacteria 1440
358 Ga0451576_1594335 3300045051 Unclassified 677
359 Ga0466958_0037202 3300045836 Bacteria 2916
360 Ga0466958_0049136 3300045836 Bacteria 2551
361 Ga0466958_0390647 3300045836 Bacteria 898
362 Ga0466958_0401437 3300045836 Unclassified 885
363 Ga0495580_0022404 3300046472 Bacteria 4648
364 Ga0495580_0131171 3300046472 Bacteria 1738
365 Ga0495606_0595813 3300046507 Bacteria 543
366 Ga0495608_0315083 3300046511 Bacteria 967
367 Ga0495618_0192488 3300046514 Bacteria 1293
368 Ga0495630_0565630 3300046517 Bacteria 872
369 Ga0495642_0420289 3300046528 Bacteria 590
370 Ga0495622_0377656 3300046557 Bacteria 612
371 Ga0495625_0236124 3300046660 Bacteria 1192
372 Ga0495658_0452986 3300046683 Bacteria 820
373 Ga0495613_0292587 3300046689 Bacteria 1129
374 Ga0495624_0954227 3300046690 Bacteria 504
375 Ga0495670_0834404 3300046691 Unclassified 503
376 Ga0495636_0050418 3300047318 Bacteria 1742
377 Ga0495636_0434977 3300047318 Bacteria 628
378 Ga0495674_0259434 3300047319 Bacteria 1428
379 Ga0495593_0343836 3300047673 Bacteria 746
380 Ga0496100_0132654 3300048903 Bacteria 1756
381 Ga0496101_1072211 3300048904 Bacteria 633
382 Ga0496102_0181830 3300048905 Bacteria 1981
383 Ga0496102_0362319 3300048905 Bacteria 1365
384 Ga0496103_0313781 3300048906 Bacteria 1009
385 Ga0496104_0033953 3300048907 Bacteria 4755
386 Ga0496105_0023111 3300048908 Bacteria 5041
387 Ga0496106_0107665 3300048909 Bacteria 2168
388 Ga0496107_0043247 3300048910 Bacteria 3236
389 Ga0496108_0014980 3300048911 Bacteria 6329
390 Ga0496108_0458419 3300048911 Bacteria 1114
391 Ga0496108_0563054 3300048911 Bacteria 994
392 Ga0496109_0897120 3300048912 Bacteria 824
393 Ga0496110_0032363 3300048913 Bacteria 4515
394 Ga0496110_0381482 3300048913 Bacteria 1284
395 Ga0496110_0972822 3300048913 Bacteria 756
396 Ga0496111_0011565 3300048914 Bacteria 5951
397 Ga0496111_0234765 3300048914 Bacteria 1362
398 Ga0496112_0695214 3300048915 Bacteria 945
399 Ga0496113_0317049 3300048916 Bacteria 1249
400 Ga0496114_0238535 3300048917 Bacteria 1598
401 Ga0496125_0680931 3300048928 Bacteria 549
402 Ga0496126_0012505 3300048929 Bacteria 8690
403 Ga0501036_0232284 3300049572 Bacteria 1548
404 Ga0501037_1071620 3300049573 Bacteria 523
405 Ga0501039_1083446 3300049575 Unclassified 621
406 Ga0501041_0214040 3300049577 Bacteria 1209
407 Ga0501041_0505184 3300049577 Unclassified 769
408 Ga0501042_0233850 3300049578 Bacteria 1326
409 Ga0501043_0130842 3300049579 Bacteria 1967
410 Ga0501046_0430209 3300049580 Bacteria 951
411 Ga0501047_0391100 3300049581 Bacteria 1224
412 Ga0501071_0359330 3300049587 Bacteria 1109
413 Ga0501072_0223619 3300049588 Unclassified 1500
414 Ga0501076_0341380 3300049592 Bacteria 1229
415 Ga0501079_1018100 3300049741 Bacteria 652
416 Ga0501081_0359184 3300049743 Unclassified 1074
417 Ga0501081_1442295 3300049743 Bacteria 523
418 Ga0501083_0340118 3300049744 Bacteria 976
419 Ga0501035_0907963 3300049822 Bacteria 697
420 nmdc:mga03683_465436_c1 3300050489 Bacteria 609
421 nmdc:mga05p37_404119_c1 3300050507 Bacteria 1594
422 nmdc:mga05p37_64729_c2 3300050507 Bacteria 1408
423 nmdc:mga05p37_829455_c1 3300050507 Bacteria 1007
424 nmdc:mga06r32_1472348_c1 3300050510 Unclassified 621
425 nmdc:mga08y16_351796_c1 3300050511 Unclassified 1513
426 nmdc:mga0n895_535390_c1 3300050512 Bacteria 1178
427 nmdc:mga0rr50_927912_c1 3300050513 Bacteria 742
428 nmdc:mga0a205_1277795_c1 3300050515 Bacteria 582
429 nmdc:mga0a205_1299833_c1 3300050515 Bacteria 575
430 nmdc:mga0a205_142927_c1 3300050515 Unclassified 2293
431 Ga0500583_0061958 3300053092 Bacteria 1768
432 Ga0500566_0092968 3300053094 Unclassified 1665
433 Ga0500554_044379 3300053102 Unclassified 1378
434 Ga0500597_086086 3300053120 Unclassified 1364
435 Ga0500614_036436 3300053123 Unclassified 1230
436 Ga0500642_0284448 3300053130 Bacteria 750
437 Ga0500588_0018732 3300053146 Unclassified 1829
438 Ga0500604_0000444 3300053151 Bacteria 11373
439 Ga0500636_0203576 3300053177 Bacteria 1045
440 Ga0500637_0029355 3300053178 Bacteria 3050
441 Ga0500637_0469936 3300053178 Bacteria 632
442 Ga0501084_0311111 3300054114 Bacteria 1330
