F445865

General Info

Members Datasets Scaffolds Average Seq Length
447 238 894 184

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1000071|Ga0055540_1000071104
Length 193
Sequence MTSFPRAQLENWVERWLQVNRDAEAAGDWKPMADFYTEDATYGWNIGPKEDVMCLGKAEIRDIALGLEMEGLEGWKYPYQRVVIDDKQGEVVGFWKQVVAVGGADNSDGAPESEYLEIYGIGGSWFRLENVDGEPKIAWQRDFFDFGHVQKLYLDLMTAGKLSKGMQQRIQRSLAGEQLPGYYPLGEAPVPIW

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
145 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
149 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
150 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
151 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
152 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
153 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
221 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
222 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
231 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
232 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
233 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
234 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
235 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
236 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
237 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
238 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.29
Nodule 0
Rhizoplane 10.07
Rhizosphere 70.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1000071 3300003792 Bacteria 117607
2 CNXas_1000501 3300000545 Bacteria 2657
3 JGI24743J22301_10020191 3300001991 Bacteria 1269
4 JGI24748J21848_1005258 3300002074 Bacteria 1499
5 JGI24034J26672_10030153 3300002239 Bacteria 880
6 JGI24742J22300_10050402 3300002244 Bacteria 753
7 Ga0055540_1001578 3300003792 Bacteria 13291
8 Ga0055540_1002279 3300003792 Bacteria 10345
9 Ga0070683_100714071 3300005329 Bacteria 960
10 Ga0068869_100098688 3300005334 Bacteria 2206
11 Ga0070682_100220027 3300005337 Bacteria 1351
12 Ga0068868_100092366 3300005338 Bacteria 2439
13 Ga0068868_100515102 3300005338 Bacteria 1049
14 Ga0070691_10047759 3300005341 Bacteria 2036
15 Ga0070691_10435680 3300005341 Bacteria 746
16 Ga0070668_100002818 3300005347 Bacteria 12799
17 Ga0070668_100132398 3300005347 Bacteria 2002
18 Ga0070668_100559907 3300005347 Bacteria 996
19 Ga0070669_100010174 3300005353 Bacteria 6686
20 Ga0070671_100173205 3300005355 Bacteria 1825
21 Ga0070671_100176142 3300005355 Bacteria 1810
22 Ga0070674_100021753 3300005356 Bacteria 4125
23 Ga0070673_100394727 3300005364 Bacteria 1236
24 Ga0070688_100170233 3300005365 Bacteria 1502
25 Ga0070659_100605710 3300005366 Bacteria 942
26 Ga0070667_100000324 3300005367 Bacteria 53403
27 Ga0070667_100000487 3300005367 Bacteria 40279
28 Ga0070667_100276938 3300005367 Bacteria 1506
29 Ga0070709_10168667 3300005434 Bacteria 1528
30 Ga0070709_10371694 3300005434 Bacteria 1061
31 Ga0070709_10612218 3300005434 Bacteria 840
32 Ga0070714_100409602 3300005435 Bacteria 1283
33 Ga0070714_100634426 3300005435 Bacteria 1028
34 Ga0070713_100315494 3300005436 Bacteria 1442
35 Ga0070713_100498292 3300005436 Bacteria 1149
36 Ga0070710_10005112 3300005437 Bacteria 6207
37 Ga0070710_10019443 3300005437 Bacteria 3510
38 Ga0070711_100012191 3300005439 Bacteria 5366
39 Ga0070711_100141914 3300005439 Bacteria 1802
40 Ga0070705_100042166 3300005440 Bacteria 2607
41 Ga0070705_100411958 3300005440 Bacteria 1004
42 Ga0070700_100765199 3300005441 Bacteria 774
43 Ga0070663_100115301 3300005455 Bacteria 2023
44 Ga0070663_101548627 3300005455 Bacteria 590
45 Ga0070678_100222797 3300005456 Bacteria 1568
46 Ga0070678_100903228 3300005456 Bacteria 807
47 Ga0070662_100386483 3300005457 Bacteria 1153
48 Ga0070685_10461645 3300005466 Bacteria 892
49 Ga0070685_10582852 3300005466 Bacteria 803
50 Ga0070707_100208290 3300005468 Bacteria 1906
51 Ga0068853_100059988 3300005539 Bacteria 3286
52 Ga0070696_100486035 3300005546 Bacteria 980
53 Ga0070693_100044060 3300005547 Bacteria 2523
54 Ga0070693_100250492 3300005547 Bacteria 1174
55 Ga0070665_100025634 3300005548 Bacteria 5940
56 Ga0070665_100052834 3300005548 Bacteria 4075
57 Ga0070704_100017533 3300005549 Bacteria 4555
58 Ga0068855_101328671 3300005563 Bacteria 743
59 Ga0068854_101133152 3300005578 Bacteria 698
60 Ga0070702_100023413 3300005615 Bacteria 3281
