F445872

General Info

Members Datasets Scaffolds Average Seq Length
447 259 894 145

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10226118|Ga0070676_102261182
Length 172
Sequence LIARRNRCSAPDEEPGVGVDAGLGWGYLAAMPITPHIVVQGAERAVTFYRDAFGAEEIDRIPTPDGRLMSVQLRLGDGFLHVADEFPEMGVLAPPSVGGTPVVLSLEVADADAVFAQAVAAGASARQPPADMFWGDRHGQLEDPFGHRWNVSQHLRDVPHDEVVAAAAALFS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
175 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
176 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
177 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
191 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 13.2
Rhizosphere 82.77
Stem 0
Stem Tuber 0
Unclassified 14.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10226118 3300005328 Bacteria 1238
2 Ga0070658_10090205 3300005327 Bacteria 2525
3 Ga0070683_100054373 3300005329 Bacteria 3712
4 Ga0070683_100261065 3300005329 Bacteria 1648
5 Ga0070683_100933342 3300005329 Bacteria 833
6 Ga0070683_101496851 3300005329 Bacteria 649
7 Ga0070670_101459048 3300005331 Bacteria 628
8 Ga0068869_100116812 3300005334 Bacteria 2036
9 Ga0070680_100043158 3300005336 Bacteria 3662
10 Ga0070680_100180077 3300005336 Bacteria 1780
11 Ga0070682_100014097 3300005337 Bacteria 4615
12 Ga0070682_100116922 3300005337 Bacteria 1785
13 Ga0070682_100216079 3300005337 Bacteria 1362
14 Ga0070682_100659433 3300005337 Bacteria 834
15 Ga0068868_100063806 3300005338 Unclassified 2922
16 Ga0068868_100078529 3300005338 Bacteria 2643
17 Ga0068868_100464552 3300005338 Bacteria 1103
18 Ga0070687_100025784 3300005343 Bacteria 2825
19 Ga0070687_100809599 3300005343 Bacteria 664
20 Ga0070661_100270198 3300005344 Bacteria 1316
21 Ga0070661_100558084 3300005344 Bacteria 922
22 Ga0070668_100125012 3300005347 Bacteria 2059
23 Ga0070668_100129602 3300005347 Bacteria 2023
24 Ga0070668_100130761 3300005347 Bacteria 2015
25 Ga0070675_100030523 3300005354 Bacteria 4352
26 Ga0070675_101779699 3300005354 Bacteria 568
27 Ga0070671_101191068 3300005355 Bacteria 670
28 Ga0070674_101020776 3300005356 Unclassified 727
29 Ga0070673_100513805 3300005364 Bacteria 1085
30 Ga0070659_100179309 3300005366 Unclassified 1738
31 Ga0070659_100851513 3300005366 Bacteria 795
32 Ga0070667_100150513 3300005367 Unclassified 2044
33 Ga0070714_100194214 3300005435 Unclassified 1854
34 Ga0070714_100227073 3300005435 Bacteria 1719
35 Ga0070713_100052600 3300005436 Bacteria 3372
36 Ga0070713_101253469 3300005436 Unclassified 718
37 Ga0070701_10144968 3300005438 Bacteria 1362
38 Ga0070701_10420866 3300005438 Bacteria 851
39 Ga0070711_100077019 3300005439 Bacteria 2366
40 Ga0070711_100464647 3300005439 Bacteria 1038
41 Ga0070700_100002765 3300005441 Bacteria 8969
42 Ga0070700_100021068 3300005441 Bacteria 3787
43 Ga0070700_100267399 3300005441 Bacteria 1234
44 Ga0070663_100009956 3300005455 Bacteria 5909
45 Ga0070678_100021053 3300005456 Bacteria 4292
46 Ga0070678_100059427 3300005456 Unclassified 2810
47 Ga0070678_100444711 3300005456 Bacteria 1134
48 Ga0070662_100181757 3300005457 Bacteria 1658
49 Ga0070662_100452338 3300005457 Bacteria 1066
50 Ga0070681_10012251 3300005458 Bacteria 8501
51 Ga0070685_11305419 3300005466 Bacteria 554
52 Ga0070684_100059317 3300005535 Bacteria 3345
53 Ga0070684_100060533 3300005535 Bacteria 3312
54 Ga0070684_100215061 3300005535 Bacteria 1753
55 Ga0070684_100806613 3300005535 Bacteria 878
56 Ga0070684_101229338 3300005535 Bacteria 705
57 Ga0068853_101132245 3300005539 Bacteria 755
58 Ga0070672_100888280 3300005543 Bacteria 787
59 Ga0070672_101415819 3300005543 Bacteria 622
60 Ga0070686_100632564 3300005544 Bacteria 846
61 Ga0070693_100193903 3300005547 Bacteria 1316
62 Ga0070665_100101694 3300005548 Unclassified 2878
63 Ga0070704_100784735 3300005549 Bacteria 850
64 Ga0068855_100019251 3300005563 Bacteria 8205
65 Ga0070664_100070738 3300005564 Bacteria 2989
66 Ga0068857_100774099 3300005577 Bacteria 915
67 Ga0068854_100100493 3300005578 Unclassified 2168
68 Ga0068856_100332268 3300005614 Bacteria 1537
69 Ga0068856_100836823 3300005614 Bacteria 939
70 Ga0068856_101896379 3300005614 Bacteria 607
71 Ga0070702_100002593 3300005615 Bacteria 7865
72 Ga0070702_100021540 3300005615 Bacteria 3393
73 Ga0068852_100112870 3300005616 Bacteria 2474
