F445969

General Info

Members Datasets Scaffolds Average Seq Length
447 198 442 231

Family's Representative Sequence

Representative Sequence 3300025986|Ga0207658_10352269|Ga0207658_103522692
Length 276
Sequence LIFPRRVRPEKTFHKLLVTGRDKSGNVGGMWLIPPYFLYIRCTEIKTMKIIIVTGASGNLGQAVVKKFLSEGCYVIGTTVPNDPVTISIQDKNFETVTVDLMNEDSASQFITKVIDKHGRVDTAVLTVGGFAMGKIADTKTADMVKQYKLNFETAYNTARPVFNQMIKQKGGQIFMIGSRPGSDMHNSKGMAAYGLAKSLIFRLAELMNDEAKGTNVITSVIVPSTIDTPQNRQSMPDADFNKWVKPEEIAGVIYFYCSENASIIREPVIKVYNNA

Samples

Sample ID Description Type Environment
1 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
145 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
150 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
192 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
193 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
197 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
198 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0.22
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0.67
Rhizoplane 0.22
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000395 3300002459 Bacteria 14494
2 JGI25151J46595_10004301 3300003187 Bacteria 7565
3 rootL2_10132266 3300003322 Bacteria 1743
4 rootH1_10136629 3300003323 Bacteria 1508
5 Ga0065714_10217056 3300005288 Bacteria 851
6 Ga0065712_10068275 3300005290 Bacteria 12255
7 Ga0065715_10001943 3300005293 Bacteria 6820
8 Ga0065707_10009422 3300005295 Bacteria 3810
9 Ga0070676_10016927 3300005328 Unclassified 4030
10 Ga0070683_100478243 3300005329 Bacteria 1189
11 Ga0070670_100036219 3300005331 Bacteria 4247
12 Ga0070670_100172703 3300005331 Bacteria 1875
13 Ga0070677_10126587 3300005333 Unclassified 1161
14 Ga0068869_100019620 3300005334 Bacteria 4624
15 Ga0068869_100020396 3300005334 Unclassified 4544
16 Ga0068869_100034225 3300005334 Unclassified 3593
17 Ga0068869_100184128 3300005334 Unclassified 1639
18 Ga0068869_100262164 3300005334 Bacteria 1384
19 Ga0070666_10009776 3300005335 Bacteria 5995
20 Ga0070666_10011395 3300005335 Bacteria 5578
21 Ga0070666_10032865 3300005335 Bacteria 3429
22 Ga0070666_10075093 3300005335 Bacteria 2305
23 Ga0068868_100022685 3300005338 Bacteria 4741
24 Ga0068868_100052383 3300005338 Bacteria 3213
25 Ga0068868_100052411 3300005338 Bacteria 3212
26 Ga0068868_100339962 3300005338 Unclassified 1283
27 Ga0068868_100422591 3300005338 Bacteria 1154
28 Ga0070689_100069034 3300005340 Bacteria 2757
29 Ga0070689_100070416 3300005340 Bacteria 2731
30 Ga0070668_100006547 3300005347 Bacteria 8631
31 Ga0070668_100199723 3300005347 Unclassified 1641
32 Ga0070668_100245814 3300005347 Bacteria 1484
33 Ga0070669_100015287 3300005353 Bacteria 5468
34 Ga0070669_100072655 3300005353 Bacteria 2547
35 Ga0070669_100267049 3300005353 Bacteria 1367
36 Ga0070669_100356529 3300005353 Bacteria 1188
37 Ga0070669_100749063 3300005353 Bacteria 828
38 Ga0070675_100052423 3300005354 Bacteria 3354
39 Ga0070675_100852576 3300005354 Bacteria 834
40 Ga0070671_100810948 3300005355 Bacteria 815
41 Ga0070673_100037193 3300005364 Unclassified 3707
42 Ga0070688_100015313 3300005365 Bacteria 4360
43 Ga0070688_100036653 3300005365 Bacteria 2984
44 Ga0070688_100136273 3300005365 Bacteria 1662
45 Ga0070688_100353274 3300005365 Bacteria 1077
46 Ga0070667_100203888 3300005367 Bacteria 1755
47 Ga0070667_100241407 3300005367 Bacteria 1613
48 Ga0070667_100292552 3300005367 Bacteria 1465
49 Ga0070667_100346580 3300005367 Bacteria 1344
50 Ga0070667_100502632 3300005367 Bacteria 1111
51 Ga0070700_100089664 3300005441 Bacteria 2004
52 Ga0070678_100018273 3300005456 Bacteria 4543
53 Ga0070678_101030543 3300005456 Bacteria 757
54 Ga0070662_100018171 3300005457 Bacteria 4752
55 Ga0070681_10356211 3300005458 Bacteria 1374
56 Ga0068867_100073155 3300005459 Bacteria 2567
57 Ga0068867_100199696 3300005459 Bacteria 1600
58 Ga0068867_100454157 3300005459 Bacteria 1092
59 Ga0068867_100609583 3300005459 Bacteria 953
60 Ga0070685_10001257 3300005466 Bacteria 13442
61 Ga0070685_10041606 3300005466 Bacteria 2619
62 Ga0070685_10344202 3300005466 Bacteria 1017
63 Ga0070698_100003404 3300005471 Bacteria 17491
64 Ga0070698_100006049 3300005471 Bacteria 13180
65 Ga0070698_100011917 3300005471 Bacteria 9224
66 Ga0070698_100048072 3300005471 Bacteria 4359
67 Ga0070679_100057562 3300005530 Bacteria 3874
68 Ga0070679_100068478 3300005530 Bacteria 3540
69 Ga0070679_100416972 3300005530 Bacteria 1288
70 Ga0070684_100025039 3300005535 Bacteria 5011
71 Ga0070684_100479542 3300005535 Bacteria 1151
72 Ga0068853_100012917 3300005539 Bacteria 6806
73 Ga0068853_100040380 3300005539 Bacteria 3981
74 Ga0068853_100059910 3300005539 Bacteria 3289
75 Ga0068853_100105185 3300005539 Bacteria 2500
76 Ga0068853_100187538 3300005539 Bacteria 1878
77 Ga0068853_100742322 3300005539 Bacteria 938
78 Ga0070672_100034079 3300005543 Unclassified 3861
79 Ga0070672_100166419 3300005543 Unclassified 1832
80 Ga0070672_100354439 3300005543 Bacteria 1251
81 Ga0070665_100089679 3300005548 Bacteria 3080
82 Ga0068855_100190389 3300005563 Bacteria 2314
83 Ga0070664_100025250 3300005564 Bacteria 4923
84 Ga0068854_100482633 3300005578 Unclassified 1041
85 Ga0068856_100105390 3300005614 Bacteria 2813
86 Ga0070702_100066522 3300005615 Bacteria 2114
87 Ga0068852_100494588 3300005616 Unclassified 1217
88 Ga0068859_100000249 3300005617 Bacteria 53191
89 Ga0068859_100025855 3300005617 Bacteria 5889
90 Ga0068859_100028827 3300005617 Bacteria 5567
91 Ga0068859_100047014 3300005617 Bacteria 4334
92 Ga0068859_100049901 3300005617 Bacteria 4204
93 Ga0068859_100062381 3300005617 Bacteria 3757
94 Ga0068859_100140052 3300005617 Unclassified 2493
95 Ga0068859_100237956 3300005617 Bacteria 1909
96 Ga0068859_100315972 3300005617 Bacteria 1656
97 Ga0068859_100445608 3300005617 Bacteria 1391
98 Ga0068859_100451717 3300005617 Bacteria 1381
99 Ga0068864_100012814 3300005618 Bacteria 6933
100 Ga0068864_100016084 3300005618 Bacteria 6226
101 Ga0068864_100031116 3300005618 Bacteria 4526
102 Ga0068864_100033442 3300005618 Bacteria 4371
103 Ga0068864_100048223 3300005618 Unclassified 3661
104 Ga0068864_100111549 3300005618 Bacteria 2437
105 Ga0068864_100275287 3300005618 Bacteria 1569
106 Ga0068864_100576539 3300005618 Bacteria 1090
107 Ga0068866_10017275 3300005718 Bacteria 3242
108 Ga0068866_10049038 3300005718 Unclassified 2137
109 Ga0068866_10088072 3300005718 Unclassified 1684
110 Ga0068861_100040345 3300005719 Bacteria 3491
111 Ga0068861_100227709 3300005719 Bacteria 1579
112 Ga0068861_100373963 3300005719 Bacteria 1257
113 Ga0068861_100953008 3300005719 Bacteria 816
114 Ga0068870_10118578 3300005840 Unclassified 1521
115 Ga0068870_10401754 3300005840 Bacteria 892
116 Ga0068863_100004176 3300005841 Bacteria 14261
117 Ga0068863_100021592 3300005841 Bacteria 6140
118 Ga0068863_100296679 3300005841 Bacteria 1567
119 Ga0068863_100387958 3300005841 Bacteria 1364
120 Ga0068863_100451826 3300005841 Bacteria 1261
121 Ga0068858_100099349 3300005842 Bacteria 2713
122 Ga0068860_100011603 3300005843 Bacteria 8690
123 Ga0068860_100030646 3300005843 Bacteria 5173