61 Ga0070702_100146703 3300005615 Bacteria 1509
62 Ga0070702_100896120 3300005615 Bacteria 694
63 Ga0068852_100271031 3300005616 Bacteria 1633
64 Ga0068852_100296558 3300005616 Bacteria 1563
65 Ga0068859_100001593 3300005617 Bacteria 23142
66 Ga0068859_100048013 3300005617 Bacteria 4289
67 Ga0068859_100730621 3300005617 Bacteria 1080
68 Ga0068859_101019775 3300005617 Bacteria 909
69 Ga0068859_101212503 3300005617 Bacteria 831
70 Ga0068859_101287499 3300005617 Bacteria 805
71 Ga0068864_100119917 3300005618 Bacteria 2351
72 Ga0068864_100968209 3300005618 Bacteria 843
73 Ga0068866_10010902 3300005718 Bacteria 3914
74 Ga0068866_10231919 3300005718 Bacteria 1120
75 Ga0068866_10546311 3300005718 Bacteria 774
76 Ga0068861_100318477 3300005719 Bacteria 1354
77 Ga0068861_100355418 3300005719 Bacteria 1287
78 Ga0068863_100000143 3300005841 Bacteria 75127
79 Ga0068858_100327645 3300005842 Bacteria 1464
80 Ga0068858_100544849 3300005842 Bacteria 1123
81 Ga0068860_100000079 3300005843 Bacteria 170752
82 Ga0068860_100154040 3300005843 Bacteria 2214
83 Ga0068860_100309573 3300005843 Bacteria 1548
84 Ga0068862_100000093 3300005844 Bacteria 106838
85 Ga0068862_100128522 3300005844 Bacteria 2239
86 Ga0068862_100270287 3300005844 Bacteria 1554
87 Ga0081455_10028885 3300005937 Bacteria 5061
88 Ga0081455_10042477 3300005937 Bacteria 3987
89 Ga0081540_1136541 3300005983 Bacteria 992
90 Ga0075365_10111093 3300006038 Bacteria 1884
91 Ga0075365_10174330 3300006038 Bacteria 1502
92 Ga0075363_100005404 3300006048 Bacteria 5677
93 Ga0075363_100224841 3300006048 Bacteria 1076
94 Ga0075363_100242700 3300006048 Bacteria 1036
95 Ga0075364_10004041 3300006051 Bacteria 8423
96 Ga0075364_10006554 3300006051 Bacteria 6848
97 Ga0075364_10119318 3300006051 Bacteria 1765
98 Ga0075364_10144738 3300006051 Bacteria 1600
99 Ga0070716_100195974 3300006173 Bacteria 1339
100 Ga0070716_100262179 3300006173 Bacteria 1183
101 Ga0070712_100070316 3300006175 Bacteria 2500
102 Ga0075367_10148904 3300006178 Bacteria 1452
103 Ga0075369_10068581 3300006186 Bacteria 1559
104 Ga0075369_10097313 3300006186 Bacteria 1318
105 Ga0075369_10131469 3300006186 Bacteria 1138
106 Ga0097621_100132843 3300006237 Bacteria 2120
107 Ga0097621_100738030 3300006237 Bacteria 909
108 Ga0075370_10445559 3300006353 Bacteria 779
109 Ga0068871_100290901 3300006358 Bacteria 1431
110 Ga0075428_100007875 3300006844 Bacteria 11813
111 Ga0075430_100018039 3300006846 Bacteria 6006
112 Ga0075431_100051836 3300006847 Bacteria 4231
113 Ga0075434_100660195 3300006871 Bacteria 1064
114 Ga0068865_100140161 3300006881 Bacteria 1822
115 Ga0068865_100141876 3300006881 Bacteria 1812
116 Ga0097620_100001593 3300006931 Bacteria 23142
117 Ga0097620_100048011 3300006931 Bacteria 4289
118 Ga0097620_100730549 3300006931 Bacteria 1080
119 Ga0097620_101019803 3300006931 Bacteria 909
120 Ga0097620_101212123 3300006931 Bacteria 831
121 Ga0097620_101287464 3300006931 Bacteria 805
122 Ga0099795_10147670 3300007788 Bacteria 961
123 Ga0105250_10073398 3300009092 Bacteria 1384
124 Ga0111539_11106227 3300009094 Bacteria 921
125 Ga0105245_10384630 3300009098 Bacteria 1398
126 Ga0105247_10000044 3300009101 Bacteria 153728
127 Ga0105247_10057458 3300009101 Bacteria 2406
128 Ga0105247_10243514 3300009101 Bacteria 1226
129 Ga0105247_10351437 3300009101 Bacteria 1037
130 Ga0114129_10534959 3300009147 Bacteria 1526
131 Ga0105243_10063567 3300009148 Bacteria 2958
132 Ga0105243_10303230 3300009148 Bacteria 1449
133 Ga0105242_10069015 3300009176 Bacteria 2927
134 Ga0105242_10296099 3300009176 Bacteria 1475
135 Ga0105242_10525113 3300009176 Bacteria 1130
136 Ga0105248_10000060 3300009177 Bacteria 131634
137 Ga0105248_10058720 3300009177 Bacteria 4320
138 Ga0105248_10406231 3300009177 Bacteria 1533
139 Ga0105237_10027148 3300009545 Bacteria 5847
140 Ga0105237_10303847 3300009545 Bacteria 1599
141 Ga0105237_10427734 3300009545 Bacteria 1330
142 Ga0105238_10316131 3300009551 Bacteria 1547
143 Ga0105238_11541376 3300009551 Bacteria 694
144 Ga0105249_10000049 3300009553 Bacteria 169899
145 Ga0105249_10008884 3300009553 Bacteria 8775
146 Ga0105249_10415224 3300009553 Bacteria 1378
147 Ga0105249_11384652 3300009553 Bacteria 775
148 Ga0105239_10183339 3300010375 Bacteria 2342
149 Ga0105239_10239462 3300010375 Bacteria 2036
150 Ga0105239_10630697 3300010375 Bacteria 1223