74 Ga0068852_100269632 3300005616 Bacteria 1637
75 Ga0068852_100880247 3300005616 Bacteria 912
76 Ga0068859_100339705 3300005617 Bacteria 1596
77 Ga0068864_100013352 3300005618 Bacteria 6806
78 Ga0068864_100165073 3300005618 Bacteria 2015
79 Ga0068866_10015732 3300005718 Bacteria 3367
80 Ga0068861_100126424 3300005719 Bacteria 2069
81 Ga0068861_101181221 3300005719 Bacteria 739
82 Ga0068870_10260431 3300005840 Bacteria 1079
83 Ga0068870_10502672 3300005840 Unclassified 808
84 Ga0068863_100718217 3300005841 Bacteria 994
85 Ga0068858_100224853 3300005842 Bacteria 1778
86 Ga0068860_100355102 3300005843 Bacteria 1443
87 Ga0068860_100961797 3300005843 Bacteria 871
88 Ga0068862_100121584 3300005844 Bacteria 2302
89 Ga0068862_100357341 3300005844 Bacteria 1357
90 Ga0081455_10012426 3300005937 Bacteria 8496
91 Ga0081540_1042371 3300005983 Bacteria 2348
92 Ga0070717_10021008 3300006028 Bacteria 5142
93 Ga0070717_10030885 3300006028 Bacteria 4305
94 Ga0070717_10280593 3300006028 Bacteria 1477
95 Ga0070717_10777626 3300006028 Bacteria 871
96 Ga0070717_10990010 3300006028 Unclassified 766
97 Ga0075365_10054476 3300006038 Bacteria 2652
98 Ga0075363_100432336 3300006048 Bacteria 776
99 Ga0070715_10077625 3300006163 Bacteria 1499
100 Ga0070716_100311638 3300006173 Bacteria 1099
101 Ga0070712_100261850 3300006175 Bacteria 1386
102 Ga0075367_10731371 3300006178 Bacteria 630
103 Ga0075428_100104126 3300006844 Bacteria 3094
104 Ga0075430_100093767 3300006846 Bacteria 2510
105 Ga0075430_100321563 3300006846 Bacteria 1279
106 Ga0075431_100190454 3300006847 Bacteria 2102
107 Ga0075431_100385613 3300006847 Bacteria 1405
108 Ga0075433_10018002 3300006852 Bacteria 5863
109 Ga0075434_100003384 3300006871 Bacteria 14275
110 Ga0075429_100340824 3300006880 Bacteria 1312
111 Ga0068865_100051946 3300006881 Bacteria 2839
112 Ga0068865_100237803 3300006881 Bacteria 1432
113 Ga0068865_100241085 3300006881 Bacteria 1423
114 Ga0097620_100339703 3300006931 Bacteria 1596
115 Ga0075435_100065007 3300007076 Bacteria 2965
116 Ga0075435_100406335 3300007076 Bacteria 1172
117 Ga0075435_101041979 3300007076 Bacteria 715
118 Ga0105240_10045442 3300009093 Bacteria 5571
119 Ga0111539_10042415 3300009094 Bacteria 5464
120 Ga0111539_10685478 3300009094 Unclassified 1193
121 Ga0111539_11230810 3300009094 Unclassified 869
122 Ga0105245_10006952 3300009098 Bacteria 9924
123 Ga0105245_10018753 3300009098 Bacteria 6054
124 Ga0105245_10079185 3300009098 Bacteria 3000
125 Ga0105245_10167013 3300009098 Bacteria 2092
126 Ga0105247_10155212 3300009101 Bacteria 1511
127 Ga0105247_10264419 3300009101 Bacteria 1181
128 Ga0105247_10933850 3300009101 Bacteria 672
129 Ga0114129_10013186 3300009147 Bacteria 11775
130 Ga0114129_10568139 3300009147 Bacteria 1473
131 Ga0114129_11109689 3300009147 Bacteria 990
132 Ga0114129_12461318 3300009147 Unclassified 623
133 Ga0105243_10209347 3300009148 Bacteria 1716
134 Ga0105243_10691146 3300009148 Bacteria 993
135 Ga0105241_11582285 3300009174 Bacteria 633
136 Ga0105242_10182051 3300009176 Bacteria 1855
137 Ga0105242_11011142 3300009176 Unclassified 840
138 Ga0105248_10309836 3300009177 Bacteria 1778
139 Ga0105237_10932315 3300009545 Bacteria 875
140 Ga0105238_10248549 3300009551 Bacteria 1756
141 Ga0105249_10079743 3300009553 Unclassified 3039
142 Ga0105249_10163834 3300009553 Bacteria 2151
143 Ga0105249_10309320 3300009553 Bacteria 1588
144 Ga0105249_10781355 3300009553 Unclassified 1018
145 Ga0105249_11303427 3300009553 Bacteria 798
146 Ga0105239_10011585 3300010375 Bacteria 9836
147 Ga0105239_10188219 3300010375 Bacteria 2310
148 Ga0105239_10250862 3300010375 Bacteria 1988
149 Ga0105239_10521229 3300010375 Bacteria 1352
150 Ga0105239_11101896 3300010375 Bacteria 914
151 Ga0105239_11698410 3300010375 Bacteria 731
152 Ga0105246_10185887 3300011119 Bacteria 1604
153 Ga0105246_10352156 3300011119 Bacteria 1207
154 Ga0105246_10415154 3300011119 Bacteria 1121
155 Ga0157370_10002457 3300013104 Bacteria 22355
156 Ga0157369_10343291 3300013105 Bacteria 1551
157 Ga0157369_10941852 3300013105 Bacteria 885
158 Ga0157374_10019397 3300013296 Bacteria 6018
159 Ga0157374_10028132 3300013296 Bacteria 5077
160 Ga0157374_10062425 3300013296 Bacteria 3492
161 Ga0157374_11269479 3300013296 Bacteria 758