443 Ga0501082_0446496 3300060353 Bacteria 1130
444 Ga0466962_0001709 3300061719 Bacteria 10307
445 Ga0466962_0193272 3300061719 Bacteria 993
446 Ga0530510_0103531 3300061734 Bacteria 2082
447 Ga0530510_0349682 3300061734 Unclassified 1110

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100567456 Ga0068869_1005674561 116
2 3300006358 Ga0068871_100173035 Ga0068871_1001730352 116
3 3300025942 Ga0207689_11194947 Ga0207689_111949472 116
4 3300050515 nmdc:mga0a205_142927_c1 nmdc:mga0a205_142927_c1_587_964 118
5 3300026075 Ga0207708_10421404 Ga0207708_104214042 123
6 3300031507 Ga0307509_10062369 Ga0307509_100623692 124
7 3300046507 Ga0495606_0595813 Ga0495606_0595813_27_416 124
8 3300046528 Ga0495642_0420289 Ga0495642_0420289_97_486 124
9 3300046557 Ga0495622_0377656 Ga0495622_0377656_153_533 124
10 3300046660 Ga0495625_0236124 Ga0495625_0236124_351_740 124
11 3300046683 Ga0495658_0452986 Ga0495658_0452986_319_693 124
12 3300053102 Ga0500554_044379 Ga0500554_044379_410_790 124
13 3300053120 Ga0500597_086086 Ga0500597_086086_892_1272 124
14 3300053123 Ga0500614_036436 Ga0500614_036436_424_804 124
15 3300053178 Ga0500637_0029355 Ga0500637_0029355_1675_2055 124
16 3300005343 Ga0070687_100438221 Ga0070687_1004382211 125
17 3300005365 Ga0070688_100665728 Ga0070688_1006657282 125
18 3300005564 Ga0070664_101399843 Ga0070664_1013998431 125
19 3300025918 Ga0207662_10095439 Ga0207662_100954393 125
20 3300028794 Ga0307515_10010605 Ga0307515_100106055 125
21 3300053092 Ga0500583_0061958 Ga0500583_0061958_197_577 125
22 3300053094 Ga0500566_0092968 Ga0500566_0092968_843_1223 125
23 3300053130 Ga0500642_0284448 Ga0500642_0284448_311_691 125
24 2162886012 MBSR1b_contig_988365 MBSR1b_0644.00002890 126
25 3300003756 Ga0055533_1010308 Ga0055533_10103082 126
26 3300003760 Ga0055527_1000037 Ga0055527_100003779 126
27 3300003760 Ga0055527_1003838 Ga0055527_10038383 126
28 3300003761 Ga0055535_1000059 Ga0055535_100005979 126
29 3300003761 Ga0055535_1000211 Ga0055535_100021128 126
30 3300003762 Ga0055542_1000086 Ga0055542_100008617 126
31 3300003762 Ga0055542_1000117 Ga0055542_100011727 126
32 3300003763 Ga0055529_1000212 Ga0055529_100021217 126
33 3300005336 Ga0070680_100126212 Ga0070680_1001262122 126
34 3300005336 Ga0070680_100320172 Ga0070680_1003201721 126
35 3300005338 Ga0068868_100097292 Ga0068868_1000972923 126
36 3300005339 Ga0070660_100742050 Ga0070660_1007420501 126
37 3300005340 Ga0070689_101372433 Ga0070689_1013724332 126
38 3300005347 Ga0070668_101294955 Ga0070668_1012949552 126
39 3300005355 Ga0070671_100302698 Ga0070671_1003026982 126
40 3300005355 Ga0070671_101826372 Ga0070671_1018263721 126
41 3300005356 Ga0070674_101021986 Ga0070674_1010219861 126
42 3300005356 Ga0070674_101955405 Ga0070674_1019554051 126
43 3300005364 Ga0070673_100057655 Ga0070673_1000576552 126
44 3300005366 Ga0070659_100265649 Ga0070659_1002656492 126
45 3300005366 Ga0070659_101399164 Ga0070659_1013991641 126
46 3300005434 Ga0070709_10640450 Ga0070709_106404502 126
47 3300005434 Ga0070709_11164117 Ga0070709_111641171 126
48 3300005435 Ga0070714_100207834 Ga0070714_1002078341 126
49 3300005435 Ga0070714_100256697 Ga0070714_1002566972 126
50 3300005435 Ga0070714_101426320 Ga0070714_1014263202 126
51 3300005435 Ga0070714_101750654 Ga0070714_1017506542 126
52 3300005436 Ga0070713_100044282 Ga0070713_1000442822 126
53 3300005436 Ga0070713_100144848 Ga0070713_1001448482 126
54 3300005436 Ga0070713_101041208 Ga0070713_1010412082 126
55 3300005436 Ga0070713_101449207 Ga0070713_1014492071 126
56 3300005437 Ga0070710_10079710 Ga0070710_100797103 126
57 3300005437 Ga0070710_10107638 Ga0070710_101076382 126
58 3300005437 Ga0070710_10181445 Ga0070710_101814452 126
59 3300005437 Ga0070710_10189462 Ga0070710_101894622 126
60 3300005439 Ga0070711_100750849 Ga0070711_1007508491 126
61 3300005440 Ga0070705_100339477 Ga0070705_1003394772 126
62 3300005440 Ga0070705_101440542 Ga0070705_1014405421 126
63 3300005441 Ga0070700_100047967 Ga0070700_1000479673 126
64 3300005444 Ga0070694_100011261 Ga0070694_1000112618 126
65 3300005445 Ga0070708_100078097 Ga0070708_1000780974 126