124 Ga0068860_100198425 3300005843 Unclassified 1944
125 Ga0068860_100270287 3300005843 Unclassified 1659
126 Ga0068862_100035394 3300005844 Bacteria 4229
127 Ga0068862_100037468 3300005844 Bacteria 4110
128 Ga0068862_100207974 3300005844 Bacteria 1767
129 Ga0068862_100224854 3300005844 Unclassified 1700
130 Ga0068862_100249572 3300005844 Bacteria 1617
131 Ga0081539_10072474 3300005985 Bacteria 1841
132 Ga0075366_10171798 3300006195 Bacteria 1315
133 Ga0097621_100004616 3300006237 Bacteria 9616
134 Ga0068871_100004783 3300006358 Bacteria 9463
135 Ga0068871_100017438 3300006358 Bacteria 5434
136 Ga0068871_100219465 3300006358 Bacteria 1647
137 Ga0075428_100047754 3300006844 Bacteria 4700
138 Ga0075428_100049951 3300006844 Bacteria 4588
139 Ga0075428_100174369 3300006844 Bacteria 2329
140 Ga0075430_100003156 3300006846 Bacteria 13793
141 Ga0075430_100015529 3300006846 Bacteria 6484
142 Ga0075431_100172909 3300006847 Bacteria 2219
143 Ga0075429_100016415 3300006880 Bacteria 6419
144 Ga0075429_100088508 3300006880 Bacteria 2699
145 Ga0068865_100036127 3300006881 Bacteria 3328
146 Ga0068865_100155780 3300006881 Unclassified 1737
147 Ga0068865_100294071 3300006881 Unclassified 1297
148 Ga0068865_100908503 3300006881 Unclassified 766
149 Ga0097620_100000249 3300006931 Bacteria 53191
150 Ga0097620_100005855 3300006931 Bacteria 12473
151 Ga0097620_100025858 3300006931 Bacteria 5889
152 Ga0097620_100028827 3300006931 Bacteria 5567
153 Ga0097620_100047014 3300006931 Bacteria 4334
154 Ga0097620_100049902 3300006931 Bacteria 4204
155 Ga0097620_100062380 3300006931 Bacteria 3757
156 Ga0097620_100140058 3300006931 Unclassified 2493
157 Ga0097620_100237955 3300006931 Bacteria 1909
158 Ga0097620_100315964 3300006931 Bacteria 1656
159 Ga0097620_100408048 3300006931 Bacteria 1455
160 Ga0097620_100445582 3300006931 Bacteria 1391
161 Ga0097620_100451709 3300006931 Bacteria 1381
162 Ga0105240_10853444 3300009093 Bacteria 983
163 Ga0105240_10897028 3300009093 Unclassified 954
164 Ga0111539_10146579 3300009094 Bacteria 2764
165 Ga0111539_10249746 3300009094 Bacteria 2066
166 Ga0111539_10467124 3300009094 Bacteria 1469
167 Ga0105247_10001996 3300009101 Bacteria 14144
168 Ga0105247_10004320 3300009101 Bacteria 9081
169 Ga0105247_10066491 3300009101 Bacteria 2245
170 Ga0114129_10298910 3300009147 Bacteria 2146
171 Ga0105243_10423918 3300009148 Bacteria 1242
172 Ga0105241_10082410 3300009174 Bacteria 2521
173 Ga0105242_10002846 3300009176 Bacteria 13551
174 Ga0105242_10024583 3300009176 Bacteria 4759
175 Ga0105242_10039168 3300009176 Bacteria 3814
176 Ga0105242_10256635 3300009176 Unclassified 1577
177 Ga0105248_10063815 3300009177 Bacteria 4134
178 Ga0105248_10181464 3300009177 Bacteria 2372
179 Ga0105249_10001026 3300009553 Bacteria 24688
180 Ga0105249_10002633 3300009553 Bacteria 15534
181 Ga0105249_10003465 3300009553 Bacteria 13663
182 Ga0105249_10062547 3300009553 Unclassified 3418
183 Ga0105249_10070196 3300009553 Bacteria 3234
184 Ga0105249_10097369 3300009553 Bacteria 2761
185 Ga0105249_10195003 3300009553 Bacteria 1979
186 Ga0105249_10257739 3300009553 Bacteria 1732
187 Ga0105249_10512232 3300009553 Bacteria 1246
188 Ga0105239_10074819 3300010375 Bacteria 3724
189 Ga0105239_10211616 3300010375 Bacteria 2173
190 Ga0105246_10008701 3300011119 Bacteria 6245
191 Ga0105246_10806377 3300011119 Bacteria 833
192 Ga0157370_10201068 3300013104 Bacteria 1848
193 Ga0157369_10072402 3300013105 Bacteria 3699
194 Ga0157369_10302725 3300013105 Unclassified 1663
195 Ga0157374_10001322 3300013296 Bacteria 21102
196 Ga0157374_10011705 3300013296 Bacteria 7610
197 Ga0157374_10053592 3300013296 Bacteria 3760
198 Ga0157374_10061967 3300013296 Bacteria 3504
199 Ga0157374_10347378 3300013296 Unclassified 1474
200 Ga0157374_10573487 3300013296 Unclassified 1137
201 Ga0157374_10637137 3300013296 Bacteria 1077
202 Ga0157378_10118865 3300013297 Unclassified 2433
203 Ga0157378_10227946 3300013297 Bacteria 1774
204 Ga0157378_10249319 3300013297 Bacteria 1699
205 Ga0157378_10849782 3300013297 Bacteria 941
206 Ga0163162_10002150 3300013306 Bacteria 18485
207 Ga0163162_10061508 3300013306 Bacteria 3792
208 Ga0163162_10069010 3300013306 Bacteria 3587
209 Ga0163162_10264451 3300013306 Bacteria 1852
210 Ga0163162_10296421 3300013306 Bacteria 1749
211 Ga0163162_10352676 3300013306 Bacteria 1604
212 Ga0163162_10803733 3300013306 Bacteria 1058
213 Ga0163162_10900158 3300013306 Bacteria 998
214 Ga0163162_11177646 3300013306 Bacteria 869
215 Ga0157372_10003383 3300013307 Bacteria 17209
216 Ga0157372_10012933 3300013307 Bacteria 8897
217 Ga0157372_10172721 3300013307 Bacteria 2501
218 Ga0157372_10313055 3300013307 Bacteria 1827
219 Ga0157372_10651622 3300013307 Bacteria 1226
220 Ga0157372_10714803 3300013307 Bacteria 1165
221 Ga0157375_10002186 3300013308 Bacteria 16910
222 Ga0157375_10040260 3300013308 Bacteria 4504
223 Ga0157375_10063027 3300013308 Bacteria 3687
224 Ga0157375_10284424 3300013308 Bacteria 1817
225 Ga0157375_11266576 3300013308 Unclassified 866
226 Ga0157375_11412087 3300013308 Bacteria 820
227 Ga0163163_10000697 3300014325 Bacteria 28555
228 Ga0163163_10237992 3300014325 Bacteria 1870
229 Ga0163163_10390510 3300014325 Bacteria 1450
230 Ga0163163_10538078 3300014325 Unclassified 1230
231 Ga0157380_10074326 3300014326 Bacteria 2759
232 Ga0157380_10405552 3300014326 Bacteria 1295
233 Ga0157379_10362784 3300014968 Bacteria 1328
234 Ga0157376_10034708 3300014969 Bacteria 4075
235 Ga0163161_10022242 3300017792 Bacteria 4463
236 Ga0163161_10134173 3300017792 Bacteria 1870
237 Ga0163161_10137966 3300017792 Bacteria 1845
238 Ga0163161_10175647 3300017792 Bacteria 1640
239 Ga0213876_10055869 3300021384 Bacteria 2084
240 Ga0209025_1000123 3300025294 Bacteria 204125
241 Ga0209051_1017525 3300025303 Bacteria 3197
242 Ga0207697_10146526 3300025315 Unclassified 1026
243 Ga0207682_10133220 3300025893 Bacteria 1110
244 Ga0207682_10134109 3300025893 Bacteria 1107
245 Ga0207642_10038586 3300025899 Unclassified 2068
246 Ga0207710_10001954 3300025900 Bacteria 9853
247 Ga0207710_10003258 3300025900 Bacteria 7256
248 Ga0207688_10003878 3300025901 Bacteria 8154
249 Ga0207688_10016817 3300025901 Bacteria 3971
250 Ga0207688_10341971 3300025901 Unclassified 921
251 Ga0207680_10023789 3300025903 Bacteria 3351
252 Ga0207680_10132436 3300025903 Bacteria 1644
253 Ga0207647_10139228 3300025904 Unclassified 1423
254 Ga0207685_10008324 3300025905 Bacteria 2948
255 Ga0207645_10000958 3300025907 Bacteria 23890
256 Ga0207645_10002136 3300025907 Bacteria 15798
257 Ga0207645_10374154 3300025907 Bacteria 955
258 Ga0207643_10003410 3300025908 Bacteria 8566
259 Ga0207643_10020355 3300025908 Unclassified 3641
260 Ga0207705_10079644 3300025909 Bacteria 2386
261 Ga0207695_10012638 3300025913 Bacteria 10115
262 Ga0207695_10117732 3300025913 Bacteria 2628
263 Ga0207662_10562043 3300025918 Bacteria 791
264 Ga0207681_10124760 3300025923 Bacteria 1894
265 Ga0207681_10172402 3300025923 Unclassified 1641
266 Ga0207681_10315822 3300025923 Bacteria 1241
267 Ga0207681_10471429 3300025923 Unclassified 1024