151 Ga0105239_11069177 3300010375 Bacteria 929
152 Ga0105239_11699933 3300010375 Bacteria 730
153 Ga0105246_10015077 3300011119 Bacteria 4871
154 Ga0157369_10077572 3300013105 Bacteria 3561
155 Ga0157369_10343866 3300013105 Bacteria 1550
156 Ga0157374_10045108 3300013296 Bacteria 4079
157 Ga0157378_10171984 3300013297 Bacteria 2032
158 Ga0157378_10421875 3300013297 Bacteria 1319
159 Ga0157378_10648908 3300013297 Bacteria 1071
160 Ga0163162_10060689 3300013306 Bacteria 3817
161 Ga0163162_10285038 3300013306 Bacteria 1784
162 Ga0163162_10594139 3300013306 Bacteria 1233
163 Ga0163162_12017642 3300013306 Bacteria 661
164 Ga0157372_11379644 3300013307 Bacteria 813
165 Ga0157375_10168224 3300013308 Bacteria 2338
166 Ga0157375_11051396 3300013308 Bacteria 952
167 Ga0157380_10288461 3300014326 Bacteria 1506
168 Ga0157380_10824469 3300014326 Bacteria 947
169 Ga0157377_10000892 3300014745 Bacteria 12459
170 Ga0157379_10108278 3300014968 Bacteria 2495
171 Ga0157379_10555260 3300014968 Bacteria 1069
172 Ga0163161_10254066 3300017792 Bacteria 1371
173 Ga0163161_10638032 3300017792 Bacteria 881
174 Ga0213876_10001760 3300021384 Bacteria 13128
175 Ga0213876_10326448 3300021384 Bacteria 816
176 Ga0224572_1045447 3300024225 Bacteria 823
177 Ga0209673_1073445 3300025273 Bacteria 806
178 Ga0209051_1000033 3300025303 Bacteria 380540
179 Ga0209051_1000776 3300025303 Bacteria 33909
180 Ga0207696_1070723 3300025711 Bacteria 970
181 Ga0207692_10169845 3300025898 Bacteria 1263
182 Ga0207642_10109109 3300025899 Bacteria 1405
183 Ga0207642_10264778 3300025899 Bacteria 982
184 Ga0207710_10000066 3300025900 Bacteria 153734
185 Ga0207688_10015934 3300025901 Bacteria 4075
186 Ga0207699_10329263 3300025906 Bacteria 1073
187 Ga0207693_10002311 3300025915 Bacteria 16577
188 Ga0207693_10731421 3300025915 Bacteria 765
189 Ga0207662_10020853 3300025918 Bacteria 3741
190 Ga0207681_10002233 3300025923 Bacteria 12310
191 Ga0207687_10346559 3300025927 Bacteria 1209
192 Ga0207700_10017600 3300025928 Bacteria 4777
193 Ga0207700_10375414 3300025928 Bacteria 1242
194 Ga0207664_10021970 3300025929 Bacteria 4755
195 Ga0207664_10068569 3300025929 Bacteria 2850
196 Ga0207644_10396318 3300025931 Bacteria 1128
197 Ga0207690_10785200 3300025932 Bacteria 786
198 Ga0207706_10072187 3300025933 Bacteria 3036
199 Ga0207706_10602926 3300025933 Bacteria 943
200 Ga0207686_10263893 3300025934 Bacteria 1264
201 Ga0207709_10153522 3300025935 Bacteria 1597
202 Ga0207669_10047798 3300025937 Bacteria 2537
203 Ga0207669_10392570 3300025937 Bacteria 1084
204 Ga0207704_10042825 3300025938 Bacteria 2668
205 Ga0207704_10513871 3300025938 Bacteria 967
206 Ga0207665_10018954 3300025939 Bacteria 4521
207 Ga0207665_10531590 3300025939 Bacteria 912
208 Ga0207691_10145845 3300025940 Bacteria 2083
209 Ga0207711_10000058 3300025941 Bacteria 133317
210 Ga0207689_10108936 3300025942 Bacteria 2276
211 Ga0207667_10184253 3300025949 Bacteria 2144
212 Ga0207651_10286471 3300025960 Bacteria 1364
213 Ga0207712_10000038 3300025961 Bacteria 192762
214 Ga0207712_10031183 3300025961 Bacteria 3588
215 Ga0207668_10001652 3300025972 Bacteria 13029
216 Ga0207668_10141314 3300025972 Bacteria 1852
217 Ga0207640_10464885 3300025981 Bacteria 1046
218 Ga0207658_10000061 3300025986 Bacteria 119045
219 Ga0207658_10005238 3300025986 Bacteria 8921
220 Ga0207658_10025851 3300025986 Bacteria 4112
221 Ga0207658_10488276 3300025986 Bacteria 1095
222 Ga0207677_10202640 3300026023 Bacteria 1578
223 Ga0207677_10208642 3300026023 Bacteria 1558
224 Ga0207703_10047929 3300026035 Bacteria 3446
225 Ga0207703_10572262 3300026035 Bacteria 1067
226 Ga0207639_10246349 3300026041 Bacteria 1556
227 Ga0207678_10043455 3300026067 Bacteria 3888
228 Ga0207678_10254275 3300026067 Bacteria 1505
229 Ga0207678_10672623 3300026067 Bacteria 910
230 Ga0207708_10140519 3300026075 Bacteria 1894
231 Ga0207708_10888119 3300026075 Bacteria 771
232 Ga0207702_10853648 3300026078 Bacteria 901
233 Ga0207641_10000232 3300026088 Bacteria 71885
234 Ga0207641_11408324 3300026088 Bacteria 698
235 Ga0207676_10094860 3300026095 Bacteria 2459
236 Ga0207675_100150777 3300026118 Bacteria 2212
237 Ga0207675_100271772 3300026118 Bacteria 1645
238 Ga0207675_100326929 3300026118 Bacteria 1498
239 Ga0207675_100436721 3300026118 Bacteria 1295
240 Ga0207683_10053314 3300026121 Bacteria 3546