66 3300005445 Ga0070708_101473761 Ga0070708_1014737611 126
67 3300005456 Ga0070678_100898347 Ga0070678_1008983472 126
68 3300005456 Ga0070678_101775321 Ga0070678_1017753211 126
69 3300005457 Ga0070662_101004833 Ga0070662_1010048332 126
70 3300005458 Ga0070681_10044671 Ga0070681_100446714 126
71 3300005458 Ga0070681_10164501 Ga0070681_101645012 126
72 3300005458 Ga0070681_10608393 Ga0070681_106083932 126
73 3300005467 Ga0070706_100557803 Ga0070706_1005578033 126
74 3300005468 Ga0070707_100704664 Ga0070707_1007046642 126
75 3300005468 Ga0070707_102262117 Ga0070707_1022621171 126
76 3300005471 Ga0070698_100445108 Ga0070698_1004451081 126
77 3300005471 Ga0070698_100449407 Ga0070698_1004494071 126
78 3300005518 Ga0070699_100642356 Ga0070699_1006423561 126
79 3300005518 Ga0070699_101469453 Ga0070699_1014694531 126
80 3300005530 Ga0070679_100007825 Ga0070679_1000078259 126
81 3300005530 Ga0070679_100083013 Ga0070679_1000830135 126
82 3300005530 Ga0070679_100340045 Ga0070679_1003400452 126
83 3300005535 Ga0070684_101808289 Ga0070684_1018082891 126
84 3300005536 Ga0070697_100497943 Ga0070697_1004979432 126
85 3300005536 Ga0070697_101317980 Ga0070697_1013179802 126
86 3300005536 Ga0070697_101369978 Ga0070697_1013699781 126
87 3300005544 Ga0070686_101745994 Ga0070686_1017459941 126
88 3300005545 Ga0070695_100007484 Ga0070695_1000074847 126
89 3300005545 Ga0070695_100201651 Ga0070695_1002016511 126
90 3300005547 Ga0070693_100326429 Ga0070693_1003264292 126
91 3300005548 Ga0070665_100001987 Ga0070665_10000198720 126
92 3300005548 Ga0070665_100281036 Ga0070665_1002810362 126
93 3300005548 Ga0070665_102601914 Ga0070665_1026019141 126
94 3300005549 Ga0070704_100225701 Ga0070704_1002257012 126
95 3300005563 Ga0068855_100155403 Ga0068855_1001554032 126
96 3300005563 Ga0068855_100299237 Ga0068855_1002992372 126
97 3300005563 Ga0068855_100672615 Ga0068855_1006726151 126
98 3300005577 Ga0068857_100674431 Ga0068857_1006744312 126
99 3300005614 Ga0068856_100028366 Ga0068856_1000283663 126
100 3300005614 Ga0068856_100123907 Ga0068856_1001239073 126
101 3300005614 Ga0068856_100186604 Ga0068856_1001866043 126
102 3300005615 Ga0070702_100846906 Ga0070702_1008469062 126
103 3300005616 Ga0068852_100521007 Ga0068852_1005210072 126
104 3300005617 Ga0068859_101162048 Ga0068859_1011620482 126
105 3300005718 Ga0068866_10265228 Ga0068866_102652282 126
106 3300005719 Ga0068861_100027380 Ga0068861_1000273806 126
107 3300005719 Ga0068861_100071036 Ga0068861_1000710361 126
108 3300005719 Ga0068861_101776835 Ga0068861_1017768352 126
109 3300005841 Ga0068863_100021185 Ga0068863_1000211855 126
110 3300005841 Ga0068863_100108348 Ga0068863_1001083483 126
111 3300005841 Ga0068863_100994301 Ga0068863_1009943011 126
112 3300005844 Ga0068862_100125299 Ga0068862_1001252992 126
113 3300005844 Ga0068862_102342868 Ga0068862_1023428681 126
114 3300005937 Ga0081455_10005657 Ga0081455_100056571 126
115 3300005937 Ga0081455_10321502 Ga0081455_103215022 126
116 3300005981 Ga0081538_10020752 Ga0081538_100207526 126
117 3300005983 Ga0081540_1000224 Ga0081540_100022432 126
118 3300005983 Ga0081540_1002501 Ga0081540_10025016 126
119 3300006028 Ga0070717_10054997 Ga0070717_100549973 126
120 3300006028 Ga0070717_10500968 Ga0070717_105009681 126
121 3300006042 Ga0075368_10558528 Ga0075368_105585281 126
122 3300006163 Ga0070715_10039165 Ga0070715_100391652 126
123 3300006173 Ga0070716_100012569 Ga0070716_1000125695 126
124 3300006173 Ga0070716_100091702 Ga0070716_1000917023 126
125 3300006173 Ga0070716_101465078 Ga0070716_1014650781 126
126 3300006175 Ga0070712_100027017 Ga0070712_1000270176 126
127 3300006175 Ga0070712_100073786 Ga0070712_1000737862 126
128 3300006175 Ga0070712_100216506 Ga0070712_1002165063 126
129 3300006175 Ga0070712_100375310 Ga0070712_1003753102 126
130 3300006178 Ga0075367_10600954 Ga0075367_106009542 126
131 3300006237 Ga0097621_100035913 Ga0097621_1000359136 126
132 3300006237 Ga0097621_100084235 Ga0097621_1000842353 126
133 3300006237 Ga0097621_100526944 Ga0097621_1005269441 126
134 3300006358 Ga0068871_100204978 Ga0068871_1002049783 126
