F445831

General Info

Members Datasets Scaffolds Average Seq Length
446 254 892 251

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0195769|Ga0501084_0195769_328_1206
Length 292
Sequence MVAAGGLPGAFKGTEIKTEPFNGSTVQGSTSEKNDYDATSIQEAALRLAGKVAIVTGGARHIGAAYCRKLAEEGAAVVVADILDGEVTAEEIRVKGGKALALKVDVSKEEDTMRMAAETVKAFGCIDILVNNAAIFINIQRHPFYEISAEEWDKVSAVNIKGPFLCTKAVFPQMKEQKSGKIINISSSTAYWGTPNFLHYVASKAALVGMTRSLAREVGEYGICVNAIAPGLVEHEGQTAPKALTELQLKARSIKRLQTPEDLMGTLVFLCSSDSDFMTGQAIVVDGGSVFH

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
140 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
141 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
161 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
198 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
223 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
241 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
242 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
253 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
254 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 3.36
Rhizosphere 94.62
Stem 0
Stem Tuber 0
Unclassified 10.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0195769 3300054114 Bacteria 1705
2 MRS1b_contig_2929384 2162886011 Bacteria 1338
3 Ga0065712_10068174 3300005290 Bacteria 13452
4 Ga0065715_10000256 3300005293 Bacteria 30993
5 Ga0065715_10014844 3300005293 Bacteria 2249
6 Ga0065707_10192212 3300005295 Bacteria 1355
7 Ga0070658_10008996 3300005327 Bacteria 8028
8 Ga0070658_10074772 3300005327 Bacteria 2779
9 Ga0070690_100008136 3300005330 Bacteria 6027
10 Ga0070690_100019777 3300005330 Bacteria 4095
11 Ga0070690_100051410 3300005330 Bacteria 2631
12 Ga0070670_100000121 3300005331 Bacteria 72344
13 Ga0070666_10006088 3300005335 Bacteria 7414
14 Ga0070666_10289889 3300005335 Unclassified 1164
15 Ga0070680_100018148 3300005336 Bacteria 5558
16 Ga0070680_100020314 3300005336 Bacteria 5271
17 Ga0070680_100121831 3300005336 Bacteria 2177
18 Ga0070682_100023251 3300005337 Bacteria 3679
19 Ga0070682_100182863 3300005337 Bacteria 1466
20 Ga0068868_100150094 3300005338 Bacteria 1919
21 Ga0068868_100514399 3300005338 Bacteria 1050
22 Ga0070660_100020663 3300005339 Bacteria 4843
23 Ga0070660_100162786 3300005339 Bacteria 1798
24 Ga0070691_10062910 3300005341 Bacteria 1788
25 Ga0070687_100277547 3300005343 Bacteria 1053
26 Ga0070661_100025716 3300005344 Bacteria 4231
27 Ga0070669_100248217 3300005353 Bacteria 1416
28 Ga0070671_100100512 3300005355 Bacteria 2427
29 Ga0070671_100170590 3300005355 Unclassified 1840
30 Ga0070671_100246176 3300005355 Bacteria 1518
31 Ga0070671_100718225 3300005355 Bacteria 867
32 Ga0070674_100012180 3300005356 Bacteria 5275
33 Ga0070674_100046737 3300005356 Bacteria 2963
34 Ga0070674_100086825 3300005356 Bacteria 2248
35 Ga0070673_100072121 3300005364 Bacteria 2776
36 Ga0070673_100178056 3300005364 Bacteria 1819