241 Ga0207683_10249616 3300026121 Bacteria 1619
242 Ga0207698_10032304 3300026142 Bacteria 3791
243 Ga0207698_10460838 3300026142 Bacteria 1229
244 Ga0268266_10018080 3300028379 Bacteria 6008
245 Ga0268266_10027281 3300028379 Bacteria 4857
246 Ga0268265_10000053 3300028380 Bacteria 170215
247 Ga0268265_10105892 3300028380 Bacteria 2283
248 Ga0268265_10675310 3300028380 Bacteria 995
249 Ga0268264_10000017 3300028381 Bacteria 498037
250 Ga0268264_10341377 3300028381 Bacteria 1423
251 Ga0268264_10802562 3300028381 Bacteria 940
252 Ga0268264_10954960 3300028381 Bacteria 862
253 Ga0265327_10000128 3300031251 Bacteria 165601
254 Ga0265327_10002212 3300031251 Bacteria 21240
255 Ga0265327_10006336 3300031251 Bacteria 9495
256 Ga0307413_10168856 3300031824 Bacteria 1546
257 Ga0307406_10066523 3300031901 Bacteria 2346
258 Ga0307415_101732405 3300032126 Bacteria 603
259 Ga0373949_0010835 3300035090 Bacteria 2003
260 Ga0373942_0044809 3300035207 Bacteria 1220
261 Ga0316584_0140498 3300036712 Bacteria 1801
262 Ga0436364_0224006 3300037853 Bacteria 27953
263 Ga0436364_1128610 3300037853 Bacteria 676
264 Ga0436364_1545518 3300037853 Bacteria 5045
265 Ga0436365_0271296 3300039437 Bacteria 39035
266 Ga0436365_0397989 3300039437 Bacteria 12470
267 Ga0436360_1241607 3300039438 Bacteria 1215
268 Ga0439461_0004216 3300041410 Bacteria 2391
269 Ga0439461_0004241 3300041410 Bacteria 2386
270 Ga0439466_0006362 3300041411 Bacteria 4492
271 Ga0439466_0022319 3300041411 Bacteria 2235
272 Ga0439465_0003069 3300041413 Bacteria 5465
273 Ga0439465_0004735 3300041413 Bacteria 4390
274 Ga0451787_197336 3300041441 Bacteria 676
275 Ga0451797_0595584 3300041453 Bacteria 781
276 Ga0451843_0893763 3300041509 Bacteria 709
277 Ga0439431_0010229 3300041997 Bacteria 2126
278 Ga0439431_0013022 3300041997 Bacteria 1916
279 Ga0439442_034823 3300042002 Bacteria 1053
280 Ga0439445_0008520 3300042004 Bacteria 2399
281 Ga0439445_0021620 3300042004 Bacteria 1617
282 Ga0439445_0138686 3300042004 Bacteria 704
283 Ga0439434_0000830 3300042435 Bacteria 8911
284 Ga0439434_0036882 3300042435 Bacteria 1496
285 Ga0466969_0027229 3300044656 Bacteria 2928
286 Ga0466972_0006441 3300044658 Bacteria 5896
287 Ga0466972_0015260 3300044658 Bacteria 3841
288 Ga0466972_0159389 3300044658 Bacteria 1060
289 Ga0466965_0000732 3300044683 Bacteria 12261
290 Ga0466965_0014710 3300044683 Bacteria 3704
291 Ga0466965_0041765 3300044683 Bacteria 2260
292 Ga0466965_0048096 3300044683 Bacteria 2113
293 Ga0466965_0080184 3300044683 Bacteria 1649
294 Ga0466965_0114268 3300044683 Bacteria 1390
295 Ga0466966_0000813 3300044684 Bacteria 19883
296 Ga0466966_0008098 3300044684 Bacteria 6968
297 Ga0466961_0016015 3300044693 Bacteria 4813
298 Ga0466961_0016143 3300044693 Bacteria 4795
299 Ga0466963_0025090 3300044694 Bacteria 3799
300 Ga0466963_0054065 3300044694 Bacteria 2668
301 Ga0466971_0006145 3300044719 Bacteria 5222
302 Ga0466968_0004166 3300044735 Bacteria 5388
303 Ga0466968_0008858 3300044735 Bacteria 3862
304 Ga0466970_0004676 3300044765 Bacteria 6759
305 Ga0466970_0021441 3300044765 Bacteria 3364
306 Ga0466957_0008951 3300044842 Bacteria 5706
307 Ga0466957_0015003 3300044842 Bacteria 4520
308 Ga0466957_0031479 3300044842 Bacteria 3170
309 Ga0466957_0088930 3300044842 Bacteria 1933
310 Ga0466960_0000220 3300044901 Bacteria 19822
311 Ga0466960_0007139 3300044901 Bacteria 4520
312 Ga0466960_0094148 3300044901 Bacteria 1532
313 Ga0466960_0164285 3300044901 Bacteria 1194
314 Ga0466959_0013172 3300045049 Bacteria 5991
315 Ga0466959_0020200 3300045049 Bacteria 4904
316 Ga0466959_0107253 3300045049 Bacteria 1996
317 Ga0466958_0002045 3300045836 Bacteria 9966
318 Ga0466958_0030847 3300045836 Bacteria 3186
319 Ga0466958_0059437 3300045836 Bacteria 2326
320 Ga0466967_0003081 3300045976 Bacteria 10717
321 Ga0466967_0086075 3300045976 Bacteria 2847
322 Ga0466967_0288452 3300045976 Bacteria 1576
323 Ga0466967_1166999 3300045976 Bacteria 767
324 Ga0495590_0084929 3300046457 Bacteria 1117
325 Ga0495638_0007186 3300046460 Bacteria 8015
326 Ga0495638_0283380 3300046460 Bacteria 899
327 Ga0495653_0123227 3300046463 Bacteria 1844
328 Ga0495606_0019624 3300046507 Bacteria 5019
329 Ga0495671_0260789 3300046692 Bacteria 836
330 Ga0495686_0007552 3300047472 Bacteria 8131
331 Ga0495686_0549694 3300047472 Bacteria 603
332 Ga0496100_0000029 3300048903 Bacteria 110710