135 3300006358 Ga0068871_100343531 Ga0068871_1003435312 126
136 3300006358 Ga0068871_101190011 Ga0068871_1011900111 126
137 3300006844 Ga0075428_100058458 Ga0075428_1000584582 126
138 3300006847 Ga0075431_101527380 Ga0075431_1015273802 126
139 3300006852 Ga0075433_10194433 Ga0075433_101944332 126
140 3300006852 Ga0075433_10829889 Ga0075433_108298891 126
141 3300006871 Ga0075434_100379385 Ga0075434_1003793852 126
142 3300006881 Ga0068865_100009997 Ga0068865_1000099976 126
143 3300006881 Ga0068865_100044894 Ga0068865_1000448944 126
144 3300006881 Ga0068865_100071760 Ga0068865_1000717604 126
145 3300006931 Ga0097620_101161839 Ga0097620_1011618391 126
146 3300007076 Ga0075435_100521755 Ga0075435_1005217552 126
147 3300007076 Ga0075435_101006153 Ga0075435_1010061532 126
148 3300007265 Ga0099794_10017786 Ga0099794_100177861 126
149 3300007265 Ga0099794_10082105 Ga0099794_100821052 126
150 3300007265 Ga0099794_10085004 Ga0099794_100850042 126
151 3300007265 Ga0099794_10493418 Ga0099794_104934181 126
152 3300007788 Ga0099795_10000383 Ga0099795_100003836 126
153 3300007788 Ga0099795_10052309 Ga0099795_100523092 126
154 3300009093 Ga0105240_10026148 Ga0105240_100261488 126
155 3300009093 Ga0105240_10034070 Ga0105240_100340706 126
156 3300009093 Ga0105240_10067118 Ga0105240_100671183 126
157 3300009093 Ga0105240_10320647 Ga0105240_103206473 126
158 3300009093 Ga0105240_10490491 Ga0105240_104904913 126
159 3300009093 Ga0105240_12004035 Ga0105240_120040351 126
160 3300009094 Ga0111539_10155541 Ga0111539_101555414 126
161 3300009098 Ga0105245_10469246 Ga0105245_104692462 126
162 3300009098 Ga0105245_10856787 Ga0105245_108567872 126
163 3300009101 Ga0105247_10086945 Ga0105247_100869452 126
164 3300009147 Ga0114129_10051094 Ga0114129_100510945 126
165 3300009147 Ga0114129_10086707 Ga0114129_100867075 126
166 3300009147 Ga0114129_11265802 Ga0114129_112658022 126
167 3300009174 Ga0105241_10008916 Ga0105241_100089168 126
168 3300009174 Ga0105241_11400248 Ga0105241_114002481 126
169 3300009176 Ga0105242_10026836 Ga0105242_100268364 126
170 3300009176 Ga0105242_10061062 Ga0105242_100610626 126
171 3300009176 Ga0105242_10116301 Ga0105242_101163014 126
172 3300009176 Ga0105242_11419026 Ga0105242_114190262 126
173 3300009545 Ga0105237_10131844 Ga0105237_101318445 126
174 3300009545 Ga0105237_10156404 Ga0105237_101564041 126
175 3300009545 Ga0105237_11095454 Ga0105237_110954541 126
176 3300009551 Ga0105238_10025022 Ga0105238_100250221 126
177 3300009551 Ga0105238_10143285 Ga0105238_101432855 126
178 3300009551 Ga0105238_10506068 Ga0105238_105060682 126
179 3300009551 Ga0105238_10645731 Ga0105238_106457312 126
180 3300009553 Ga0105249_10364634 Ga0105249_103646342 126
181 3300010159 Ga0099796_10018428 Ga0099796_100184282 126
182 3300010375 Ga0105239_11536766 Ga0105239_115367661 126
183 3300010375 Ga0105239_12070656 Ga0105239_120706562 126
184 3300013104 Ga0157370_10786310 Ga0157370_107863101 126
185 3300013105 Ga0157369_10082617 Ga0157369_100826174 126
186 3300013105 Ga0157369_10491230 Ga0157369_104912301 126
187 3300013296 Ga0157374_10583821 Ga0157374_105838211 126
188 3300013297 Ga0157378_10061824 Ga0157378_100618245 126
189 3300013297 Ga0157378_10205687 Ga0157378_102056872 126
190 3300013297 Ga0157378_10948074 Ga0157378_109480741 126
191 3300013306 Ga0163162_10036550 Ga0163162_100365506 126
192 3300013306 Ga0163162_12963023 Ga0163162_129630231 126
193 3300013307 Ga0157372_10122765 Ga0157372_101227653 126
194 3300013307 Ga0157372_10308807 Ga0157372_103088072 126
195 3300013308 Ga0157375_10509897 Ga0157375_105098972 126
196 3300014325 Ga0163163_10849693 Ga0163163_108496932 126
197 3300014968 Ga0157379_10749075 Ga0157379_107490751 126
198 3300014968 Ga0157379_10928029 Ga0157379_109280292 126
199 3300017792 Ga0163161_10361681 Ga0163161_103616812 126
200 3300021441 Ga0213871_10065044 Ga0213871_100650441 126
201 3300025226 Ga0209674_100134 Ga0209674_10013454 126
202 3300025228 Ga0209672_100074 Ga0209672_10007417 126
203 3300025228 Ga0209672_100501 Ga0209672_10050110 126
204 3300025229 Ga0209147_117440 Ga0209147_1174402 126
205 3300025242 Ga0209258_100004 Ga0209258_1000041157 126