162 Ga0163162_10291099 3300013306 Bacteria 1765
163 Ga0163162_10489461 3300013306 Bacteria 1361
164 Ga0157372_10264131 3300013307 Unclassified 1999
165 Ga0157372_10337659 3300013307 Bacteria 1755
166 Ga0157372_10514521 3300013307 Bacteria 1395
167 Ga0157372_12061663 3300013307 Bacteria 655
168 Ga0157375_10121894 3300013308 Unclassified 2718
169 Ga0157375_11602839 3300013308 Bacteria 770
170 Ga0163163_10245431 3300014325 Bacteria 1841
171 Ga0163163_12216772 3300014325 Bacteria 608
172 Ga0163163_12278226 3300014325 Bacteria 600
173 Ga0157380_10100066 3300014326 Bacteria 2412
174 Ga0157380_10153936 3300014326 Bacteria 1991
175 Ga0182008_10550250 3300014497 Bacteria 641
176 Ga0157377_10009882 3300014745 Bacteria 4702
177 Ga0157377_10026690 3300014745 Bacteria 3093
178 Ga0157377_10086050 3300014745 Bacteria 1847
179 Ga0157379_10109945 3300014968 Bacteria 2475
180 Ga0157376_10535258 3300014969 Bacteria 1157
181 Ga0163161_10371815 3300017792 Bacteria 1140
182 Ga0206353_10957287 3300020082 Bacteria 13822
183 Ga0213876_10000594 3300021384 Bacteria 26891
184 Ga0213875_10011040 3300021388 Bacteria 4509
185 Ga0207692_11128167 3300025898 Bacteria 520
186 Ga0207688_10000936 3300025901 Bacteria 14756
187 Ga0207688_10220614 3300025901 Bacteria 1142
188 Ga0207699_10421205 3300025906 Bacteria 954
189 Ga0207645_10201231 3300025907 Bacteria 1310
190 Ga0207643_10427368 3300025908 Bacteria 840
191 Ga0207705_10033027 3300025909 Bacteria 3698
192 Ga0207707_10247625 3300025912 Bacteria 1548
193 Ga0207695_10558071 3300025913 Bacteria 1027
194 Ga0207693_10152962 3300025915 Bacteria 1815
195 Ga0207693_10246700 3300025915 Bacteria 1402
196 Ga0207693_10534761 3300025915 Bacteria 914
197 Ga0207693_10742145 3300025915 Bacteria 759
198 Ga0207663_10023050 3300025916 Bacteria 3568
199 Ga0207662_10061722 3300025918 Bacteria 2251
200 Ga0207657_10000199 3300025919 Bacteria 62376
201 Ga0207649_10375785 3300025920 Unclassified 1058
202 Ga0207694_10214929 3300025924 Bacteria 1567
203 Ga0207659_11523406 3300025926 Bacteria 572
204 Ga0207687_10064721 3300025927 Bacteria 2594
205 Ga0207687_10147965 3300025927 Unclassified 1789
206 Ga0207700_10268599 3300025928 Bacteria 1463
207 Ga0207700_10333543 3300025928 Bacteria 1317
208 Ga0207700_10452999 3300025928 Bacteria 1131
209 Ga0207664_10032184 3300025929 Bacteria 4017
210 Ga0207664_10035623 3300025929 Bacteria 3841
211 Ga0207664_10043765 3300025929 Bacteria 3504
212 Ga0207690_10172954 3300025932 Bacteria 1620
213 Ga0207690_10351687 3300025932 Bacteria 1165
214 Ga0207690_10668323 3300025932 Bacteria 852
215 Ga0207706_10031043 3300025933 Unclassified 4762
216 Ga0207706_10139774 3300025933 Bacteria 2130
217 Ga0207706_10450552 3300025933 Bacteria 1113
218 Ga0207686_10190886 3300025934 Bacteria 1460
219 Ga0207686_10783099 3300025934 Unclassified 763
220 Ga0207709_10284476 3300025935 Bacteria 1223
221 Ga0207709_10299056 3300025935 Bacteria 1196
222 Ga0207709_10611357 3300025935 Bacteria 864
223 Ga0207669_10134795 3300025937 Bacteria 1704
224 Ga0207704_10102494 3300025938 Bacteria 1912
225 Ga0207704_10797892 3300025938 Bacteria 788
226 Ga0207665_10837373 3300025939 Bacteria 728
227 Ga0207691_11005511 3300025940 Bacteria 696
228 Ga0207711_11545975 3300025941 Bacteria 607
229 Ga0207689_10090948 3300025942 Bacteria 2508
230 Ga0207689_10092966 3300025942 Unclassified 2477
231 Ga0207689_11119496 3300025942 Bacteria 663
232 Ga0207679_10057521 3300025945 Bacteria 2876
233 Ga0207679_10060250 3300025945 Bacteria 2819
234 Ga0207667_12106036 3300025949 Bacteria 523
235 Ga0207651_10423842 3300025960 Bacteria 1137
236 Ga0207712_10106235 3300025961 Bacteria 2097
237 Ga0207712_11196800 3300025961 Bacteria 678
238 Ga0207668_10107765 3300025972 Bacteria 2084
239 Ga0207668_10562225 3300025972 Bacteria 989
240 Ga0207640_10028507 3300025981 Bacteria 3415
241 Ga0207640_10029361 3300025981 Unclassified 3375
242 Ga0207640_10060316 3300025981 Bacteria 2507
243 Ga0207640_10431102 3300025981 Unclassified 1081
244 Ga0207677_10150444 3300026023 Bacteria 1795
245 Ga0207677_10194093 3300026023 Unclassified 1608
246 Ga0207677_10484515 3300026023 Bacteria 1066
247 Ga0207677_10707424 3300026023 Bacteria 894
248 Ga0207703_10265990 3300026035 Bacteria 1552