333 Ga0496100_0002877 3300048903 Bacteria 8828
334 Ga0496100_0316833 3300048903 Bacteria 1171
335 Ga0496100_0358628 3300048903 Bacteria 1103
336 Ga0496101_0000015 3300048904 Bacteria 252368
337 Ga0496101_0000031 3300048904 Bacteria 195195
338 Ga0496101_0030710 3300048904 Bacteria 3771
339 Ga0496101_0032368 3300048904 Bacteria 3680
340 Ga0496101_0194327 3300048904 Bacteria 1567
341 Ga0496102_0000065 3300048905 Bacteria 161370
342 Ga0496102_0000336 3300048905 Bacteria 57396
343 Ga0496102_0032237 3300048905 Bacteria 4707
344 Ga0496102_0050101 3300048905 Bacteria 3801
345 Ga0496102_0298419 3300048905 Bacteria 1519
346 Ga0496102_0899632 3300048905 Bacteria 807
347 Ga0496103_0000048 3300048906 Bacteria 160911
348 Ga0496103_0000271 3300048906 Bacteria 49217
349 Ga0496103_0123360 3300048906 Bacteria 1651
350 Ga0496104_0298108 3300048907 Bacteria 1524
351 Ga0496106_0000396 3300048909 Bacteria 31087
352 Ga0496106_0035372 3300048909 Bacteria 3735
353 Ga0496106_0038878 3300048909 Bacteria 3562
354 Ga0496106_0979108 3300048909 Bacteria 666
355 Ga0496106_0993878 3300048909 Bacteria 660
356 Ga0496107_0010437 3300048910 Bacteria 6453
357 Ga0496107_0014326 3300048910 Bacteria 5552
358 Ga0496107_0181164 3300048910 Bacteria 1564
359 Ga0496107_0960881 3300048910 Bacteria 621
360 Ga0496108_0001208 3300048911 Bacteria 20256
361 Ga0496108_0038239 3300048911 Bacteria 3998
362 Ga0496108_0876751 3300048911 Bacteria 771
363 Ga0496109_0000022 3300048912 Bacteria 188901
364 Ga0496109_0079702 3300048912 Bacteria 3017
365 Ga0496109_0323130 3300048912 Bacteria 1456
366 Ga0496110_0004126 3300048913 Bacteria 11225
367 Ga0496110_0063621 3300048913 Bacteria 3260
368 Ga0496111_0004361 3300048914 Bacteria 8928
369 Ga0496112_0037889 3300048915 Bacteria 4708
370 Ga0496113_0096800 3300048916 Bacteria 2282
371 Ga0496113_0146316 3300048916 Bacteria 1862
372 Ga0496114_0000716 3300048917 Bacteria 24693
373 Ga0496114_0230511 3300048917 Bacteria 1627
374 Ga0496115_0356662 3300048918 Bacteria 1192
375 Ga0496116_0000125 3300048919 Bacteria 160885
376 Ga0496116_0003462 3300048919 Bacteria 15566
377 Ga0496116_0013160 3300048919 Bacteria 6695
378 Ga0496117_0000111 3300048920 Bacteria 184570
379 Ga0496117_0001352 3300048920 Bacteria 35887
380 Ga0496117_0008331 3300048920 Bacteria 9863
381 Ga0496118_0000083 3300048921 Bacteria 184570
382 Ga0496118_0013176 3300048921 Bacteria 7844
383 Ga0496119_0004014 3300048922 Bacteria 14877
384 Ga0496119_0007493 3300048922 Bacteria 9809
385 Ga0496119_0010640 3300048922 Bacteria 7711
386 Ga0496120_0001769 3300048923 Bacteria 24335
387 Ga0496120_0012983 3300048923 Bacteria 5635
388 Ga0496120_0042150 3300048923 Bacteria 2667
389 Ga0496121_0000004 3300048924 Bacteria 1139011
390 Ga0496121_0001000 3300048924 Bacteria 50532
391 Ga0496121_0009717 3300048924 Bacteria 11008
392 Ga0496122_0000138 3300048925 Bacteria 169434
393 Ga0496123_0034379 3300048926 Bacteria 3632
394 Ga0496124_0000012 3300048927 Bacteria 512581
395 Ga0496124_0175332 3300048927 Bacteria 1655
396 Ga0496125_0000003 3300048928 Bacteria 1189767
397 Ga0496126_0000001 3300048929 Bacteria 1139011
398 Ga0496126_0000220 3300048929 Bacteria 124547
399 Ga0496126_0004252 3300048929 Bacteria 17240
400 Ga0496126_0026981 3300048929 Bacteria 5496
401 Ga0496126_0061092 3300048929 Bacteria 3386
402 Ga0496126_0305279 3300048929 Bacteria 1311
403 Ga0501034_0206391 3300049571 Bacteria 1921
404 Ga0501034_0357814 3300049571 Bacteria 1387
405 Ga0501048_0225451 3300049582 Bacteria 1330
406 Ga0501069_0038188 3300049585 Bacteria 2651
407 Ga0501044_0140864 3300049823 Bacteria 2400
408 nmdc:mga03683_165903_c1 3300050489 Bacteria 1002
409 nmdc:mga03n38_3117_c1 3300050490 Bacteria 5271
410 nmdc:mga00v17_109122_c1 3300050491 Bacteria 1754
411 nmdc:mga00v17_214051_c1 3300050491 Bacteria 1247
412 nmdc:mga00v17_37382_c1 3300050491 Bacteria 2899
413 nmdc:mga00v17_5765_c1 3300050491 Bacteria 6545
414 nmdc:mga00v17_75016_c1 3300050491 Bacteria 2102
415 nmdc:mga0yw44_115776_c2 3300050492 Bacteria 1425
416 nmdc:mga0yw44_4095_c1 3300050492 Bacteria 6611
417 nmdc:mga0yw44_497635_c1 3300050492 Bacteria 827
418 nmdc:mga07m45_34752_c1 3300050496 Bacteria 2802
419 nmdc:mga05p37_433381_c1 3300050507 Bacteria 1527
420 nmdc:mga0qj67_279176_c1 3300050509 Bacteria 1354
421 nmdc:mga0qj67_48520_c1 3300050509 Bacteria 3354