206 3300025242 Ga0209258_100008 Ga0209258_100008782 126
207 3300025242 Ga0209258_100229 Ga0209258_10022947 126
208 3300025253 Ga0209677_102248 Ga0209677_1022485 126
209 3300025254 Ga0209148_1000041 Ga0209148_1000041284 126
210 3300025254 Ga0209148_1000191 Ga0209148_100019147 126
211 3300025272 Ga0209455_1000007 Ga0209455_1000007902 126
212 3300025272 Ga0209455_1003840 Ga0209455_10038403 126
213 3300025898 Ga0207692_10182552 Ga0207692_101825522 126
214 3300025899 Ga0207642_10354330 Ga0207642_103543302 126
215 3300025899 Ga0207642_10405150 Ga0207642_104051501 126
216 3300025903 Ga0207680_10295447 Ga0207680_102954471 126
217 3300025905 Ga0207685_10062034 Ga0207685_100620341 126
218 3300025906 Ga0207699_10836576 Ga0207699_108365761 126
219 3300025906 Ga0207699_10871682 Ga0207699_108716822 126
220 3300025907 Ga0207645_10427304 Ga0207645_104273042 126
221 3300025910 Ga0207684_10003987 Ga0207684_100039879 126
222 3300025910 Ga0207684_10765806 Ga0207684_107658062 126
223 3300025910 Ga0207684_11291900 Ga0207684_112919001 126
224 3300025911 Ga0207654_11409550 Ga0207654_114095501 126
225 3300025912 Ga0207707_10067205 Ga0207707_100672054 126
226 3300025912 Ga0207707_10245604 Ga0207707_102456042 126
227 3300025912 Ga0207707_10534174 Ga0207707_105341742 126
228 3300025913 Ga0207695_10324493 Ga0207695_103244931 126
229 3300025915 Ga0207693_10021536 Ga0207693_100215366 126
230 3300025915 Ga0207693_10078359 Ga0207693_100783592 126
231 3300025916 Ga0207663_10060723 Ga0207663_100607234 126
232 3300025916 Ga0207663_10271265 Ga0207663_102712653 126
233 3300025916 Ga0207663_10293868 Ga0207663_102938682 126
234 3300025916 Ga0207663_10346350 Ga0207663_103463501 126
235 3300025916 Ga0207663_10629496 Ga0207663_106294962 126
236 3300025917 Ga0207660_10449193 Ga0207660_104491931 126
237 3300025917 Ga0207660_10454167 Ga0207660_104541672 126
238 3300025919 Ga0207657_10506543 Ga0207657_105065432 126
239 3300025921 Ga0207652_10029881 Ga0207652_100298813 126
240 3300025921 Ga0207652_11204432 Ga0207652_112044322 126
241 3300025922 Ga0207646_10045143 Ga0207646_100451435 126
242 3300025922 Ga0207646_11001937 Ga0207646_110019371 126
243 3300025924 Ga0207694_10092349 Ga0207694_100923495 126
244 3300025924 Ga0207694_10708043 Ga0207694_107080432 126
245 3300025924 Ga0207694_11084509 Ga0207694_110845092 126
246 3300025927 Ga0207687_10067596 Ga0207687_100675963 126
247 3300025928 Ga0207700_10116854 Ga0207700_101168542 126
248 3300025928 Ga0207700_10295103 Ga0207700_102951032 126
249 3300025928 Ga0207700_10535462 Ga0207700_105354622 126
250 3300025929 Ga0207664_10006280 Ga0207664_100062802 126
251 3300025929 Ga0207664_10169035 Ga0207664_101690352 126
252 3300025929 Ga0207664_10346956 Ga0207664_103469562 126
253 3300025929 Ga0207664_11148064 Ga0207664_111480642 126
254 3300025929 Ga0207664_11946734 Ga0207664_119467341 126
255 3300025931 Ga0207644_10250486 Ga0207644_102504862 126
256 3300025934 Ga0207686_10065041 Ga0207686_100650414 126
257 3300025934 Ga0207686_10071843 Ga0207686_100718432 126
258 3300025934 Ga0207686_10109723 Ga0207686_101097232 126
259 3300025936 Ga0207670_10479014 Ga0207670_104790142 126
260 3300025938 Ga0207704_10021976 Ga0207704_100219766 126
261 3300025938 Ga0207704_10383551 Ga0207704_103835512 126
262 3300025938 Ga0207704_10387126 Ga0207704_103871261 126
263 3300025939 Ga0207665_10017873 Ga0207665_100178732 126
264 3300025939 Ga0207665_10040924 Ga0207665_100409243 126
265 3300025941 Ga0207711_10447713 Ga0207711_104477132 126
266 3300025942 Ga0207689_10343386 Ga0207689_103433862 126
267 3300025944 Ga0207661_10266220 Ga0207661_102662202 126
268 3300025944 Ga0207661_10465105 Ga0207661_104651053 126
269 3300025944 Ga0207661_10511913 Ga0207661_105119132 126
270 3300025945 Ga0207679_10767807 Ga0207679_107678072 126
271 3300025949 Ga0207667_10776787 Ga0207667_107767871 126
272 3300025961 Ga0207712_10324703 Ga0207712_103247032 126
273 3300025961 Ga0207712_10715418 Ga0207712_107154182 126
274 3300025961 Ga0207712_10844579 Ga0207712_108445791 126
275 3300025986 Ga0207658_10121979 Ga0207658_101219794 126
276 3300025986 Ga0207658_10504923 Ga0207658_105049232 126