249 Ga0207678_10001974 3300026067 Bacteria 18692
250 Ga0207708_10001917 3300026075 Bacteria 15373
251 Ga0207708_10022924 3300026075 Bacteria 4716
252 Ga0207708_10060913 3300026075 Bacteria 2881
253 Ga0207648_10236876 3300026089 Bacteria 1624
254 Ga0207648_11356515 3300026089 Bacteria 668
255 Ga0207676_10695422 3300026095 Bacteria 985
256 Ga0207676_12131418 3300026095 Bacteria 559
257 Ga0207674_10090973 3300026116 Bacteria 3042
258 Ga0207674_10582317 3300026116 Bacteria 1081
259 Ga0207674_11910573 3300026116 Bacteria 560
260 Ga0207675_100054919 3300026118 Bacteria 3716
261 Ga0207675_101180285 3300026118 Bacteria 786
262 Ga0207683_11057554 3300026121 Unclassified 753
263 Ga0207698_10926720 3300026142 Bacteria 879
264 Ga0207698_11049402 3300026142 Bacteria 827
265 Ga0207428_10018392 3300027907 Bacteria 5971
266 Ga0268266_11508268 3300028379 Bacteria 648
267 Ga0268265_10422338 3300028380 Bacteria 1238
268 Ga0268265_11380630 3300028380 Bacteria 706
269 Ga0268264_10088452 3300028381 Bacteria 2666
270 Ga0307508_10065548 3300031616 Bacteria 3200
271 Ga0307405_10048210 3300031731 Bacteria 2626
272 Ga0307410_10004464 3300031852 Bacteria 7239
273 Ga0307410_10456608 3300031852 Bacteria 1043
274 Ga0307406_10069669 3300031901 Bacteria 2300
275 Ga0307406_10155390 3300031901 Bacteria 1638
276 Ga0307407_10000214 3300031903 Bacteria 17496
277 Ga0307407_10049774 3300031903 Bacteria 2393
278 Ga0307412_10022821 3300031911 Bacteria 3843
279 Ga0307409_100175538 3300031995 Bacteria 1890
280 Ga0307409_100601287 3300031995 Archaea 1087
281 Ga0307416_100290776 3300032002 Unclassified 1617
282 Ga0307414_10061387 3300032004 Bacteria 2662
283 Ga0307414_11724416 3300032004 Bacteria 584
284 Ga0307411_10048478 3300032005 Bacteria 2753
285 Ga0307415_101766885 3300032126 Bacteria 598
286 Ga0373936_0030790 3300035113 Unclassified 2117
287 Ga0373945_0046260 3300035116 Unclassified 1587
288 Ga0373945_0511621 3300035116 Unclassified 536
289 Ga0373954_0106279 3300035118 Unclassified 1356
290 Ga0373957_0237695 3300035120 Bacteria 765
291 Ga0373924_0055314 3300035410 Unclassified 1651
292 Ga0373931_0788707 3300035691 Bacteria 633
293 Ga0373935_1292430 3300035692 Bacteria 545
294 Ga0373933_0020448 3300035724 Bacteria 3752
295 Ga0373947_0305143 3300035725 Bacteria 1062
296 Ga0373937_0194051 3300036401 Unclassified 1908
297 Ga0373925_0544428 3300037068 Bacteria 954
298 Ga0436364_0729628 3300037853 Bacteria 9317
299 Ga0395901_1858137 3300038443 Bacteria 550
300 Ga0436365_0160922 3300039437 Bacteria 31844
301 Ga0451797_0041795 3300041453 Unclassified 603
302 Ga0451797_0354308 3300041453 Bacteria 580
303 Ga0451853_0812913 3300041512 Unclassified 917
304 Ga0451853_1059127 3300041512 Unclassified 834
305 Ga0439454_096910 3300042011 Bacteria 551
306 Ga0439463_064602 3300042016 Bacteria 936
307 Ga0450920_002446 3300042122 Bacteria 3161
308 Ga0439440_0202109 3300042993 Bacteria 589
309 Ga0466963_0059023 3300044694 Bacteria 2560
310 Ga0466963_0456672 3300044694 Bacteria 901
311 Ga0466968_0120663 3300044735 Bacteria 1186
312 Ga0466959_1001477 3300045049 Bacteria 556
313 Ga0466958_0006885 3300045836 Bacteria 6216
314 Ga0466967_0000326 3300045976 Bacteria 21716
315 Ga0466967_0053025 3300045976 Bacteria 3563
316 Ga0495592_0024297 3300046454 Bacteria 4608
317 Ga0495629_0138075 3300046459 Unclassified 1697
318 Ga0495641_0154100 3300046461 Bacteria 1027
319 Ga0495651_0007732 3300046462 Bacteria 8224
320 Ga0495653_0003344 3300046463 Bacteria 12890
321 Ga0495580_0205311 3300046472 Bacteria 1357
322 Ga0495582_0384836 3300046473 Bacteria 809
323 Ga0495662_0056460 3300046476 Unclassified 1896
324 Ga0495664_0227830 3300046477 Unclassified 1128
325 Ga0495607_0171150 3300046501 Bacteria 1097
326 Ga0495608_0129634 3300046511 Unclassified 1614
327 Ga0495616_0449105 3300046513 Unclassified 522
328 Ga0495618_0026207 3300046514 Bacteria 3622
329 Ga0495628_0119412 3300046516 Unclassified 2023
330 Ga0495630_0155166 3300046517 Unclassified 1742
331 Ga0495630_0839700 3300046517 Unclassified 701
332 Ga0495652_0026219 3300046529 Bacteria 5151
333 Ga0495665_0059310 3300046531 Bacteria 2020
334 Ga0495640_0001989 3300046533 Bacteria 16300
335 Ga0495640_0691280 3300046533 Unclassified 612
336 Ga0495587_0003841 3300046536 Bacteria 9968