268 Ga0207650_10037606 3300025925 Bacteria 3528
269 Ga0207650_10084993 3300025925 Bacteria 2406
270 Ga0207650_10133301 3300025925 Bacteria 1946
271 Ga0207650_10230082 3300025925 Unclassified 1495
272 Ga0207650_10843867 3300025925 Unclassified 777
273 Ga0207659_10018007 3300025926 Bacteria 4623
274 Ga0207659_10182428 3300025926 Bacteria 1664
275 Ga0207706_10040383 3300025933 Bacteria 4135
276 Ga0207706_10044939 3300025933 Bacteria 3913
277 Ga0207706_10207118 3300025933 Unclassified 1720
278 Ga0207686_10004705 3300025934 Bacteria 7318
279 Ga0207686_10048892 3300025934 Bacteria 2622
280 Ga0207670_10053078 3300025936 Bacteria 2729
281 Ga0207669_10024377 3300025937 Unclassified 3251
282 Ga0207669_10079377 3300025937 Unclassified 2095
283 Ga0207669_10164755 3300025937 Unclassified 1570
284 Ga0207704_10063495 3300025938 Unclassified 2302
285 Ga0207704_10847091 3300025938 Unclassified 766
286 Ga0207691_10030320 3300025940 Bacteria 5055
287 Ga0207691_10165644 3300025940 Unclassified 1937
288 Ga0207691_10199824 3300025940 Unclassified 1740
289 Ga0207691_10353167 3300025940 Bacteria 1258
290 Ga0207711_10417253 3300025941 Bacteria 1248
291 Ga0207689_10004687 3300025942 Bacteria 12337
292 Ga0207689_10012871 3300025942 Bacteria 7146
293 Ga0207689_10027029 3300025942 Bacteria 4803
294 Ga0207689_10031168 3300025942 Bacteria 4441
295 Ga0207689_10050019 3300025942 Bacteria 3447
296 Ga0207689_10136188 3300025942 Bacteria 2022
297 Ga0207689_10148771 3300025942 Bacteria 1930
298 Ga0207689_10357032 3300025942 Bacteria 1215
299 Ga0207661_10458843 3300025944 Bacteria 1161
300 Ga0207679_10003197 3300025945 Bacteria 10103
301 Ga0207667_10027241 3300025949 Bacteria 6226
302 Ga0207651_10084457 3300025960 Bacteria 2300
303 Ga0207651_10126805 3300025960 Unclassified 1946
304 Ga0207651_10518526 3300025960 Bacteria 1032
305 Ga0207712_10002991 3300025961 Bacteria 10799
306 Ga0207712_10005446 3300025961 Bacteria 8035
307 Ga0207712_10022679 3300025961 Bacteria 4137
308 Ga0207712_10072427 3300025961 Bacteria 2481
309 Ga0207712_10121150 3300025961 Bacteria 1979
310 Ga0207712_10218245 3300025961 Unclassified 1523
311 Ga0207712_10323984 3300025961 Bacteria 1272
312 Ga0207668_10071525 3300025972 Unclassified 2478
313 Ga0207640_10230128 3300025981 Unclassified 1425
314 Ga0207658_10343487 3300025986 Unclassified 1298
315 Ga0207658_10352269 3300025986 Bacteria 1282
316 Ga0207658_10549489 3300025986 Bacteria 1033
317 Ga0207677_10407400 3300026023 Bacteria 1155
318 Ga0207639_10030076 3300026041 Bacteria 3981
319 Ga0207639_10031612 3300026041 Bacteria 3891
320 Ga0207639_10080305 3300026041 Bacteria 2579
321 Ga0207639_10090699 3300026041 Unclassified 2445
322 Ga0207639_10315260 3300026041 Bacteria 1387
323 Ga0207639_10332514 3300026041 Unclassified 1352
324 Ga0207708_10076205 3300026075 Bacteria 2572
325 Ga0207708_10196044 3300026075 Bacteria 1609
326 Ga0207702_10026966 3300026078 Bacteria 4770
327 Ga0207641_10000380 3300026088 Bacteria 52801
328 Ga0207641_10015756 3300026088 Bacteria 6193
329 Ga0207641_10027933 3300026088 Bacteria 4660
330 Ga0207648_10008276 3300026089 Bacteria 10099
331 Ga0207648_10029474 3300026089 Bacteria 4866
332 Ga0207648_10033503 3300026089 Bacteria 4531
333 Ga0207676_10024446 3300026095 Bacteria 4469
334 Ga0207676_10024760 3300026095 Bacteria 4445
335 Ga0207676_10042231 3300026095 Bacteria 3506
336 Ga0207676_10088070 3300026095 Bacteria 2541
337 Ga0207676_10093562 3300026095 Bacteria 2475
338 Ga0207676_10120611 3300026095 Bacteria 2211
339 Ga0207676_10135109 3300026095 Bacteria 2103
340 Ga0207676_10135403 3300026095 Unclassified 2101
341 Ga0207674_10031075 3300026116 Bacteria 5611
342 Ga0207675_100017193 3300026118 Bacteria 6754
343 Ga0207675_100173484 3300026118 Unclassified 2062
344 Ga0207675_100246528 3300026118 Bacteria 1728
345 Ga0207675_100256492 3300026118 Bacteria 1694
346 Ga0207675_100358006 3300026118 Bacteria 1431
347 Ga0207675_100467017 3300026118 Bacteria 1252
348 Ga0207683_10002824 3300026121 Bacteria 15171
349 Ga0207683_10048399 3300026121 Bacteria 3723
350 Ga0207698_10118482 3300026142 Bacteria 2236
351 Ga0207698_10240481 3300026142 Bacteria 1650
352 Ga0207428_10246911 3300027907 Bacteria 1332
353 Ga0207428_10263781 3300027907 Bacteria 1282
354 Ga0268266_10597148 3300028379 Unclassified 1060
355 Ga0268265_10041445 3300028380 Bacteria 3408
356 Ga0268265_10072064 3300028380 Bacteria 2694
357 Ga0268265_10080011 3300028380 Bacteria 2576
358 Ga0268265_10097845 3300028380 Bacteria 2362
359 Ga0268265_10105152 3300028380 Unclassified 2290
360 Ga0268265_10365355 3300028380 Bacteria 1323
361 Ga0268264_10058346 3300028381 Bacteria 3232
362 Ga0268264_10076115 3300028381 Unclassified 2855
363 Ga0268264_10096890 3300028381 Bacteria 2556
364 Ga0268264_10098510 3300028381 Bacteria 2535
365 Ga0268264_10124406 3300028381 Bacteria 2277
366 Ga0307515_10000001 3300028794 Bacteria 4259510
367 Ga0265327_10000219 3300031251 Bacteria 116606
368 Ga0316579_10104346 3300031691 Bacteria 1359
369 Ga0316578_10027326 3300031728 Bacteria 3224
370 Ga0316577_10000530 3300031733 Bacteria 15344
371 Ga0307416_100209745 3300032002 Archaea 1857
372 Ga0307414_10208384 3300032004 Bacteria 1596
373 Ga0307414_10308415 3300032004 Bacteria 1342
374 Ga0316585_10048147 3300032137 Unclassified 1366
375 Ga0316593_10021280 3300032168 Bacteria 2027
376 Ga0316582_0035057 3300036647 Bacteria 3095
377 Ga0316584_0043112 3300036712 Unclassified 3364
378 Ga0436365_1426137 3300039437 Bacteria 9898
379 Ga0436365_1824164 3300039437 Bacteria 746
380 Ga0451804_0484573 3300041463 Bacteria 1955
381 Ga0439442_007016 3300042002 Bacteria 2262
382 Ga0439445_0032761 3300042004 Unclassified 1356
383 Ga0439457_027478 3300042014 Bacteria 1260
384 Ga0439446_0042182 3300042156 Bacteria 1346
385 Ga0439434_0039395 3300042435 Bacteria 1450
386 Ga0453684_0142096 3300044712 Bacteria 2865
387 Ga0495638_0158474 3300046460 Bacteria 1308
388 Ga0495636_0000702 3300047318 Bacteria 12217
389 Ga0495672_0027367 3300047320 Unclassified 3624
390 Ga0495685_018381 3300047447 Bacteria 2399
391 Ga0495686_0227609 3300047472 Bacteria 1057
392 Ga0501031_0012253 3300049568 Archaea 5588
393 Ga0501031_0016660 3300049568 Bacteria 4773
394 Ga0501033_0240281 3300049570 Archaea 1285
395 Ga0501034_0000022 3300049571 Bacteria 264441
396 Ga0501034_0000277 3300049571 Bacteria 92445
397 Ga0501036_0007654 3300049572 Bacteria 8817
398 Ga0501036_0014621 3300049572 Archaea 6538
399 Ga0501037_0007544 3300049573 Bacteria 7966
400 Ga0501037_0043805 3300049573 Archaea 3289
401 Ga0501038_0184579 3300049574 Archaea 1681
402 Ga0501039_0273577 3300049575 Archaea 1327
403 Ga0501040_0171637 3300049576 Archaea 1535
404 Ga0501041_0013323 3300049577 Archaea 4872
405 Ga0501042_0118876 3300049578 Archaea 1902
406 Ga0501043_0005718 3300049579 Bacteria 10017
407 Ga0501043_0057656 3300049579 Bacteria 3049
408 Ga0501046_0007172 3300049580 Bacteria 9808
409 Ga0501046_0151510 3300049580 Archaea 1749
410 Ga0501046_0186164 3300049580 Bacteria 1550
411 Ga0501047_0227457 3300049581 Bacteria 1720
412 Ga0501047_0283337 3300049581 Unclassified 1501