277 3300026067 Ga0207678_10550389 Ga0207678_105503891 126
278 3300026067 Ga0207678_11161743 Ga0207678_111617432 126
279 3300026075 Ga0207708_10039815 Ga0207708_100398153 126
280 3300026078 Ga0207702_10007263 Ga0207702_100072635 126
281 3300026078 Ga0207702_10655874 Ga0207702_106558742 126
282 3300026088 Ga0207641_10053812 Ga0207641_100538122 126
283 3300026088 Ga0207641_10304007 Ga0207641_103040073 126
284 3300026095 Ga0207676_11270169 Ga0207676_112701691 126
285 3300026118 Ga0207675_100020365 Ga0207675_10002036510 126
286 3300026118 Ga0207675_100075487 Ga0207675_1000754871 126
287 3300026121 Ga0207683_10009317 Ga0207683_100093173 126
288 3300026142 Ga0207698_10716939 Ga0207698_107169392 126
289 3300027512 Ga0209179_1060096 Ga0209179_10600961 126
290 3300027671 Ga0209588_1097162 Ga0209588_10971621 126
291 3300027671 Ga0209588_1109324 Ga0209588_11093241 126
292 3300027907 Ga0207428_10051510 Ga0207428_100515102 126
293 3300028379 Ga0268266_10000768 Ga0268266_1000076832 126
294 3300028379 Ga0268266_10303800 Ga0268266_103038002 126
295 3300028380 Ga0268265_10254711 Ga0268265_102547112 126
296 3300028380 Ga0268265_11482520 Ga0268265_114825201 126
297 3300028573 Ga0265334_10000010 Ga0265334_10000010176 126
298 3300028573 Ga0265334_10024571 Ga0265334_100245712 126
299 3300028800 Ga0265338_10030563 Ga0265338_100305636 126
300 3300031090 Ga0265760_10023448 Ga0265760_100234483 126
301 3300031239 Ga0265328_10230454 Ga0265328_102304541 126
302 3300031247 Ga0265340_10322738 Ga0265340_103227382 126
303 3300031250 Ga0265331_10012593 Ga0265331_100125932 126
304 3300031250 Ga0265331_10019654 Ga0265331_100196545 126
305 3300031456 Ga0307513_10003074 Ga0307513_1000307422 126
306 3300031456 Ga0307513_10414173 Ga0307513_104141733 126
307 3300031548 Ga0307408_100123300 Ga0307408_1001233003 126
308 3300031595 Ga0265313_10000125 Ga0265313_1000012571 126
309 3300031595 Ga0265313_10000583 Ga0265313_1000058315 126
310 3300031595 Ga0265313_10005387 Ga0265313_100053873 126
311 3300031616 Ga0307508_10001520 Ga0307508_1000152040 126
312 3300031616 Ga0307508_10003670 Ga0307508_1000367010 126
313 3300031616 Ga0307508_10006589 Ga0307508_1000658910 126
314 3300031711 Ga0265314_10124185 Ga0265314_101241852 126
315 3300031712 Ga0265342_10098813 Ga0265342_100988132 126
316 3300031730 Ga0307516_10000641 Ga0307516_1000064133 126
317 3300031731 Ga0307405_11493122 Ga0307405_114931222 126
318 3300031824 Ga0307413_10028800 Ga0307413_100288006 126
319 3300031852 Ga0307410_10006501 Ga0307410_100065016 126
320 3300031901 Ga0307406_10075335 Ga0307406_100753353 126
321 3300031903 Ga0307407_10232768 Ga0307407_102327682 126
322 3300031995 Ga0307409_100097071 Ga0307409_1000970714 126
323 3300032002 Ga0307416_100085733 Ga0307416_1000857332 126
324 3300033180 Ga0307510_10000001 Ga0307510_10000001387 126
325 3300033180 Ga0307510_10103102 Ga0307510_101031021 126
326 3300033180 Ga0307510_10160985 Ga0307510_101609852 126
327 3300035088 Ga0373940_0240387 Ga0373940_0240387_98_478 126
328 3300035113 Ga0373936_0006893 Ga0373936_0006893_110_490 126
329 3300035118 Ga0373954_0206918 Ga0373954_0206918_547_927 126
330 3300035121 Ga0373960_0358587 Ga0373960_0358587_11_391 126
331 3300035170 Ga0373943_0281746 Ga0373943_0281746_291_671 126
332 3300035691 Ga0373931_0642011 Ga0373931_0642011_279_659 126
333 3300035695 Ga0373927_0050670 Ga0373927_0050670_582_962 126
334 3300035695 Ga0373927_0321462 Ga0373927_0321462_375_770 126
335 3300035724 Ga0373933_0239938 Ga0373933_0239938_207_587 126
336 3300036401 Ga0373937_0160438 Ga0373937_0160438_1440_1820 126
337 3300037312 Ga0395899_0000051 Ga0395899_0000051_61004_61384 126
338 3300037418 Ga0395900_0000047 Ga0395900_0000047_158415_158795 126
339 3300037466 Ga0395898_0000090 Ga0395898_0000090_161237_161617 126
340 3300037466 Ga0395898_0032247 Ga0395898_0032247_1099_1479 126
341 3300037471 Ga0395905_0325201 Ga0395905_0325201_247_666 126
342 3300038443 Ga0395901_0044863 Ga0395901_0044863_1984_2364 126
343 3300038443 Ga0395901_1037032 Ga0395901_1037032_176_595 126
344 3300039438 Ga0436360_0665360 Ga0436360_0665360_208_588 126