337 Ga0495645_0029004 3300046543 Bacteria 4021
338 Ga0495667_0001030 3300046559 Bacteria 18064
339 Ga0495656_0218486 3300046615 Bacteria 952
340 Ga0495634_0017951 3300046642 Bacteria 5042
341 Ga0495635_0005692 3300046663 Bacteria 8683
342 Ga0495657_0019851 3300046675 Bacteria 4843
343 Ga0495599_0060897 3300046678 Bacteria 2359
344 Ga0495623_0151162 3300046679 Unclassified 1372
345 Ga0495646_0002615 3300046680 Bacteria 11113
346 Ga0495613_0113511 3300046689 Unclassified 1951
347 Ga0495670_0578862 3300046691 Bacteria 611
348 Ga0495670_0742395 3300046691 Bacteria 535
349 Ga0495600_0026599 3300046809 Bacteria 3735
350 Ga0495581_0125997 3300047315 Bacteria 1491
351 Ga0495604_0021668 3300047317 Bacteria 5130
352 Ga0495674_0075368 3300047319 Bacteria 2903
353 Ga0495674_0985008 3300047319 Bacteria 647
354 Ga0495676_0101991 3300047321 Unclassified 2121
355 Ga0495676_0618190 3300047321 Bacteria 705
356 Ga0495680_0021451 3300047322 Bacteria 5407
357 Ga0495675_0034778 3300047444 Bacteria 3217
358 Ga0495677_0132949 3300047445 Unclassified 953
359 Ga0495684_0082412 3300047471 Bacteria 2440
360 Ga0495684_0408108 3300047471 Bacteria 952
361 Ga0495602_0013715 3300048088 Bacteria 8265
362 Ga0496100_0011925 3300048903 Bacteria 4965
363 Ga0496100_0037119 3300048903 Bacteria 3078
364 Ga0496101_0151972 3300048904 Bacteria 1771
365 Ga0496101_0358318 3300048904 Unclassified 1147
366 Ga0496101_0363341 3300048904 Bacteria 1138
367 Ga0496101_0374132 3300048904 Unclassified 1120
368 Ga0496101_1053840 3300048904 Bacteria 639
369 Ga0496101_1564657 3300048904 Bacteria 513
370 Ga0496102_0173428 3300048905 Bacteria 2030
371 Ga0496102_1392205 3300048905 Bacteria 620
372 Ga0496103_0281058 3300048906 Bacteria 1070
373 Ga0496104_0030181 3300048907 Bacteria 5036
374 Ga0496104_0240209 3300048907 Bacteria 1724
375 Ga0496104_0585065 3300048907 Bacteria 1027
376 Ga0496104_0642229 3300048907 Bacteria 970
377 Ga0496104_1163701 3300048907 Unclassified 675
378 Ga0496105_0056577 3300048908 Bacteria 3237
379 Ga0496105_0067924 3300048908 Bacteria 2944
380 Ga0496105_0209151 3300048908 Bacteria 1591
381 Ga0496106_0024560 3300048909 Bacteria 4482
382 Ga0496106_0046858 3300048909 Bacteria 3251
383 Ga0496106_0082210 3300048909 Bacteria 2475
384 Ga0496106_0205274 3300048909 Bacteria 1569
385 Ga0496106_0433741 3300048909 Bacteria 1056
386 Ga0496107_0037515 3300048910 Bacteria 3478
387 Ga0496107_0183371 3300048910 Bacteria 1554
388 Ga0496107_0375847 3300048910 Bacteria 1057
389 Ga0496108_0109288 3300048911 Unclassified 2363
390 Ga0496108_0144136 3300048911 Bacteria 2053
391 Ga0496108_0405100 3300048911 Bacteria 1191
392 Ga0496108_0729376 3300048911 Bacteria 858
393 Ga0496108_1175039 3300048911 Unclassified 650
394 Ga0496109_0009044 3300048912 Bacteria 8486
395 Ga0496109_0015592 3300048912 Bacteria 6628
396 Ga0496109_0074292 3300048912 Bacteria 3125
397 Ga0496109_0204659 3300048912 Unclassified 1856
398 Ga0496109_0283670 3300048912 Bacteria 1561
399 Ga0496109_0594042 3300048912 Bacteria 1043
400 Ga0496109_1194855 3300048912 Bacteria 697
401 Ga0496110_0028712 3300048913 Bacteria 4780
402 Ga0496110_0047154 3300048913 Bacteria 3772
403 Ga0496110_0079885 3300048913 Bacteria 2913
404 Ga0496110_0326415 3300048913 Bacteria 1398
405 Ga0496110_0696443 3300048913 Bacteria 917
406 Ga0496110_1197656 3300048913 Bacteria 668
407 Ga0496111_0025940 3300048914 Bacteria 4136
408 Ga0496111_0116722 3300048914 Unclassified 1969
409 Ga0496111_0417235 3300048914 Bacteria 991
410 Ga0496112_0012332 3300048915 Bacteria 7851
411 Ga0496112_0024274 3300048915 Bacteria 5803
412 Ga0496112_0371483 3300048915 Bacteria 1372
413 Ga0496112_0983078 3300048915 Bacteria 764
414 Ga0496113_0559744 3300048916 Bacteria 917
415 Ga0496113_0695138 3300048916 Bacteria 812
416 Ga0496114_0445064 3300048917 Bacteria 1147
417 Ga0496115_0172349 3300048918 Bacteria 1789
418 Ga0496115_0544128 3300048918 Bacteria 929
419 Ga0496119_0002387 3300048922 Bacteria 20628
420 Ga0496121_0007416 3300048924 Bacteria 13254
421 Ga0496121_0017242 3300048924 Bacteria 7393
422 Ga0496125_0010783 3300048928 Bacteria 9203
423 Ga0496126_0370180 3300048929 Bacteria 1168
424 Ga0501067_0621669 3300049583 Unclassified 606
425 Ga0501083_0441574 3300049744 Unclassified 847
426 nmdc:mga03n38_378299_c1 3300050490 Bacteria 775