37 Ga0070673_100314962 3300005364 Bacteria 1381
38 Ga0070688_100289518 3300005365 Bacteria 1180
39 Ga0070659_100023080 3300005366 Bacteria 4756
40 Ga0070659_100074810 3300005366 Bacteria 2699
41 Ga0070667_100310256 3300005367 Bacteria 1422
42 Ga0070667_100478766 3300005367 Bacteria 1139
43 Ga0070709_10035322 3300005434 Unclassified 3037
44 Ga0070714_100007134 3300005435 Bacteria 8668
45 Ga0070713_100221556 3300005436 Unclassified 1716
46 Ga0070710_10015563 3300005437 Plasmid 3852
47 Ga0070711_100312756 3300005439 Bacteria 1252
48 Ga0070700_100004625 3300005441 Bacteria 7208
49 Ga0070708_100279143 3300005445 Bacteria 1572
50 Ga0070678_100027509 3300005456 Bacteria 3862
51 Ga0070662_100095578 3300005457 Bacteria 2240
52 Ga0070681_10013999 3300005458 Bacteria 7983
53 Ga0068867_100516919 3300005459 Bacteria 1029
54 Ga0070706_100631925 3300005467 Unclassified 994
55 Ga0070707_100141653 3300005468 Bacteria 2340
56 Ga0070698_100023885 3300005471 Bacteria 6383
57 Ga0070679_100019779 3300005530 Bacteria 6554
58 Ga0070679_100056571 3300005530 Bacteria 3908
59 Ga0070697_100148430 3300005536 Bacteria 1975
60 Ga0068853_100039307 3300005539 Bacteria 4035
61 Ga0070696_100086463 3300005546 Bacteria 2226
62 Ga0070693_100010574 3300005547 Bacteria 4626
63 Ga0070704_100387450 3300005549 Bacteria 1189
64 Ga0068855_100703525 3300005563 Bacteria 1081
65 Ga0070664_100003298 3300005564 Bacteria 13036
66 Ga0070664_100082760 3300005564 Bacteria 2768
67 Ga0068854_100018613 3300005578 Bacteria 4667
68 Ga0068864_100027239 3300005618 Bacteria 4824
69 Ga0068864_100929811 3300005618 Bacteria 860
70 Ga0068870_10305504 3300005840 Bacteria 1006
71 Ga0068863_100016965 3300005841 Bacteria 6984
72 Ga0068860_100170244 3300005843 Bacteria 2103
73 Ga0081455_10000240 3300005937 Bacteria 71150
74 Ga0081538_10000858 3300005981 Bacteria 32764
75 Ga0081538_10129299 3300005981 Bacteria 1191
76 Ga0081540_1000027 3300005983 Bacteria 151880
77 Ga0070715_10143676 3300006163 Bacteria 1162
78 Ga0070716_100073552 3300006173 Bacteria 2016
79 Ga0070712_100258312 3300006175 Bacteria 1395
80 Ga0075362_10044934 3300006177 Bacteria 1961
81 Ga0097621_100062107 3300006237 Bacteria 3066
82 Ga0097621_100186123 3300006237 Bacteria 1796
83 Ga0068871_100015554 3300006358 Bacteria 5700
84 Ga0075428_100125835 3300006844 Bacteria 2789
85 Ga0075428_100155533 3300006844 Bacteria 2484
86 Ga0075428_100606108 3300006844 Bacteria 1169
87 Ga0075428_100820611 3300006844 Bacteria 988
88 Ga0075430_100019890 3300006846 Bacteria 5712
89 Ga0075430_100074007 3300006846 Bacteria 2856
90 Ga0075430_100099668 3300006846 Bacteria 2426
91 Ga0075431_100015740 3300006847 Bacteria 7668
92 Ga0075431_100169511 3300006847 Bacteria 2243
93 Ga0075431_100422398 3300006847 Unclassified 1332
94 Ga0075433_10012051 3300006852 Bacteria 6973
95 Ga0075433_10021438 3300006852 Bacteria 5418
96 Ga0075433_10041055 3300006852 Bacteria 4008