345 3300039438 Ga0436360_0853982 Ga0436360_0853982_86_466 126
346 3300039438 Ga0436360_0963817 Ga0436360_0963817_1823_2203 126
347 3300039447 Ga0436361_0280419 Ga0436361_0280419_92_472 126
348 3300039447 Ga0436361_0569891 Ga0436361_0569891_9455_9835 126
349 3300039450 Ga0436363_1605196 Ga0436363_1605196_496_876 126
350 3300039453 Ga0436362_0546971 Ga0436362_0546971_46_426 126
351 3300039453 Ga0436362_0579364 Ga0436362_0579364_32_412 126
352 3300039453 Ga0436362_0709855 Ga0436362_0709855_171_551 126
353 3300041458 Ga0451798_0064347 Ga0451798_0064347_457_837 126
354 3300041486 Ga0451807_0650615 Ga0451807_0650615_117_497 126
355 3300042008 Ga0439450_036297 Ga0439450_036297_173_553 126
356 3300042013 Ga0439456_127018 Ga0439456_127018_67_447 126
357 3300044656 Ga0466969_0046155 Ga0466969_0046155_1260_1640 126
358 3300044661 Ga0466975_0290894 Ga0466975_0290894_83_463 126
359 3300044683 Ga0466965_0028758 Ga0466965_0028758_601_981 126
360 3300044684 Ga0466966_0012843 Ga0466966_0012843_4191_4571 126
361 3300044693 Ga0466961_0000281 Ga0466961_0000281_7106_7486 126
362 3300044693 Ga0466961_0000682 Ga0466961_0000682_11289_11669 126
363 3300044693 Ga0466961_0007290 Ga0466961_0007290_5594_5974 126
364 3300044693 Ga0466961_0409940 Ga0466961_0409940_392_772 126
365 3300044719 Ga0466971_0003509 Ga0466971_0003509_2807_3187 126
366 3300044719 Ga0466971_0368080 Ga0466971_0368080_43_423 126
367 3300044842 Ga0466957_0153809 Ga0466957_0153809_174_554 126
368 3300045049 Ga0466959_0008906 Ga0466959_0008906_2379_2759 126
369 3300045049 Ga0466959_0252103 Ga0466959_0252103_764_1144 126
370 3300045051 Ga0451576_0399814 Ga0451576_0399814_182_562 126
371 3300045051 Ga0451576_1594335 Ga0451576_1594335_177_557 126
372 3300045836 Ga0466958_0037202 Ga0466958_0037202_1412_1792 126
373 3300045836 Ga0466958_0049136 Ga0466958_0049136_1492_1872 126
374 3300045836 Ga0466958_0390647 Ga0466958_0390647_29_409 126
375 3300045836 Ga0466958_0401437 Ga0466958_0401437_111_491 126
376 3300046472 Ga0495580_0022404 Ga0495580_0022404_1625_2005 126
377 3300046472 Ga0495580_0131171 Ga0495580_0131171_1290_1670 126
378 3300046511 Ga0495608_0315083 Ga0495608_0315083_387_767 126
379 3300046514 Ga0495618_0192488 Ga0495618_0192488_824_1204 126
380 3300046517 Ga0495630_0565630 Ga0495630_0565630_304_684 126
381 3300046689 Ga0495613_0292587 Ga0495613_0292587_721_1101 126
382 3300046690 Ga0495624_0954227 Ga0495624_0954227_66_446 126
383 3300046691 Ga0495670_0834404 Ga0495670_0834404_61_453 126
384 3300047318 Ga0495636_0050418 Ga0495636_0050418_1271_1651 126
385 3300047318 Ga0495636_0434977 Ga0495636_0434977_178_558 126
386 3300047319 Ga0495674_0259434 Ga0495674_0259434_967_1347 126
387 3300047673 Ga0495593_0343836 Ga0495593_0343836_86_466 126
388 3300048903 Ga0496100_0132654 Ga0496100_0132654_1068_1448 126
389 3300048904 Ga0496101_1072211 Ga0496101_1072211_214_594 126
390 3300048905 Ga0496102_0181830 Ga0496102_0181830_362_742 126
391 3300048905 Ga0496102_0362319 Ga0496102_0362319_195_575 126
392 3300048906 Ga0496103_0313781 Ga0496103_0313781_432_812 126
393 3300048907 Ga0496104_0033953 Ga0496104_0033953_472_852 126
394 3300048908 Ga0496105_0023111 Ga0496105_0023111_4639_5019 126
395 3300048909 Ga0496106_0107665 Ga0496106_0107665_1543_1923 126
396 3300048910 Ga0496107_0043247 Ga0496107_0043247_1329_1709 126
397 3300048911 Ga0496108_0014980 Ga0496108_0014980_4985_5365 126
398 3300048911 Ga0496108_0458419 Ga0496108_0458419_312_692 126
399 3300048911 Ga0496108_0563054 Ga0496108_0563054_298_678 126
400 3300048912 Ga0496109_0897120 Ga0496109_0897120_34_414 126
401 3300048913 Ga0496110_0032363 Ga0496110_0032363_2837_3217 126
402 3300048913 Ga0496110_0381482 Ga0496110_0381482_731_1111 126
403 3300048913 Ga0496110_0972822 Ga0496110_0972822_127_507 126
404 3300048914 Ga0496111_0011565 Ga0496111_0011565_1106_1486 126
405 3300048914 Ga0496111_0234765 Ga0496111_0234765_866_1246 126
406 3300048915 Ga0496112_0695214 Ga0496112_0695214_524_904 126
407 3300048916 Ga0496113_0317049 Ga0496113_0317049_633_1013 126
408 3300048917 Ga0496114_0238535 Ga0496114_0238535_564_944 126
409 3300048928 Ga0496125_0680931 Ga0496125_0680931_21_401 126