427 nmdc:mga00v17_601305_c1 3300050491 Bacteria 709
428 nmdc:mga05p37_121079_c1 3300050507 Bacteria 3215
429 nmdc:mga05p37_1268153_c1 3300050507 Unclassified 754
430 nmdc:mga05p37_294222_c1 3300050507 Unclassified 1932
431 nmdc:mga09592_365056_c1 3300050508 Bacteria 1249
432 nmdc:mga09592_747274_c1 3300050508 Bacteria 830
433 nmdc:mga0qj67_269720_c1 3300050509 Bacteria 1380
434 nmdc:mga06r32_369347_c1 3300050510 Bacteria 1418
435 nmdc:mga08y16_55658_c1 3300050511 Bacteria 4133
436 nmdc:mga0n895_276263_c1 3300050512 Bacteria 1704
437 nmdc:mga0n895_752153_c1 3300050512 Bacteria 968
438 nmdc:mga0rr50_127421_c1 3300050513 Bacteria 2034
439 nmdc:mga0a205_691_c2 3300050515 Bacteria 22805
440 nmdc:mga0a205_844228_c1 3300050515 Bacteria 763
441 Ga0495601_0017196 3300053077 Bacteria 4389
442 Ga0495601_0233668 3300053077 Bacteria 1201
443 Ga0495595_0463408 3300053084 Bacteria 645
444 Ga0495619_0116205 3300053085 Unclassified 1831
445 Ga0495619_0620425 3300053085 Bacteria 739
446 Ga0500614_029419 3300053123 Bacteria 1333
447 Ga0466962_0276090 3300061719 Bacteria 829
448 Ga0070676_10226118
449 Ga0070658_10090205
450 Ga0070683_100054373
451 Ga0070683_100261065
452 Ga0070683_100933342
453 Ga0070683_101496851
454 Ga0070670_101459048
455 Ga0068869_100116812
456 Ga0070680_100043158
457 Ga0070680_100180077
458 Ga0070682_100014097
459 Ga0070682_100116922
460 Ga0070682_100216079
461 Ga0070682_100659433
462 Ga0068868_100063806
463 Ga0068868_100078529
464 Ga0068868_100464552
465 Ga0070687_100025784
466 Ga0070687_100809599
467 Ga0070661_100270198
468 Ga0070661_100558084
469 Ga0070668_100125012
470 Ga0070668_100129602
471 Ga0070668_100130761
472 Ga0070675_100030523
473 Ga0070675_101779699
474 Ga0070671_101191068
475 Ga0070674_101020776
476 Ga0070673_100513805
477 Ga0070659_100179309
478 Ga0070659_100851513
479 Ga0070667_100150513
480 Ga0070714_100194214
481 Ga0070714_100227073
482 Ga0070713_100052600
483 Ga0070713_101253469
484 Ga0070701_10144968
485 Ga0070701_10420866
486 Ga0070711_100077019
487 Ga0070711_100464647
488 Ga0070700_100002765
489 Ga0070700_100021068
490 Ga0070700_100267399
491 Ga0070663_100009956
492 Ga0070678_100021053
493 Ga0070678_100059427
494 Ga0070678_100444711
495 Ga0070662_100181757
496 Ga0070662_100452338
497 Ga0070681_10012251
498 Ga0070685_11305419
499 Ga0070684_100059317
500 Ga0070684_100060533
501 Ga0070684_100215061
502 Ga0070684_100806613
503 Ga0070684_101229338
504 Ga0068853_101132245
505 Ga0070672_100888280
506 Ga0070672_101415819
507 Ga0070686_100632564
508 Ga0070693_100193903
509 Ga0070665_100101694
510 Ga0070704_100784735
511 Ga0068855_100019251
512 Ga0070664_100070738
513 Ga0068857_100774099
514 Ga0068854_100100493
515 Ga0068856_100332268
516 Ga0068856_100836823
517 Ga0068856_101896379
518 Ga0070702_100002593
519 Ga0070702_100021540
520 Ga0068852_100112870
521 Ga0068852_100269632
522 Ga0068852_100880247
523 Ga0068859_100339705
524 Ga0068864_100013352
525 Ga0068864_100165073
526 Ga0068866_10015732
527 Ga0068861_100126424
528 Ga0068861_101181221
529 Ga0068870_10260431
530 Ga0068870_10502672
531 Ga0068863_100718217
532 Ga0068858_100224853
533 Ga0068860_100355102
534 Ga0068860_100961797
535 Ga0068862_100121584
536 Ga0068862_100357341
537 Ga0081455_10012426
538 Ga0081540_1042371
539 Ga0070717_10021008
540 Ga0070717_10030885
541 Ga0070717_10280593
542 Ga0070717_10777626
543 Ga0070717_10990010
544 Ga0075365_10054476
545 Ga0075363_100432336
546 Ga0070715_10077625
547 Ga0070716_100311638
548 Ga0070712_100261850
549 Ga0075367_10731371
550 Ga0075428_100104126
551 Ga0075430_100093767
552 Ga0075430_100321563
553 Ga0075431_100190454
554 Ga0075431_100385613
555 Ga0075433_10018002
556 Ga0075434_100003384
557 Ga0075429_100340824
558 Ga0068865_100051946
559 Ga0068865_100237803
560 Ga0068865_100241085
561 Ga0097620_100339703
562 Ga0075435_100065007
563 Ga0075435_100406335
564 Ga0075435_101041979
565 Ga0105240_10045442
566 Ga0111539_10042415
567 Ga0111539_10685478
568 Ga0111539_11230810
569 Ga0105245_10006952
570 Ga0105245_10018753
571 Ga0105245_10079185
572 Ga0105245_10167013
573 Ga0105247_10155212
574 Ga0105247_10264419
575 Ga0105247_10933850
576 Ga0114129_10013186
577 Ga0114129_10568139
578 Ga0114129_11109689
579 Ga0114129_12461318
580 Ga0105243_10209347