422 nmdc:mga06r32_27527_c1 3300050510 Bacteria 5312
423 nmdc:mga0n895_742666_c1 3300050512 Bacteria 975
424 nmdc:mga0sz30_10448_c1 3300050516 Bacteria 3560
425 nmdc:mga0sz30_50148_c1 3300050516 Bacteria 1769
426 nmdc:mga0sz30_60117_c1 3300050516 Bacteria 1622
427 Ga0500610_0012187 3300053079 Bacteria 3949
428 Ga0500643_010917 3300053087 Bacteria 3350
429 Ga0500641_0098339 3300053096 Bacteria 1254
430 Ga0500556_0007111 3300053104 Bacteria 3197
431 Ga0500562_046409 3300053108 Bacteria 1158
432 Ga0500595_063232 3300053119 Bacteria 1113
433 Ga0500652_001113 3300053131 Bacteria 8661
434 Ga0500559_0100702 3300053136 Bacteria 1331
435 Ga0500568_0072385 3300053139 Bacteria 1318
436 Ga0500616_0017253 3300053153 Bacteria 4099
437 Ga0500620_112140 3300053155 Bacteria 955
438 Ga0500645_000056 3300053730 Bacteria 92126
439 Ga0466962_0070492 3300061719 Bacteria 1670
440 2523383862 2523231044 Bacteria 6434991
441 2644636439 2643221715 Bacteria 6671032
442 2738667385 2738541264 Bacteria 5935393
443 2739146228 2738541356 Bacteria 5935017
444 2902804168 2902799365 Bacteria 5419524
445 2902814477 2902810491 Bacteria 6794147
446 2929217936 2929212328 Bacteria 7708288
447 2939585162 2939582691 Bacteria 7088898
448 Ga0055540_1000071
449 CNXas_1000501
450 JGI24743J22301_10020191
451 JGI24748J21848_1005258
452 JGI24034J26672_10030153
453 JGI24742J22300_10050402
454 Ga0055540_1001578
455 Ga0055540_1002279
456 Ga0070683_100714071
457 Ga0068869_100098688
458 Ga0070682_100220027
459 Ga0068868_100092366
460 Ga0068868_100515102
461 Ga0070691_10047759
462 Ga0070691_10435680
463 Ga0070668_100002818
464 Ga0070668_100132398
465 Ga0070668_100559907
466 Ga0070669_100010174
467 Ga0070671_100173205
468 Ga0070671_100176142
469 Ga0070674_100021753
470 Ga0070673_100394727
471 Ga0070688_100170233
472 Ga0070659_100605710
473 Ga0070667_100000324
474 Ga0070667_100000487
475 Ga0070667_100276938
476 Ga0070709_10168667
477 Ga0070709_10371694
478 Ga0070709_10612218
479 Ga0070714_100409602
480 Ga0070714_100634426
481 Ga0070713_100315494
482 Ga0070713_100498292
483 Ga0070710_10005112
484 Ga0070710_10019443
485 Ga0070711_100012191
486 Ga0070711_100141914
487 Ga0070705_100042166
488 Ga0070705_100411958
489 Ga0070700_100765199
490 Ga0070663_100115301
491 Ga0070663_101548627
492 Ga0070678_100222797
493 Ga0070678_100903228
494 Ga0070662_100386483
495 Ga0070685_10461645
496 Ga0070685_10582852
497 Ga0070707_100208290
498 Ga0068853_100059988
499 Ga0070696_100486035
500 Ga0070693_100044060
501 Ga0070693_100250492
502 Ga0070665_100025634
503 Ga0070665_100052834
504 Ga0070704_100017533
505 Ga0068855_101328671
506 Ga0068854_101133152
507 Ga0070702_100023413
508 Ga0070702_100146703
509 Ga0070702_100896120
510 Ga0068852_100271031
511 Ga0068852_100296558
512 Ga0068859_100001593
513 Ga0068859_100048013
514 Ga0068859_100730621
515 Ga0068859_101019775
516 Ga0068859_101212503
517 Ga0068859_101287499
518 Ga0068864_100119917
519 Ga0068864_100968209
520 Ga0068866_10010902
521 Ga0068866_10231919
522 Ga0068866_10546311
523 Ga0068861_100318477
524 Ga0068861_100355418
525 Ga0068863_100000143
526 Ga0068858_100327645
527 Ga0068858_100544849
528 Ga0068860_100000079
529 Ga0068860_100154040
530 Ga0068860_100309573
531 Ga0068862_100000093
532 Ga0068862_100128522
533 Ga0068862_100270287
534 Ga0081455_10028885
535 Ga0081455_10042477
536 Ga0081540_1136541
537 Ga0075365_10111093
538 Ga0075365_10174330
539 Ga0075363_100005404
540 Ga0075363_100224841
541 Ga0075363_100242700
542 Ga0075364_10004041
543 Ga0075364_10006554
544 Ga0075364_10119318
545 Ga0075364_10144738
546 Ga0070716_100195974
547 Ga0070716_100262179
548 Ga0070712_100070316
549 Ga0075367_10148904
550 Ga0075369_10068581
551 Ga0075369_10097313
552 Ga0075369_10131469
553 Ga0097621_100132843
554 Ga0097621_100738030
555 Ga0075370_10445559
556 Ga0068871_100290901
557 Ga0075428_100007875
558 Ga0075430_100018039
559 Ga0075431_100051836
560 Ga0075434_100660195
561 Ga0068865_100140161
562 Ga0068865_100141876
563 Ga0097620_100001593
564 Ga0097620_100048011
565 Ga0097620_100730549
566 Ga0097620_101019803
567 Ga0097620_101212123
568 Ga0097620_101287464
569 Ga0099795_10147670
570 Ga0105250_10073398
571 Ga0111539_11106227
572 Ga0105245_10384630
573 Ga0105247_10000044
574 Ga0105247_10057458
575 Ga0105247_10243514
576 Ga0105247_10351437
577 Ga0114129_10534959
578 Ga0105243_10063567
579 Ga0105243_10303230