410 3300048929 Ga0496126_0012505 Ga0496126_0012505_1383_1763 126
411 3300049572 Ga0501036_0232284 Ga0501036_0232284_1144_1524 126
412 3300049573 Ga0501037_1071620 Ga0501037_1071620_92_472 126
413 3300049575 Ga0501039_1083446 Ga0501039_1083446_94_474 126
414 3300049577 Ga0501041_0214040 Ga0501041_0214040_415_795 126
415 3300049577 Ga0501041_0505184 Ga0501041_0505184_298_678 126
416 3300049578 Ga0501042_0233850 Ga0501042_0233850_19_399 126
417 3300049579 Ga0501043_0130842 Ga0501043_0130842_144_524 126
418 3300049580 Ga0501046_0430209 Ga0501046_0430209_488_868 126
419 3300049581 Ga0501047_0391100 Ga0501047_0391100_250_630 126
420 3300049587 Ga0501071_0359330 Ga0501071_0359330_156_536 126
421 3300049588 Ga0501072_0223619 Ga0501072_0223619_44_424 126
422 3300049592 Ga0501076_0341380 Ga0501076_0341380_701_1081 126
423 3300049741 Ga0501079_1018100 Ga0501079_1018100_138_518 126
424 3300049743 Ga0501081_0359184 Ga0501081_0359184_334_714 126
425 3300049743 Ga0501081_1442295 Ga0501081_1442295_24_404 126
426 3300049744 Ga0501083_0340118 Ga0501083_0340118_365_745 126
427 3300049822 Ga0501035_0907963 Ga0501035_0907963_293_673 126
428 3300050489 nmdc:mga03683_465436_c1 nmdc:mga03683_465436_c1_218_598 126
429 3300050507 nmdc:mga05p37_404119_c1 nmdc:mga05p37_404119_c1_1073_1537 126
430 3300050507 nmdc:mga05p37_64729_c2 nmdc:mga05p37_64729_c2_27_407 126
431 3300050507 nmdc:mga05p37_829455_c1 nmdc:mga05p37_829455_c1_298_678 126
432 3300050510 nmdc:mga06r32_1472348_c1 nmdc:mga06r32_1472348_c1_153_533 126
433 3300050511 nmdc:mga08y16_351796_c1 nmdc:mga08y16_351796_c1_310_690 126
434 3300050512 nmdc:mga0n895_535390_c1 nmdc:mga0n895_535390_c1_422_802 126
435 3300050513 nmdc:mga0rr50_927912_c1 nmdc:mga0rr50_927912_c1_243_635 126
436 3300050515 nmdc:mga0a205_1277795_c1 nmdc:mga0a205_1277795_c1_135_515 126
437 3300050515 nmdc:mga0a205_1299833_c1 nmdc:mga0a205_1299833_c1_142_522 126
438 3300053146 Ga0500588_0018732 Ga0500588_0018732_150_530 126
439 3300053151 Ga0500604_0000444 Ga0500604_0000444_5512_5892 126
440 3300053177 Ga0500636_0203576 Ga0500636_0203576_88_468 126
441 3300053178 Ga0500637_0469936 Ga0500637_0469936_179_559 126
442 3300054114 Ga0501084_0311111 Ga0501084_0311111_17_397 126
443 3300060353 Ga0501082_0446496 Ga0501082_0446496_573_953 126
444 3300061719 Ga0466962_0001709 Ga0466962_0001709_2483_2863 126
445 3300061719 Ga0466962_0193272 Ga0466962_0193272_296_676 126
446 3300061734 Ga0530510_0103531 Ga0530510_0103531_928_1308 126
447 3300061734 Ga0530510_0349682 Ga0530510_0349682_582_962 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

8

108

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z7t-assembly1.cif.gz_A nucleotide-free myosin-ii motor domain 0.9009 88 111
3ue0-assembly1.cif.gz_B crystal structure of acinetobacter baumannii pbp1a in complex with aztreonam 0.8922 88 111
3udf-assembly1.cif.gz_A crystal structure of apo pbp1a from acinetobacter baumannii 0.8911 88 111
3udi-assembly1.cif.gz_B crystal structure of acinetobacter baumannii pbp1a in complex with penicillin g 0.8888 88 111
3udx-assembly1.cif.gz_A crystal structure of acinetobacter baumannii pbp1a in complex with imipenem 0.8877 88 111
ID Description Score Start End Superfamily
af_O74839_657_709_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9499 88 111 2.30.30.60
af_Q55A48_1158_1269_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9162 88 111 2.40.50.140
af_Q8CJE3_1_67_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.9061 88 111 2.30.30.100
af_P75783_574_621_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.9056 88 111 2.30.30.60
af_P0C0S1_129_178_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8996 88 111 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A534AGY9-F1-model_v4 VOC family protein 0.9905 70 126
AF-A0A1V3QK24-F1-model_v4 Glyoxalase 0.9896 33 126
AF-A0A369ULU2-F1-model_v4 VOC family protein 0.9857 1 126
AF-A0A7Y2YD13-F1-model_v4 VOC family protein 0.9614 62 126
AF-A0A5C5TGV8-F1-model_v4 VOC family protein 0.9493 1 126

Feature Viewer

pLDDT pTM Quality
95.69 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map