581 Ga0105243_10691146
582 Ga0105241_11582285
583 Ga0105242_10182051
584 Ga0105242_11011142
585 Ga0105248_10309836
586 Ga0105237_10932315
587 Ga0105238_10248549
588 Ga0105249_10079743
589 Ga0105249_10163834
590 Ga0105249_10309320
591 Ga0105249_10781355
592 Ga0105249_11303427
593 Ga0105239_10011585
594 Ga0105239_10188219
595 Ga0105239_10250862
596 Ga0105239_10521229
597 Ga0105239_11101896
598 Ga0105239_11698410
599 Ga0105246_10185887
600 Ga0105246_10352156
601 Ga0105246_10415154
602 Ga0157370_10002457
603 Ga0157369_10343291
604 Ga0157369_10941852
605 Ga0157374_10019397
606 Ga0157374_10028132
607 Ga0157374_10062425
608 Ga0157374_11269479
609 Ga0163162_10291099
610 Ga0163162_10489461
611 Ga0157372_10264131
612 Ga0157372_10337659
613 Ga0157372_10514521
614 Ga0157372_12061663
615 Ga0157375_10121894
616 Ga0157375_11602839
617 Ga0163163_10245431
618 Ga0163163_12216772
619 Ga0163163_12278226
620 Ga0157380_10100066
621 Ga0157380_10153936
622 Ga0182008_10550250
623 Ga0157377_10009882
624 Ga0157377_10026690
625 Ga0157377_10086050
626 Ga0157379_10109945
627 Ga0157376_10535258
628 Ga0163161_10371815
629 Ga0206353_10957287
630 Ga0213876_10000594
631 Ga0213875_10011040
632 Ga0207692_11128167
633 Ga0207688_10000936
634 Ga0207688_10220614
635 Ga0207699_10421205
636 Ga0207645_10201231
637 Ga0207643_10427368
638 Ga0207705_10033027
639 Ga0207707_10247625
640 Ga0207695_10558071
641 Ga0207693_10152962
642 Ga0207693_10246700
643 Ga0207693_10534761
644 Ga0207693_10742145
645 Ga0207663_10023050
646 Ga0207662_10061722
647 Ga0207657_10000199
648 Ga0207649_10375785
649 Ga0207694_10214929
650 Ga0207659_11523406
651 Ga0207687_10064721
652 Ga0207687_10147965
653 Ga0207700_10268599
654 Ga0207700_10333543
655 Ga0207700_10452999
656 Ga0207664_10032184
657 Ga0207664_10035623
658 Ga0207664_10043765
659 Ga0207690_10172954
660 Ga0207690_10351687
661 Ga0207690_10668323
662 Ga0207706_10031043
663 Ga0207706_10139774
664 Ga0207706_10450552
665 Ga0207686_10190886
666 Ga0207686_10783099
667 Ga0207709_10284476
668 Ga0207709_10299056
669 Ga0207709_10611357
670 Ga0207669_10134795
671 Ga0207704_10102494
672 Ga0207704_10797892
673 Ga0207665_10837373
674 Ga0207691_11005511
675 Ga0207711_11545975
676 Ga0207689_10090948
677 Ga0207689_10092966
678 Ga0207689_11119496
679 Ga0207679_10057521
680 Ga0207679_10060250
681 Ga0207667_12106036
682 Ga0207651_10423842
683 Ga0207712_10106235
684 Ga0207712_11196800
685 Ga0207668_10107765
686 Ga0207668_10562225
687 Ga0207640_10028507
688 Ga0207640_10029361
689 Ga0207640_10060316
690 Ga0207640_10431102
691 Ga0207677_10150444
692 Ga0207677_10194093
693 Ga0207677_10484515
694 Ga0207677_10707424
695 Ga0207703_10265990
696 Ga0207678_10001974
697 Ga0207708_10001917
698 Ga0207708_10022924
699 Ga0207708_10060913
700 Ga0207648_10236876
701 Ga0207648_11356515
702 Ga0207676_10695422
703 Ga0207676_12131418
704 Ga0207674_10090973
705 Ga0207674_10582317
706 Ga0207674_11910573
707 Ga0207675_100054919
708 Ga0207675_101180285
709 Ga0207683_11057554
710 Ga0207698_10926720
711 Ga0207698_11049402
712 Ga0207428_10018392
713 Ga0268266_11508268
714 Ga0268265_10422338
715 Ga0268265_11380630
716 Ga0268264_10088452
717 Ga0307508_10065548
718 Ga0307405_10048210
719 Ga0307410_10004464
720 Ga0307410_10456608
721 Ga0307406_10069669
722 Ga0307406_10155390
723 Ga0307407_10000214
724 Ga0307407_10049774
725 Ga0307412_10022821
726 Ga0307409_100175538
727 Ga0307409_100601287
728 Ga0307416_100290776
729 Ga0307414_10061387
730 Ga0307414_11724416
731 Ga0307411_10048478
732 Ga0307415_101766885
733 Ga0373936_0030790
734 Ga0373945_0046260
735 Ga0373945_0511621
736 Ga0373954_0106279
737 Ga0373957_0237695
738 Ga0373924_0055314
739 Ga0373931_0788707
740 Ga0373935_1292430
741 Ga0373933_0020448
742 Ga0373947_0305143
743 Ga0373937_0194051
744 Ga0373925_0544428
745 Ga0436364_0729628
746 Ga0395901_1858137
747 Ga0436365_0160922
748 Ga0451797_0041795
749 Ga0451797_0354308
750 Ga0451853_0812913
751 Ga0451853_1059127
752 Ga0439454_096910
753 Ga0439463_064602
754 Ga0450920_002446
755 Ga0439440_0202109
756 Ga0466963_0059023
757 Ga0466963_0456672
758 Ga0466968_0120663
759 Ga0466959_1001477
760 Ga0466958_0006885
761 Ga0466967_0000326
762 Ga0466967_0053025
763 Ga0495592_0024297
764 Ga0495629_0138075
765 Ga0495641_0154100