413 Ga0501048_0059349 3300049582 Archaea 2711
414 Ga0501048_0133110 3300049582 Unclassified 1757
415 Ga0501070_0467490 3300049586 Bacteria 1016
416 Ga0501072_0022245 3300049588 Archaea 4918
417 Ga0501073_0028428 3300049589 Bacteria 3995
418 Ga0501074_0000591 3300049590 Bacteria 22526
419 Ga0501075_0019313 3300049591 Archaea 4941
420 Ga0501076_0025379 3300049592 Archaea 4585
421 Ga0501079_0366624 3300049741 Unclassified 1129
422 Ga0501080_0125228 3300049742 Archaea 2380
423 Ga0501081_0201195 3300049743 Archaea 1444
424 Ga0501035_0003701 3300049822 Bacteria 14580
425 Ga0501035_0110003 3300049822 Unclassified 2415
426 Ga0501035_0243100 3300049822 Archaea 1530
427 Ga0501044_0018327 3300049823 Bacteria 7503
428 Ga0501044_0035998 3300049823 Bacteria 5180
429 Ga0501044_0258599 3300049823 Archaea 1680
430 nmdc:mga05p37_494134_c1 3300050507 Bacteria 1406
431 nmdc:mga09592_86782_c1 3300050508 Unclassified 2671
432 nmdc:mga0qj67_26743_c1 3300050509 Bacteria 4468
433 nmdc:mga0qj67_295398_c1 3300050509 Bacteria 1313
434 nmdc:mga06r32_116279_c1 3300050510 Bacteria 2635
435 nmdc:mga06r32_275999_c1 3300050510 Bacteria 1668
436 nmdc:mga08y16_521372_c1 3300050511 Bacteria 1205
437 Ga0500641_0064589 3300053096 Bacteria 1529
438 Ga0500568_0001298 3300053139 Bacteria 16407
439 Ga0500611_000011 3300053727 Bacteria 141259
440 Ga0501084_0157611 3300054114 Bacteria 1915
441 Ga0501082_0113261 3300060353 Bacteria 2349
442 Ga0530510_0014082 3300061734 Archaea 5638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013307 Ga0157372_10003383 Ga0157372_100033833 219
2 3300049571 Ga0501034_0000277 Ga0501034_0000277_89500_90183 219
3 iso_pu_bacteria 2834641062 2834644543 219
4 iso_pu_bacteria 8003400568 8003404074 219
5 3300003323 rootH1_10136629 rootH1_101366292 223
6 3300053139 Ga0500568_0001298 Ga0500568_0001298_2774_3457 223
7 3300031691 Ga0316579_10104346 Ga0316579_101043461 224
8 3300031728 Ga0316578_10027326 Ga0316578_100273262 224
9 3300032168 Ga0316593_10021280 Ga0316593_100212802 224
10 3300036647 Ga0316582_0035057 Ga0316582_0035057_286_993 224
11 3300049581 Ga0501047_0227457 Ga0501047_0227457_20_694 224
12 3300003187 JGI25151J46595_10004301 JGI25151J46595_100043015 225
13 3300025294 Ga0209025_1000123 Ga0209025_1000123173 225
14 3300025303 Ga0209051_1017525 Ga0209051_10175253 225
15 3300031733 Ga0316577_10000530 Ga0316577_100005307 225
16 3300032137 Ga0316585_10048147 Ga0316585_100481472 225
17 3300036712 Ga0316584_0043112 Ga0316584_0043112_602_1327 225
18 3300047318 Ga0495636_0000702 Ga0495636_0000702_7402_8094 225
19 3300047447 Ga0495685_018381 Ga0495685_018381_1020_1712 225
20 3300049571 Ga0501034_0000022 Ga0501034_0000022_257607_258299 225
21 3300053096 Ga0500641_0064589 Ga0500641_0064589_651_1331 225
22 iso_pu_bacteria 2513237150 2513954683 225
23 iso_pu_bacteria 2513237165 2514043568 225
24 iso_pu_bacteria 644736347 644752219 225
25 3300005353 Ga0070669_100356529 Ga0070669_1003565291 226
26 3300005719 Ga0068861_100227709 Ga0068861_1002277092 226
27 3300025923 Ga0207681_10315822 Ga0207681_103158222 226
28 3300026118 Ga0207675_100467017 Ga0207675_1004670172 226
29 3300046460 Ga0495638_0158474 Ga0495638_0158474_100_783 226
30 3300053727 Ga0500611_000011 Ga0500611_000011_101847_102530 226
31 3300005354 Ga0070675_100052423 Ga0070675_1000524234 227
32 3300005578 Ga0068854_100482633 Ga0068854_1004826331 227
33 3300013105 Ga0157369_10302725 Ga0157369_103027251 227
34 3300013307 Ga0157372_10313055 Ga0157372_103130552 227
35 3300013307 Ga0157372_10714803 Ga0157372_107148031 227
36 3300025926 Ga0207659_10182428 Ga0207659_101824282 227
37 3300032002 Ga0307416_100209745 Ga0307416_1002097452 227
38 3300042002 Ga0439442_007016 Ga0439442_007016_606_1289 227
39 3300042004 Ga0439445_0032761 Ga0439445_0032761_643_1326 227
40 3300042014 Ga0439457_027478 Ga0439457_027478_127_810 227
41 3300042156 Ga0439446_0042182 Ga0439446_0042182_187_870 227
42 3300042435 Ga0439434_0039395 Ga0439434_0039395_112_795 227
43 3300047320 Ga0495672_0027367 Ga0495672_0027367_1333_2016 227
44 3300049568 Ga0501031_0012253 Ga0501031_0012253_3761_4492 227
45 3300049570 Ga0501033_0240281 Ga0501033_0240281_364_1095 227
46 3300049572 Ga0501036_0014621 Ga0501036_0014621_1672_2403 227
47 3300049573 Ga0501037_0043805 Ga0501037_0043805_1689_2420 227
48 3300049574 Ga0501038_0184579 Ga0501038_0184579_560_1291 227
49 3300049575 Ga0501039_0273577 Ga0501039_0273577_218_949 227
50 3300049576 Ga0501040_0171637 Ga0501040_0171637_333_1064 227
51 3300049577 Ga0501041_0013323 Ga0501041_0013323_1741_2472 227
52 3300049578 Ga0501042_0118876 Ga0501042_0118876_889_1620 227
53 3300049580 Ga0501046_0151510 Ga0501046_0151510_428_1159 227
54 3300049582 Ga0501048_0059349 Ga0501048_0059349_464_1195 227
55 3300049588 Ga0501072_0022245 Ga0501072_0022245_2879_3610 227
56 3300049591 Ga0501075_0019313 Ga0501075_0019313_1744_2475 227
57 3300049592 Ga0501076_0025379 Ga0501076_0025379_1743_2474 227
58 3300049742 Ga0501080_0125228 Ga0501080_0125228_414_1145 227
59 3300049743 Ga0501081_0201195 Ga0501081_0201195_242_973 227
60 3300049822 Ga0501035_0243100 Ga0501035_0243100_547_1278 227
61 3300049823 Ga0501044_0258599 Ga0501044_0258599_512_1243 227
62 3300061734 Ga0530510_0014082 Ga0530510_0014082_1345_2076 227
63 3300002459 JGI24751J29686_10000395 JGI24751J29686_100003956 229
64 3300003322 rootL2_10132266 rootL2_101322662 229
65 3300005288 Ga0065714_10217056 Ga0065714_102170561 229
66 3300005290 Ga0065712_10068275 Ga0065712_100682757 229
67 3300005293 Ga0065715_10001943 Ga0065715_100019435 229
68 3300005295 Ga0065707_10009422 Ga0065707_100094222 229
69 3300005328 Ga0070676_10016927 Ga0070676_100169274 229
70 3300005329 Ga0070683_100478243 Ga0070683_1004782431 229
71 3300005331 Ga0070670_100036219 Ga0070670_1000362193 229
72 3300005331 Ga0070670_100172703 Ga0070670_1001727032 229
73 3300005333 Ga0070677_10126587 Ga0070677_101265872 229
74 3300005334 Ga0068869_100019620 Ga0068869_1000196202 229
75 3300005334 Ga0068869_100020396 Ga0068869_1000203964 229
76 3300005334 Ga0068869_100034225 Ga0068869_1000342254 229
77 3300005334 Ga0068869_100184128 Ga0068869_1001841281 229
78 3300005334 Ga0068869_100262164 Ga0068869_1002621641 229
79 3300005335 Ga0070666_10009776 Ga0070666_100097763 229
80 3300005335 Ga0070666_10011395 Ga0070666_100113957 229
81 3300005335 Ga0070666_10032865 Ga0070666_100328652 229
82 3300005335 Ga0070666_10075093 Ga0070666_100750933 229
83 3300005338 Ga0068868_100022685 Ga0068868_1000226853 229
84 3300005338 Ga0068868_100052383 Ga0068868_1000523833 229
85 3300005338 Ga0068868_100052411 Ga0068868_1000524112 229
86 3300005338 Ga0068868_100339962 Ga0068868_1003399622 229
87 3300005338 Ga0068868_100422591 Ga0068868_1004225912 229
88 3300005340 Ga0070689_100069034 Ga0070689_1000690344 229
89 3300005340 Ga0070689_100070416 Ga0070689_1000704162 229
90 3300005347 Ga0070668_100006547 Ga0070668_1000065474 229
91 3300005347 Ga0070668_100199723 Ga0070668_1001997232 229
92 3300005347 Ga0070668_100245814 Ga0070668_1002458142 229
93 3300005353 Ga0070669_100015287 Ga0070669_1000152872 229