580 Ga0105242_10069015
581 Ga0105242_10296099
582 Ga0105242_10525113
583 Ga0105248_10000060
584 Ga0105248_10058720
585 Ga0105248_10406231
586 Ga0105237_10027148
587 Ga0105237_10303847
588 Ga0105237_10427734
589 Ga0105238_10316131
590 Ga0105238_11541376
591 Ga0105249_10000049
592 Ga0105249_10008884
593 Ga0105249_10415224
594 Ga0105249_11384652
595 Ga0105239_10183339
596 Ga0105239_10239462
597 Ga0105239_10630697
598 Ga0105239_11069177
599 Ga0105239_11699933
600 Ga0105246_10015077
601 Ga0157369_10077572
602 Ga0157369_10343866
603 Ga0157374_10045108
604 Ga0157378_10171984
605 Ga0157378_10421875
606 Ga0157378_10648908
607 Ga0163162_10060689
608 Ga0163162_10285038
609 Ga0163162_10594139
610 Ga0163162_12017642
611 Ga0157372_11379644
612 Ga0157375_10168224
613 Ga0157375_11051396
614 Ga0157380_10288461
615 Ga0157380_10824469
616 Ga0157377_10000892
617 Ga0157379_10108278
618 Ga0157379_10555260
619 Ga0163161_10254066
620 Ga0163161_10638032
621 Ga0213876_10001760
622 Ga0213876_10326448
623 Ga0224572_1045447
624 Ga0209673_1073445
625 Ga0209051_1000033
626 Ga0209051_1000776
627 Ga0207696_1070723
628 Ga0207692_10169845
629 Ga0207642_10109109
630 Ga0207642_10264778
631 Ga0207710_10000066
632 Ga0207688_10015934
633 Ga0207699_10329263
634 Ga0207693_10002311
635 Ga0207693_10731421
636 Ga0207662_10020853
637 Ga0207681_10002233
638 Ga0207687_10346559
639 Ga0207700_10017600
640 Ga0207700_10375414
641 Ga0207664_10021970
642 Ga0207664_10068569
643 Ga0207644_10396318
644 Ga0207690_10785200
645 Ga0207706_10072187
646 Ga0207706_10602926
647 Ga0207686_10263893
648 Ga0207709_10153522
649 Ga0207669_10047798
650 Ga0207669_10392570
651 Ga0207704_10042825
652 Ga0207704_10513871
653 Ga0207665_10018954
654 Ga0207665_10531590
655 Ga0207691_10145845
656 Ga0207711_10000058
657 Ga0207689_10108936
658 Ga0207667_10184253
659 Ga0207651_10286471
660 Ga0207712_10000038
661 Ga0207712_10031183
662 Ga0207668_10001652
663 Ga0207668_10141314
664 Ga0207640_10464885
665 Ga0207658_10000061
666 Ga0207658_10005238
667 Ga0207658_10025851
668 Ga0207658_10488276
669 Ga0207677_10202640
670 Ga0207677_10208642
671 Ga0207703_10047929
672 Ga0207703_10572262
673 Ga0207639_10246349
674 Ga0207678_10043455
675 Ga0207678_10254275
676 Ga0207678_10672623
677 Ga0207708_10140519
678 Ga0207708_10888119
679 Ga0207702_10853648
680 Ga0207641_10000232
681 Ga0207641_11408324
682 Ga0207676_10094860
683 Ga0207675_100150777
684 Ga0207675_100271772
685 Ga0207675_100326929
686 Ga0207675_100436721
687 Ga0207683_10053314
688 Ga0207683_10249616
689 Ga0207698_10032304
690 Ga0207698_10460838
691 Ga0268266_10018080
692 Ga0268266_10027281
693 Ga0268265_10000053
694 Ga0268265_10105892
695 Ga0268265_10675310
696 Ga0268264_10000017
697 Ga0268264_10341377
698 Ga0268264_10802562
699 Ga0268264_10954960
700 Ga0265327_10000128
701 Ga0265327_10002212
702 Ga0265327_10006336
703 Ga0307413_10168856
704 Ga0307406_10066523
705 Ga0307415_101732405
706 Ga0373949_0010835
707 Ga0373942_0044809
708 Ga0316584_0140498
709 Ga0436364_0224006
710 Ga0436364_1128610
711 Ga0436364_1545518
712 Ga0436365_0271296
713 Ga0436365_0397989
714 Ga0436360_1241607
715 Ga0439461_0004216
716 Ga0439461_0004241
717 Ga0439466_0006362
718 Ga0439466_0022319
719 Ga0439465_0003069
720 Ga0439465_0004735
721 Ga0451787_197336
722 Ga0451797_0595584
723 Ga0451843_0893763
724 Ga0439431_0010229
725 Ga0439431_0013022
726 Ga0439442_034823
727 Ga0439445_0008520
728 Ga0439445_0021620
729 Ga0439445_0138686
730 Ga0439434_0000830
731 Ga0439434_0036882
732 Ga0466969_0027229
733 Ga0466972_0006441
734 Ga0466972_0015260
735 Ga0466972_0159389
736 Ga0466965_0000732
737 Ga0466965_0014710
738 Ga0466965_0041765
739 Ga0466965_0048096
740 Ga0466965_0080184
741 Ga0466965_0114268
742 Ga0466966_0000813
743 Ga0466966_0008098
744 Ga0466961_0016015
745 Ga0466961_0016143
746 Ga0466963_0025090
747 Ga0466963_0054065
748 Ga0466971_0006145
749 Ga0466968_0004166
750 Ga0466968_0008858
751 Ga0466970_0004676
752 Ga0466970_0021441
753 Ga0466957_0008951
754 Ga0466957_0015003
755 Ga0466957_0031479
756 Ga0466957_0088930
757 Ga0466960_0000220
758 Ga0466960_0007139
759 Ga0466960_0094148
760 Ga0466960_0164285
761 Ga0466959_0013172
762 Ga0466959_0020200
763 Ga0466959_0107253
764 Ga0466958_0002045
765 Ga0466958_0030847
766 Ga0466958_0059437
767 Ga0466967_0003081
768 Ga0466967_0086075
769 Ga0466967_0288452