766 Ga0495651_0007732
767 Ga0495653_0003344
768 Ga0495580_0205311
769 Ga0495582_0384836
770 Ga0495662_0056460
771 Ga0495664_0227830
772 Ga0495607_0171150
773 Ga0495608_0129634
774 Ga0495616_0449105
775 Ga0495618_0026207
776 Ga0495628_0119412
777 Ga0495630_0155166
778 Ga0495630_0839700
779 Ga0495652_0026219
780 Ga0495665_0059310
781 Ga0495640_0001989
782 Ga0495640_0691280
783 Ga0495587_0003841
784 Ga0495645_0029004
785 Ga0495667_0001030
786 Ga0495656_0218486
787 Ga0495634_0017951
788 Ga0495635_0005692
789 Ga0495657_0019851
790 Ga0495599_0060897
791 Ga0495623_0151162
792 Ga0495646_0002615
793 Ga0495613_0113511
794 Ga0495670_0578862
795 Ga0495670_0742395
796 Ga0495600_0026599
797 Ga0495581_0125997
798 Ga0495604_0021668
799 Ga0495674_0075368
800 Ga0495674_0985008
801 Ga0495676_0101991
802 Ga0495676_0618190
803 Ga0495680_0021451
804 Ga0495675_0034778
805 Ga0495677_0132949
806 Ga0495684_0082412
807 Ga0495684_0408108
808 Ga0495602_0013715
809 Ga0496100_0011925
810 Ga0496100_0037119
811 Ga0496101_0151972
812 Ga0496101_0358318
813 Ga0496101_0363341
814 Ga0496101_0374132
815 Ga0496101_1053840
816 Ga0496101_1564657
817 Ga0496102_0173428
818 Ga0496102_1392205
819 Ga0496103_0281058
820 Ga0496104_0030181
821 Ga0496104_0240209
822 Ga0496104_0585065
823 Ga0496104_0642229
824 Ga0496104_1163701
825 Ga0496105_0056577
826 Ga0496105_0067924
827 Ga0496105_0209151
828 Ga0496106_0024560
829 Ga0496106_0046858
830 Ga0496106_0082210
831 Ga0496106_0205274
832 Ga0496106_0433741
833 Ga0496107_0037515
834 Ga0496107_0183371
835 Ga0496107_0375847
836 Ga0496108_0109288
837 Ga0496108_0144136
838 Ga0496108_0405100
839 Ga0496108_0729376
840 Ga0496108_1175039
841 Ga0496109_0009044
842 Ga0496109_0015592
843 Ga0496109_0074292
844 Ga0496109_0204659
845 Ga0496109_0283670
846 Ga0496109_0594042
847 Ga0496109_1194855
848 Ga0496110_0028712
849 Ga0496110_0047154
850 Ga0496110_0079885
851 Ga0496110_0326415
852 Ga0496110_0696443
853 Ga0496110_1197656
854 Ga0496111_0025940
855 Ga0496111_0116722
856 Ga0496111_0417235
857 Ga0496112_0012332
858 Ga0496112_0024274
859 Ga0496112_0371483
860 Ga0496112_0983078
861 Ga0496113_0559744
862 Ga0496113_0695138
863 Ga0496114_0445064
864 Ga0496115_0172349
865 Ga0496115_0544128
866 Ga0496119_0002387
867 Ga0496121_0007416
868 Ga0496121_0017242
869 Ga0496125_0010783
870 Ga0496126_0370180
871 Ga0501067_0621669
872 Ga0501083_0441574
873 nmdc:mga03n38_378299_c1
874 nmdc:mga00v17_601305_c1
875 nmdc:mga05p37_121079_c1
876 nmdc:mga05p37_1268153_c1
877 nmdc:mga05p37_294222_c1
878 nmdc:mga09592_365056_c1
879 nmdc:mga09592_747274_c1
880 nmdc:mga0qj67_269720_c1
881 nmdc:mga06r32_369347_c1
882 nmdc:mga08y16_55658_c1
883 nmdc:mga0n895_276263_c1
884 nmdc:mga0n895_752153_c1
885 nmdc:mga0rr50_127421_c1
886 nmdc:mga0a205_691_c2
887 nmdc:mga0a205_844228_c1
888 Ga0495601_0017196
889 Ga0495601_0233668
890 Ga0495595_0463408
891 Ga0495619_0116205
892 Ga0495619_0620425
893 Ga0500614_029419
894 Ga0466962_0276090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

151

0.96

PF18029

Glyoxalase_6

Glyoxalase-like domain

36

152

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8254 8 129
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8166 7 132
1xy7-assembly1.cif.gz_A x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8131 8 128
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.8106 7 132
2zw7-assembly1.cif.gz_B crystal structure of bleomycin n-acetyltransferase complexed with bleomycin a2 and coenzyme a 0.807 1 132
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9516 78 144 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9253 78 144 3.30.720.110
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.865 8 63 3.30.720.120
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8427 77 132 3.30.720.110
af_I1N1R1_19_162_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.841 8 137 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A522DD24-F1-model_v4 VOC family protein 0.967 6 147
AF-A0A1H4FZI4-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.958 8 147
AF-A0A4R0K191-F1-model_v4 VOC family protein 0.9539 8 149
AF-A0A1Q7H029-F1-model_v4 VOC domain-containing protein 0.9513 78 137
AF-A0A059U1I8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9512 81 148 GO:0051213

Map