94 3300005353 Ga0070669_100072655 Ga0070669_1000726552 229
95 3300005353 Ga0070669_100267049 Ga0070669_1002670491 229
96 3300005353 Ga0070669_100749063 Ga0070669_1007490631 229
97 3300005354 Ga0070675_100852576 Ga0070675_1008525761 229
98 3300005355 Ga0070671_100810948 Ga0070671_1008109481 229
99 3300005364 Ga0070673_100037193 Ga0070673_1000371933 229
100 3300005365 Ga0070688_100015313 Ga0070688_1000153132 229
101 3300005365 Ga0070688_100036653 Ga0070688_1000366531 229
102 3300005365 Ga0070688_100136273 Ga0070688_1001362732 229
103 3300005365 Ga0070688_100353274 Ga0070688_1003532742 229
104 3300005367 Ga0070667_100203888 Ga0070667_1002038882 229
105 3300005367 Ga0070667_100241407 Ga0070667_1002414072 229
106 3300005367 Ga0070667_100292552 Ga0070667_1002925522 229
107 3300005367 Ga0070667_100346580 Ga0070667_1003465802 229
108 3300005367 Ga0070667_100502632 Ga0070667_1005026322 229
109 3300005441 Ga0070700_100089664 Ga0070700_1000896642 229
110 3300005456 Ga0070678_100018273 Ga0070678_1000182735 229
111 3300005456 Ga0070678_101030543 Ga0070678_1010305431 229
112 3300005457 Ga0070662_100018171 Ga0070662_1000181714 229
113 3300005458 Ga0070681_10356211 Ga0070681_103562111 229
114 3300005459 Ga0068867_100073155 Ga0068867_1000731552 229
115 3300005459 Ga0068867_100199696 Ga0068867_1001996962 229
116 3300005459 Ga0068867_100454157 Ga0068867_1004541572 229
117 3300005459 Ga0068867_100609583 Ga0068867_1006095832 229
118 3300005466 Ga0070685_10001257 Ga0070685_100012579 229
119 3300005466 Ga0070685_10041606 Ga0070685_100416062 229
120 3300005466 Ga0070685_10344202 Ga0070685_103442021 229
121 3300005471 Ga0070698_100003404 Ga0070698_10000340418 229
122 3300005471 Ga0070698_100006049 Ga0070698_1000060499 229
123 3300005471 Ga0070698_100011917 Ga0070698_1000119178 229
124 3300005471 Ga0070698_100048072 Ga0070698_1000480724 229
125 3300005530 Ga0070679_100057562 Ga0070679_1000575624 229
126 3300005530 Ga0070679_100068478 Ga0070679_1000684782 229
127 3300005530 Ga0070679_100416972 Ga0070679_1004169721 229
128 3300005535 Ga0070684_100025039 Ga0070684_1000250394 229
129 3300005535 Ga0070684_100479542 Ga0070684_1004795421 229
130 3300005539 Ga0068853_100012917 Ga0068853_1000129171 229
131 3300005539 Ga0068853_100040380 Ga0068853_1000403802 229
132 3300005539 Ga0068853_100059910 Ga0068853_1000599103 229
133 3300005539 Ga0068853_100105185 Ga0068853_1001051852 229
134 3300005539 Ga0068853_100187538 Ga0068853_1001875383 229
135 3300005539 Ga0068853_100742322 Ga0068853_1007423221 229
136 3300005543 Ga0070672_100034079 Ga0070672_1000340793 229
137 3300005543 Ga0070672_100166419 Ga0070672_1001664192 229
138 3300005543 Ga0070672_100354439 Ga0070672_1003544392 229
139 3300005548 Ga0070665_100089679 Ga0070665_1000896793 229
140 3300005563 Ga0068855_100190389 Ga0068855_1001903892 229
141 3300005564 Ga0070664_100025250 Ga0070664_1000252504 229
142 3300005614 Ga0068856_100105390 Ga0068856_1001053902 229
143 3300005615 Ga0070702_100066522 Ga0070702_1000665223 229
144 3300005616 Ga0068852_100494588 Ga0068852_1004945882 229
145 3300005617 Ga0068859_100000249 Ga0068859_10000024923 229
146 3300005617 Ga0068859_100025855 Ga0068859_1000258557 229
147 3300005617 Ga0068859_100028827 Ga0068859_1000288271 229
148 3300005617 Ga0068859_100047014 Ga0068859_1000470144 229
149 3300005617 Ga0068859_100049901 Ga0068859_1000499015 229
150 3300005617 Ga0068859_100062381 Ga0068859_1000623814 229
151 3300005617 Ga0068859_100140052 Ga0068859_1001400522 229
152 3300005617 Ga0068859_100237956 Ga0068859_1002379562 229
153 3300005617 Ga0068859_100315972 Ga0068859_1003159722 229
154 3300005617 Ga0068859_100445608 Ga0068859_1004456081 229
155 3300005617 Ga0068859_100451717 Ga0068859_1004517171 229
156 3300005618 Ga0068864_100012814 Ga0068864_1000128146 229
157 3300005618 Ga0068864_100016084 Ga0068864_1000160846 229
158 3300005618 Ga0068864_100031116 Ga0068864_1000311162 229
159 3300005618 Ga0068864_100033442 Ga0068864_1000334424 229
160 3300005618 Ga0068864_100048223 Ga0068864_1000482233 229
161 3300005618 Ga0068864_100111549 Ga0068864_1001115493 229
162 3300005618 Ga0068864_100275287 Ga0068864_1002752871 229
163 3300005618 Ga0068864_100576539 Ga0068864_1005765392 229
164 3300005718 Ga0068866_10017275 Ga0068866_100172752 229
165 3300005718 Ga0068866_10049038 Ga0068866_100490382 229
166 3300005718 Ga0068866_10088072 Ga0068866_100880722 229
167 3300005719 Ga0068861_100040345 Ga0068861_1000403452 229
168 3300005719 Ga0068861_100373963 Ga0068861_1003739632 229
169 3300005719 Ga0068861_100953008 Ga0068861_1009530081 229
170 3300005840 Ga0068870_10118578 Ga0068870_101185783 229
171 3300005840 Ga0068870_10401754 Ga0068870_104017541 229
172 3300005841 Ga0068863_100004176 Ga0068863_10000417614 229
173 3300005841 Ga0068863_100021592 Ga0068863_1000215921 229
174 3300005841 Ga0068863_100296679 Ga0068863_1002966792 229
175 3300005841 Ga0068863_100387958 Ga0068863_1003879582 229
176 3300005841 Ga0068863_100451826 Ga0068863_1004518262 229
177 3300005842 Ga0068858_100099349 Ga0068858_1000993492 229
178 3300005843 Ga0068860_100011603 Ga0068860_10001160310 229
179 3300005843 Ga0068860_100030646 Ga0068860_1000306462 229
180 3300005843 Ga0068860_100198425 Ga0068860_1001984251 229
181 3300005843 Ga0068860_100270287 Ga0068860_1002702873 229
182 3300005844 Ga0068862_100035394 Ga0068862_1000353943 229
183 3300005844 Ga0068862_100037468 Ga0068862_1000374681 229
184 3300005844 Ga0068862_100207974 Ga0068862_1002079742 229
185 3300005844 Ga0068862_100224854 Ga0068862_1002248543 229
186 3300005844 Ga0068862_100249572 Ga0068862_1002495721 229
187 3300005985 Ga0081539_10072474 Ga0081539_100724742 229
188 3300006195 Ga0075366_10171798 Ga0075366_101717981 229
189 3300006237 Ga0097621_100004616 Ga0097621_10000461610 229
190 3300006358 Ga0068871_100004783 Ga0068871_1000047833 229
191 3300006358 Ga0068871_100017438 Ga0068871_1000174382 229
192 3300006358 Ga0068871_100219465 Ga0068871_1002194652 229
193 3300006844 Ga0075428_100047754 Ga0075428_1000477543 229
194 3300006844 Ga0075428_100049951 Ga0075428_1000499512 229
195 3300006844 Ga0075428_100174369 Ga0075428_1001743692 229
196 3300006846 Ga0075430_100003156 Ga0075430_10000315613 229
197 3300006846 Ga0075430_100015529 Ga0075430_1000155296 229
198 3300006847 Ga0075431_100172909 Ga0075431_1001729093 229
199 3300006880 Ga0075429_100016415 Ga0075429_1000164152 229
200 3300006880 Ga0075429_100088508 Ga0075429_1000885084 229
201 3300006881 Ga0068865_100036127 Ga0068865_1000361273 229
202 3300006881 Ga0068865_100155780 Ga0068865_1001557802 229
203 3300006881 Ga0068865_100294071 Ga0068865_1002940712 229
204 3300006881 Ga0068865_100908503 Ga0068865_1009085031 229
205 3300006931 Ga0097620_100000249 Ga0097620_10000024923 229
206 3300006931 Ga0097620_100005855 Ga0097620_10000585514 229
207 3300006931 Ga0097620_100025858 Ga0097620_1000258584 229
208 3300006931 Ga0097620_100028827 Ga0097620_1000288271 229
209 3300006931 Ga0097620_100047014 Ga0097620_1000470142 229
210 3300006931 Ga0097620_100049902 Ga0097620_1000499025 229
211 3300006931 Ga0097620_100062380 Ga0097620_1000623804 229