770 Ga0466967_1166999
771 Ga0495590_0084929
772 Ga0495638_0007186
773 Ga0495638_0283380
774 Ga0495653_0123227
775 Ga0495606_0019624
776 Ga0495671_0260789
777 Ga0495686_0007552
778 Ga0495686_0549694
779 Ga0496100_0000029
780 Ga0496100_0002877
781 Ga0496100_0316833
782 Ga0496100_0358628
783 Ga0496101_0000015
784 Ga0496101_0000031
785 Ga0496101_0030710
786 Ga0496101_0032368
787 Ga0496101_0194327
788 Ga0496102_0000065
789 Ga0496102_0000336
790 Ga0496102_0032237
791 Ga0496102_0050101
792 Ga0496102_0298419
793 Ga0496102_0899632
794 Ga0496103_0000048
795 Ga0496103_0000271
796 Ga0496103_0123360
797 Ga0496104_0298108
798 Ga0496106_0000396
799 Ga0496106_0035372
800 Ga0496106_0038878
801 Ga0496106_0979108
802 Ga0496106_0993878
803 Ga0496107_0010437
804 Ga0496107_0014326
805 Ga0496107_0181164
806 Ga0496107_0960881
807 Ga0496108_0001208
808 Ga0496108_0038239
809 Ga0496108_0876751
810 Ga0496109_0000022
811 Ga0496109_0079702
812 Ga0496109_0323130
813 Ga0496110_0004126
814 Ga0496110_0063621
815 Ga0496111_0004361
816 Ga0496112_0037889
817 Ga0496113_0096800
818 Ga0496113_0146316
819 Ga0496114_0000716
820 Ga0496114_0230511
821 Ga0496115_0356662
822 Ga0496116_0000125
823 Ga0496116_0003462
824 Ga0496116_0013160
825 Ga0496117_0000111
826 Ga0496117_0001352
827 Ga0496117_0008331
828 Ga0496118_0000083
829 Ga0496118_0013176
830 Ga0496119_0004014
831 Ga0496119_0007493
832 Ga0496119_0010640
833 Ga0496120_0001769
834 Ga0496120_0012983
835 Ga0496120_0042150
836 Ga0496121_0000004
837 Ga0496121_0001000
838 Ga0496121_0009717
839 Ga0496122_0000138
840 Ga0496123_0034379
841 Ga0496124_0000012
842 Ga0496124_0175332
843 Ga0496125_0000003
844 Ga0496126_0000001
845 Ga0496126_0000220
846 Ga0496126_0004252
847 Ga0496126_0026981
848 Ga0496126_0061092
849 Ga0496126_0305279
850 Ga0501034_0206391
851 Ga0501034_0357814
852 Ga0501048_0225451
853 Ga0501069_0038188
854 Ga0501044_0140864
855 nmdc:mga03683_165903_c1
856 nmdc:mga03n38_3117_c1
857 nmdc:mga00v17_109122_c1
858 nmdc:mga00v17_214051_c1
859 nmdc:mga00v17_37382_c1
860 nmdc:mga00v17_5765_c1
861 nmdc:mga00v17_75016_c1
862 nmdc:mga0yw44_115776_c2
863 nmdc:mga0yw44_4095_c1
864 nmdc:mga0yw44_497635_c1
865 nmdc:mga07m45_34752_c1
866 nmdc:mga05p37_433381_c1
867 nmdc:mga0qj67_279176_c1
868 nmdc:mga0qj67_48520_c1
869 nmdc:mga06r32_27527_c1
870 nmdc:mga0n895_742666_c1
871 nmdc:mga0sz30_10448_c1
872 nmdc:mga0sz30_50148_c1
873 nmdc:mga0sz30_60117_c1
874 Ga0500610_0012187
875 Ga0500643_010917
876 Ga0500641_0098339
877 Ga0500556_0007111
878 Ga0500562_046409
879 Ga0500595_063232
880 Ga0500652_001113
881 Ga0500559_0100702
882 Ga0500568_0072385
883 Ga0500616_0017253
884 Ga0500620_112140
885 Ga0500645_000056
886 Ga0466962_0070492
887 2523383862
888 2644636439
889 2738667385
890 2739146228
891 2902804168
892 2902814477
893 2929217936
894 2939585162

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v94-assembly1.cif.gz_A crystal structure of p. abyssi rps24 0.8543 75 99
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.7997 11 136
1ogz-assembly1.cif.gz_A-2 crystal structure of 5-3-ketosteroid isomerase mutants p39a complexed with equilenin from pseudomonas testosteroni 0.7985 11 136
5dre-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gp39gd99n mutant from pseudomonas testosteroni (tksi) 0.7944 11 136
6uae-assembly4.cif.gz_D ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.7935 11 136
ID Description Score Start End Superfamily
af_I6XW93_5_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9746 5 141 3.10.450.50
af_I6XW93_5_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9609 5 141 3.10.450.50
af_P96815_13_143_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8288 12 143 3.10.450.50
af_P96815_13_143_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8115 12 143 3.10.450.50
4df9E01 Mainly Beta;Sandwich;Immunoglobulin-like;Peptidase M64, N-terminal domain 0.7922 108 133 2.60.40.3250
ID Description Score Start End GO Terms
AF-A0A2S9FJ29-F1-model_v4 Nuclear transport factor 2 family protein 0.9653 1 154
AF-L7VDT5-F1-model_v4 SnoaL-like domain-containing protein 0.9288 1 181
AF-L7VDT5-F1-model_v4 SnoaL-like domain-containing protein 0.9238 1 181
AF-X7ZWM4-F1-model_v4 SnoaL-like domain protein 0.9225 1 179 GO:0004497
GO:0005506
GO:0016705
GO:0020037
AF-A0A7K2DJD2-F1-model_v4 Nuclear transport factor 2 family protein 0.9203 2 178

Map