97 Ga0075433_10182087 3300006852 Unclassified 1870
98 Ga0075433_10411537 3300006852 Bacteria 1193
99 Ga0075433_10659601 3300006852 Bacteria 917
100 Ga0075434_100000644 3300006871 Bacteria 27011
101 Ga0075434_100003205 3300006871 Bacteria 14593
102 Ga0075434_100012637 3300006871 Bacteria 8007
103 Ga0075434_100013269 3300006871 Bacteria 7832
104 Ga0075434_100017418 3300006871 Bacteria 6923
105 Ga0075434_100018475 3300006871 Bacteria 6737
106 Ga0075434_100103592 3300006871 Unclassified 2854
107 Ga0075434_100148840 3300006871 Bacteria 2361
108 Ga0075429_100174668 3300006880 Bacteria 1882
109 Ga0075429_100582213 3300006880 Bacteria 981
110 Ga0068865_100024500 3300006881 Bacteria 3960
111 Ga0068865_100084404 3300006881 Bacteria 2289
112 Ga0075436_100054544 3300006914 Bacteria 2759
113 Ga0075436_100073976 3300006914 Bacteria 2359
114 Ga0075436_100087227 3300006914 Unclassified 2168
115 Ga0075435_100000588 3300007076 Bacteria 22215
116 Ga0075435_100004481 3300007076 Bacteria 9600
117 Ga0075435_100095651 3300007076 Bacteria 2456
118 Ga0075435_100119289 3300007076 Bacteria 2200
119 Ga0075435_100190603 3300007076 Unclassified 1735
120 Ga0075435_100453433 3300007076 Unclassified 1106
121 Ga0111539_10186556 3300009094 Bacteria 2422
122 Ga0111539_10274112 3300009094 Bacteria 1964
123 Ga0111539_10477032 3300009094 Bacteria 1453
124 Ga0111539_10517487 3300009094 Bacteria 1390
125 Ga0105245_10001238 3300009098 Bacteria 23022
126 Ga0105247_10139353 3300009101 Bacteria 1588
127 Ga0114129_10002603 3300009147 Bacteria 25087
128 Ga0114129_10040175 3300009147 Bacteria 6595
129 Ga0114129_10099052 3300009147 Bacteria 4035
130 Ga0114129_10157370 3300009147 Bacteria 3106
131 Ga0114129_10206839 3300009147 Bacteria 2655
132 Ga0114129_10208212 3300009147 Bacteria 2645
133 Ga0114129_10617113 3300009147 Bacteria 1403
134 Ga0114129_10664541 3300009147 Bacteria 1343
135 Ga0114129_10768615 3300009147 Unclassified 1232
136 Ga0105243_10026995 3300009148 Bacteria 4397
137 Ga0105242_10237720 3300009176 Bacteria 1636
138 Ga0105242_10452690 3300009176 Bacteria 1210
139 Ga0105248_10236492 3300009177 Bacteria 2056
140 Ga0105248_10481297 3300009177 Bacteria 1399
141 Ga0105238_10000499 3300009551 Bacteria 41227
142 Ga0105238_10055931 3300009551 Bacteria 3959
143 Ga0105238_10743287 3300009551 Bacteria 994
144 Ga0105239_10228953 3300010375 Unclassified 2085
145 Ga0105239_10466784 3300010375 Bacteria 1433
146 Ga0157371_10020081 3300013102 Bacteria 4919
147 Ga0157374_10008639 3300013296 Bacteria 8716
148 Ga0157378_10025375 3300013297 Bacteria 5219
149 Ga0157378_10087290 3300013297 Bacteria 2829
150 Ga0157378_10352764 3300013297 Bacteria 1437
151 Ga0163162_10039767 3300013306 Bacteria 4700
152 Ga0163162_10759386 3300013306 Bacteria 1089
153 Ga0157372_10336380 3300013307 Bacteria 1759
154 Ga0157375_10161071 3300013308 Bacteria 2385
155 Ga0157375_10181043 3300013308 Bacteria 2259