212 3300006931 Ga0097620_100140058 Ga0097620_1001400582 229
213 3300006931 Ga0097620_100237955 Ga0097620_1002379552 229
214 3300006931 Ga0097620_100315964 Ga0097620_1003159642 229
215 3300006931 Ga0097620_100408048 Ga0097620_1004080484 229
216 3300006931 Ga0097620_100445582 Ga0097620_1004455821 229
217 3300006931 Ga0097620_100451709 Ga0097620_1004517091 229
218 3300009093 Ga0105240_10853444 Ga0105240_108534441 229
219 3300009093 Ga0105240_10897028 Ga0105240_108970281 229
220 3300009094 Ga0111539_10146579 Ga0111539_101465792 229
221 3300009094 Ga0111539_10249746 Ga0111539_102497462 229
222 3300009094 Ga0111539_10467124 Ga0111539_104671242 229
223 3300009101 Ga0105247_10001996 Ga0105247_1000199613 229
224 3300009101 Ga0105247_10004320 Ga0105247_100043207 229
225 3300009101 Ga0105247_10066491 Ga0105247_100664912 229
226 3300009147 Ga0114129_10298910 Ga0114129_102989102 229
227 3300009148 Ga0105243_10423918 Ga0105243_104239181 229
228 3300009174 Ga0105241_10082410 Ga0105241_100824102 229
229 3300009176 Ga0105242_10002846 Ga0105242_100028468 229
230 3300009176 Ga0105242_10024583 Ga0105242_100245835 229
231 3300009176 Ga0105242_10039168 Ga0105242_100391683 229
232 3300009176 Ga0105242_10256635 Ga0105242_102566352 229
233 3300009177 Ga0105248_10063815 Ga0105248_100638155 229
234 3300009177 Ga0105248_10181464 Ga0105248_101814642 229
235 3300009553 Ga0105249_10001026 Ga0105249_100010263 229
236 3300009553 Ga0105249_10002633 Ga0105249_1000263317 229
237 3300009553 Ga0105249_10003465 Ga0105249_100034656 229
238 3300009553 Ga0105249_10062547 Ga0105249_100625473 229
239 3300009553 Ga0105249_10070196 Ga0105249_100701962 229
240 3300009553 Ga0105249_10097369 Ga0105249_100973692 229
241 3300009553 Ga0105249_10195003 Ga0105249_101950032 229
242 3300009553 Ga0105249_10257739 Ga0105249_102577392 229
243 3300009553 Ga0105249_10512232 Ga0105249_105122322 229
244 3300010375 Ga0105239_10074819 Ga0105239_100748194 229
245 3300010375 Ga0105239_10211616 Ga0105239_102116162 229
246 3300011119 Ga0105246_10008701 Ga0105246_100087015 229
247 3300011119 Ga0105246_10806377 Ga0105246_108063771 229
248 3300013104 Ga0157370_10201068 Ga0157370_102010681 229
249 3300013105 Ga0157369_10072402 Ga0157369_100724022 229
250 3300013296 Ga0157374_10001322 Ga0157374_1000132218 229
251 3300013296 Ga0157374_10011705 Ga0157374_100117058 229
252 3300013296 Ga0157374_10053592 Ga0157374_100535923 229
253 3300013296 Ga0157374_10061967 Ga0157374_100619673 229
254 3300013296 Ga0157374_10347378 Ga0157374_103473782 229
255 3300013296 Ga0157374_10573487 Ga0157374_105734872 229
256 3300013296 Ga0157374_10637137 Ga0157374_106371372 229
257 3300013297 Ga0157378_10118865 Ga0157378_101188652 229
258 3300013297 Ga0157378_10227946 Ga0157378_102279463 229
259 3300013297 Ga0157378_10249319 Ga0157378_102493192 229
260 3300013297 Ga0157378_10849782 Ga0157378_108497821 229
261 3300013306 Ga0163162_10002150 Ga0163162_100021509 229
262 3300013306 Ga0163162_10061508 Ga0163162_100615083 229
263 3300013306 Ga0163162_10069010 Ga0163162_100690104 229
264 3300013306 Ga0163162_10264451 Ga0163162_102644512 229
265 3300013306 Ga0163162_10296421 Ga0163162_102964211 229
266 3300013306 Ga0163162_10352676 Ga0163162_103526763 229
267 3300013306 Ga0163162_10803733 Ga0163162_108037332 229
268 3300013306 Ga0163162_10900158 Ga0163162_109001581 229
269 3300013306 Ga0163162_11177646 Ga0163162_111776461 229
270 3300013307 Ga0157372_10012933 Ga0157372_100129334 229
271 3300013307 Ga0157372_10172721 Ga0157372_101727212 229
272 3300013307 Ga0157372_10651622 Ga0157372_106516222 229
273 3300013308 Ga0157375_10002186 Ga0157375_100021867 229
274 3300013308 Ga0157375_10040260 Ga0157375_100402606 229
275 3300013308 Ga0157375_10063027 Ga0157375_100630274 229
276 3300013308 Ga0157375_10284424 Ga0157375_102844242 229
277 3300013308 Ga0157375_11266576 Ga0157375_112665761 229
278 3300013308 Ga0157375_11412087 Ga0157375_114120871 229
279 3300014325 Ga0163163_10000697 Ga0163163_1000069728 229
280 3300014325 Ga0163163_10237992 Ga0163163_102379922 229
281 3300014325 Ga0163163_10390510 Ga0163163_103905102 229
282 3300014325 Ga0163163_10538078 Ga0163163_105380781 229
283 3300014326 Ga0157380_10074326 Ga0157380_100743262 229
284 3300014326 Ga0157380_10405552 Ga0157380_104055522 229
285 3300014968 Ga0157379_10362784 Ga0157379_103627841 229
286 3300014969 Ga0157376_10034708 Ga0157376_100347082 229
287 3300017792 Ga0163161_10022242 Ga0163161_100222425 229
288 3300017792 Ga0163161_10134173 Ga0163161_101341733 229
289 3300017792 Ga0163161_10137966 Ga0163161_101379663 229
290 3300017792 Ga0163161_10175647 Ga0163161_101756473 229
291 3300021384 Ga0213876_10055869 Ga0213876_100558692 229
292 3300025315 Ga0207697_10146526 Ga0207697_101465262 229
293 3300025893 Ga0207682_10133220 Ga0207682_101332202 229
294 3300025893 Ga0207682_10134109 Ga0207682_101341091 229
295 3300025899 Ga0207642_10038586 Ga0207642_100385862 229
296 3300025900 Ga0207710_10001954 Ga0207710_100019546 229
297 3300025900 Ga0207710_10003258 Ga0207710_100032587 229
298 3300025901 Ga0207688_10003878 Ga0207688_100038784 229
299 3300025901 Ga0207688_10016817 Ga0207688_100168176 229
300 3300025901 Ga0207688_10341971 Ga0207688_103419711 229
301 3300025903 Ga0207680_10023789 Ga0207680_100237893 229
302 3300025903 Ga0207680_10132436 Ga0207680_101324362 229
303 3300025904 Ga0207647_10139228 Ga0207647_101392282 229
304 3300025905 Ga0207685_10008324 Ga0207685_100083242 229
305 3300025907 Ga0207645_10000958 Ga0207645_1000095810 229
306 3300025907 Ga0207645_10002136 Ga0207645_1000213617 229
307 3300025907 Ga0207645_10374154 Ga0207645_103741541 229
308 3300025908 Ga0207643_10003410 Ga0207643_100034107 229
309 3300025908 Ga0207643_10020355 Ga0207643_100203552 229
310 3300025909 Ga0207705_10079644 Ga0207705_100796442 229
311 3300025913 Ga0207695_10012638 Ga0207695_1001263810 229
312 3300025913 Ga0207695_10117732 Ga0207695_101177322 229
313 3300025918 Ga0207662_10562043 Ga0207662_105620431 229
314 3300025923 Ga0207681_10124760 Ga0207681_101247601 229
315 3300025923 Ga0207681_10172402 Ga0207681_101724023 229
316 3300025923 Ga0207681_10471429 Ga0207681_104714292 229
317 3300025925 Ga0207650_10037606 Ga0207650_100376063 229
318 3300025925 Ga0207650_10084993 Ga0207650_100849933 229
319 3300025925 Ga0207650_10133301 Ga0207650_101333013 229
320 3300025925 Ga0207650_10230082 Ga0207650_102300822 229
321 3300025925 Ga0207650_10843867 Ga0207650_108438671 229
322 3300025926 Ga0207659_10018007 Ga0207659_100180074 229
323 3300025933 Ga0207706_10040383 Ga0207706_100403832 229
324 3300025933 Ga0207706_10044939 Ga0207706_100449392 229
325 3300025933 Ga0207706_10207118 Ga0207706_102071182 229
326 3300025934 Ga0207686_10004705 Ga0207686_100047056 229
327 3300025934 Ga0207686_10048892 Ga0207686_100488922 229
328 3300025936 Ga0207670_10053078 Ga0207670_100530782 229
329 3300025937 Ga0207669_10024377 Ga0207669_100243772 229
330 3300025937 Ga0207669_10079377 Ga0207669_100793772 229
331 3300025937 Ga0207669_10164755 Ga0207669_101647552 229
332 3300025938 Ga0207704_10063495 Ga0207704_100634952 229
333 3300025938 Ga0207704_10847091 Ga0207704_108470911 229
334 3300025940 Ga0207691_10030320 Ga0207691_100303203 229
335 3300025940 Ga0207691_10165644 Ga0207691_101656443 229
336 3300025940 Ga0207691_10199824 Ga0207691_101998243 229
337 3300025940 Ga0207691_10353167 Ga0207691_103531671 229
338 3300025941 Ga0207711_10417253 Ga0207711_104172532 229
339 3300025942 Ga0207689_10004687 Ga0207689_1000468714 229
340 3300025942 Ga0207689_10012871 Ga0207689_100128716 229
341 3300025942 Ga0207689_10027029 Ga0207689_100270292 229
342 3300025942 Ga0207689_10031168 Ga0207689_100311682 229
343 3300025942 Ga0207689_10050019 Ga0207689_100500193 229
344 3300025942 Ga0207689_10136188 Ga0207689_101361883 229
345 3300025942 Ga0207689_10148771 Ga0207689_101487713 229
346 3300025942 Ga0207689_10357032 Ga0207689_103570322 229
347 3300025944 Ga0207661_10458843 Ga0207661_104588432 229
348 3300025945 Ga0207679_10003197 Ga0207679_100031979 229
349 3300025949 Ga0207667_10027241 Ga0207667_100272414 229
350 3300025960 Ga0207651_10084457 Ga0207651_100844573 229
351 3300025960 Ga0207651_10126805 Ga0207651_101268053 229
352 3300025960 Ga0207651_10518526 Ga0207651_105185262 229
353 3300025961 Ga0207712_10002991 Ga0207712_100029917 229
354 3300025961 Ga0207712_10005446 Ga0207712_100054467 229
355 3300025961 Ga0207712_10022679 Ga0207712_100226791 229
356 3300025961 Ga0207712_10072427 Ga0207712_100724272 229
357 3300025961 Ga0207712_10121150 Ga0207712_101211503 229
358 3300025961 Ga0207712_10218245 Ga0207712_102182453 229
359 3300025961 Ga0207712_10323984 Ga0207712_103239842 229
360 3300025972 Ga0207668_10071525 Ga0207668_100715254 229
361 3300025981 Ga0207640_10230128 Ga0207640_102301281 229
362 3300025986 Ga0207658_10343487 Ga0207658_103434871 229
363 3300025986 Ga0207658_10352269 Ga0207658_103522692 229
364 3300025986 Ga0207658_10549489 Ga0207658_105494891 229
365 3300026023 Ga0207677_10407400 Ga0207677_104074002 229
366 3300026041 Ga0207639_10030076 Ga0207639_100300762 229
367 3300026041 Ga0207639_10031612 Ga0207639_100316123 229
368 3300026041 Ga0207639_10080305 Ga0207639_100803052 229
369 3300026041 Ga0207639_10090699 Ga0207639_100906993 229
370 3300026041 Ga0207639_10315260 Ga0207639_103152601 229
371 3300026041 Ga0207639_10332514 Ga0207639_103325141 229
372 3300026075 Ga0207708_10076205 Ga0207708_100762053 229
373 3300026075 Ga0207708_10196044 Ga0207708_101960442 229
374 3300026078 Ga0207702_10026966 Ga0207702_100269664 229
375 3300026088 Ga0207641_10000380 Ga0207641_1000038037 229
376 3300026088 Ga0207641_10015756 Ga0207641_100157561 229
377 3300026088 Ga0207641_10027933 Ga0207641_100279334 229
378 3300026089 Ga0207648_10008276 Ga0207648_100082766 229
379 3300026089 Ga0207648_10029474 Ga0207648_100294745 229
380 3300026089 Ga0207648_10033503 Ga0207648_100335032 229
381 3300026095 Ga0207676_10024446 Ga0207676_100244465 229
382 3300026095 Ga0207676_10024760 Ga0207676_100247604 229
383 3300026095 Ga0207676_10042231 Ga0207676_100422312 229
384 3300026095 Ga0207676_10088070 Ga0207676_100880702 229
385 3300026095 Ga0207676_10093562 Ga0207676_100935622 229
386 3300026095 Ga0207676_10120611 Ga0207676_101206113 229
387 3300026095 Ga0207676_10135109 Ga0207676_101351092 229
388 3300026095 Ga0207676_10135403 Ga0207676_101354032 229
389 3300026116 Ga0207674_10031075 Ga0207674_100310754 229
390 3300026118 Ga0207675_100017193 Ga0207675_1000171936 229
391 3300026118 Ga0207675_100173484 Ga0207675_1001734842 229
392 3300026118 Ga0207675_100246528 Ga0207675_1002465281 229
393 3300026118 Ga0207675_100256492 Ga0207675_1002564922 229
394 3300026118 Ga0207675_100358006 Ga0207675_1003580061 229
395 3300026121 Ga0207683_10002824 Ga0207683_100028249 229
396 3300026121 Ga0207683_10048399 Ga0207683_100483993 229
397 3300026142 Ga0207698_10118482 Ga0207698_101184822 229
398 3300026142 Ga0207698_10240481 Ga0207698_102404811 229
399 3300027907 Ga0207428_10246911 Ga0207428_102469111 229
400 3300027907 Ga0207428_10263781 Ga0207428_102637812 229
401 3300028379 Ga0268266_10597148 Ga0268266_105971482 229
402 3300028380 Ga0268265_10041445 Ga0268265_100414452 229
403 3300028380 Ga0268265_10072064 Ga0268265_100720643 229
404 3300028380 Ga0268265_10080011 Ga0268265_100800113 229
405 3300028380 Ga0268265_10097845 Ga0268265_100978453 229
406 3300028380 Ga0268265_10105152 Ga0268265_101051524 229
407 3300028380 Ga0268265_10365355 Ga0268265_103653552 229
408 3300028381 Ga0268264_10058346 Ga0268264_100583463 229
409 3300028381 Ga0268264_10076115 Ga0268264_100761155 229
410 3300028381 Ga0268264_10096890 Ga0268264_100968902 229
411 3300028381 Ga0268264_10098510 Ga0268264_100985102 229
412 3300028381 Ga0268264_10124406 Ga0268264_101244062 229
413 3300028794 Ga0307515_10000001 Ga0307515_100000011046 229
414 3300031251 Ga0265327_10000219 Ga0265327_1000021967 229
415 3300032004 Ga0307414_10208384 Ga0307414_102083842 229
416 3300032004 Ga0307414_10308415 Ga0307414_103084152 229
417 3300039437 Ga0436365_1426137 Ga0436365_1426137_7676_8383 229
418 3300039437 Ga0436365_1824164 Ga0436365_1824164_47_736 229
419 3300041463 Ga0451804_0484573 Ga0451804_0484573_1015_1704 229
420 3300044712 Ga0453684_0142096 Ga0453684_0142096_1799_2488 229
421 3300047472 Ga0495686_0227609 Ga0495686_0227609_68_757 229
422 3300049568 Ga0501031_0016660 Ga0501031_0016660_1794_2516 229
423 3300049572 Ga0501036_0007654 Ga0501036_0007654_6894_7616 229
424 3300049573 Ga0501037_0007544 Ga0501037_0007544_1693_2415 229
425 3300049579 Ga0501043_0005718 Ga0501043_0005718_3026_3715 229
426 3300049579 Ga0501043_0057656 Ga0501043_0057656_1557_2279 229
427 3300049580 Ga0501046_0007172 Ga0501046_0007172_2838_3527 229
428 3300049580 Ga0501046_0186164 Ga0501046_0186164_116_838 229
429 3300049581 Ga0501047_0283337 Ga0501047_0283337_319_1008 229
430 3300049582 Ga0501048_0133110 Ga0501048_0133110_940_1629 229
431 3300049586 Ga0501070_0467490 Ga0501070_0467490_295_984 229
432 3300049589 Ga0501073_0028428 Ga0501073_0028428_388_1077 229
433 3300049590 Ga0501074_0000591 Ga0501074_0000591_9199_9888 229
434 3300049741 Ga0501079_0366624 Ga0501079_0366624_39_728 229
435 3300049822 Ga0501035_0003701 Ga0501035_0003701_4441_5163 229
436 3300049822 Ga0501035_0110003 Ga0501035_0110003_804_1493 229
437 3300049823 Ga0501044_0018327 Ga0501044_0018327_1100_1789 229
438 3300049823 Ga0501044_0035998 Ga0501044_0035998_1494_2216 229
439 3300050507 nmdc:mga05p37_494134_c1 nmdc:mga05p37_494134_c1_162_851 229
440 3300050508 nmdc:mga09592_86782_c1 nmdc:mga09592_86782_c1_982_1671 229
441 3300050509 nmdc:mga0qj67_26743_c1 nmdc:mga0qj67_26743_c1_1096_1785 229
442 3300050509 nmdc:mga0qj67_295398_c1 nmdc:mga0qj67_295398_c1_308_997 229
443 3300050510 nmdc:mga06r32_116279_c1 nmdc:mga06r32_116279_c1_1479_2168 229
444 3300050510 nmdc:mga06r32_275999_c1 nmdc:mga06r32_275999_c1_909_1598 229
445 3300050511 nmdc:mga08y16_521372_c1 nmdc:mga08y16_521372_c1_232_921 229
446 3300054114 Ga0501084_0157611 Ga0501084_0157611_1183_1872 229
447 3300060353 Ga0501082_0113261 Ga0501082_0113261_1346_2035 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

49

240

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

55

272

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

51

234

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sbv-assembly2.cif.gz_B crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (adp bound) 0.9154 2 226
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.911 2 225
4qec-assembly1.cif.gz_A elxo with nadp bound 0.9107 2 225
5ovl-assembly1.cif.gz_D crystal structure of maba bound to nadp+ from m. smegmatis 0.906 4 225
8sbw-assembly1.cif.gz_A crystal structure of 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase from klebsiella aerogenes (apo, orthorhombic form) 0.9037 2 229
ID Description Score Start End Superfamily
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 2 35 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9193 2 174 3.40.50.720
2fwmX00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9037 2 225 3.40.50.720
af_Q2QLP7_18_222_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9035 3 178 3.40.50.720
af_A0A1D6GEP1_1_92_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9015 2 38 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A832BKX5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9956 2 229 GO:0016491
AF-A0A832BKX5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9869 2 229 GO:0016491
AF-A0A1V9G635-F1-model_v4 Short-chain dehydrogenase 0.9788 2 229 GO:0050664
AF-A0A1V9FJJ9-F1-model_v4 Short-chain dehydrogenase 0.9767 2 229 GO:0016491
AF-A0A395LZS9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9759 2 229 GO:0016491

Feature Viewer

pLDDT pTM Quality
95.28 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map