156 Ga0163163_10121197 3300014325 Bacteria 2649
157 Ga0157379_10091761 3300014968 Bacteria 2725
158 Ga0157376_10008228 3300014969 Bacteria 7510
159 Ga0163161_10060544 3300017792 Bacteria 2756
160 Ga0163161_10199382 3300017792 Bacteria 1542
161 Ga0207697_10056410 3300025315 Bacteria 1629
162 Ga0207653_10092512 3300025885 Bacteria 1061
163 Ga0207642_10017520 3300025899 Bacteria 2727
164 Ga0207680_10211403 3300025903 Unclassified 1326
165 Ga0207680_10283447 3300025903 Bacteria 1152
166 Ga0207699_10030267 3300025906 Plasmid 3027
167 Ga0207645_10002520 3300025907 Bacteria 14338
168 Ga0207643_10308908 3300025908 Bacteria 985
169 Ga0207705_10007374 3300025909 Bacteria 8087
170 Ga0207707_10006403 3300025912 Bacteria 10279
171 Ga0207707_10040557 3300025912 Bacteria 4066
172 Ga0207707_10676468 3300025912 Bacteria 868
173 Ga0207693_10106660 3300025915 Bacteria 2198
174 Ga0207693_10119830 3300025915 Unclassified 2067
175 Ga0207660_10018642 3300025917 Bacteria 4630
176 Ga0207662_10050372 3300025918 Bacteria 2474
177 Ga0207657_10001479 3300025919 Bacteria 25115
178 Ga0207657_10129662 3300025919 Bacteria 2068
179 Ga0207649_10088487 3300025920 Bacteria 2022
180 Ga0207652_10055099 3300025921 Bacteria 3419
181 Ga0207652_10160736 3300025921 Bacteria 2014
182 Ga0207652_10302215 3300025921 Bacteria 1444
183 Ga0207646_10027557 3300025922 Bacteria 5181
184 Ga0207646_10236557 3300025922 Bacteria 1650
185 Ga0207646_10328868 3300025922 Unclassified 1381
186 Ga0207681_10085781 3300025923 Bacteria 2235
187 Ga0207694_10006805 3300025924 Bacteria 8679
188 Ga0207694_10044287 3300025924 Bacteria 3437
189 Ga0207659_10329355 3300025926 Bacteria 1262
190 Ga0207687_10008390 3300025927 Bacteria 6759
191 Ga0207664_10002106 3300025929 Bacteria 13091
192 Ga0207644_10032045 3300025931 Bacteria 3665
193 Ga0207644_10117697 3300025931 Bacteria 2018
194 Ga0207644_10235536 3300025931 Bacteria 1456
195 Ga0207706_10003428 3300025933 Bacteria 15141
196 Ga0207706_10053436 3300025933 Bacteria 3566
197 Ga0207686_10156737 3300025934 Bacteria 1591
198 Ga0207709_10042377 3300025935 Bacteria 2737
199 Ga0207709_10210393 3300025935 Bacteria 1395
200 Ga0207669_10082669 3300025937 Bacteria 2062
201 Ga0207704_10055496 3300025938 Bacteria 2421
202 Ga0207704_10456105 3300025938 Unclassified 1021
203 Ga0207691_10003335 3300025940 Bacteria 15629
204 Ga0207691_10320405 3300025940 Bacteria 1329
205 Ga0207711_10064816 3300025941 Bacteria 3156
206 Ga0207689_10048881 3300025942 Bacteria 3489
207 Ga0207679_10051273 3300025945 Bacteria 3020
208 Ga0207679_10052744 3300025945 Bacteria 2984
209 Ga0207667_10608875 3300025949 Bacteria 1101
210 Ga0207651_10610606 3300025960 Bacteria 954
211 Ga0207668_10050379 3300025972 Bacteria 2870
212 Ga0207640_10602575 3300025981 Unclassified 930
213 Ga0207658_10104449 3300025986 Bacteria 2226
214 Ga0207658_10651482 3300025986 Bacteria 949
215 Ga0207703_10939645 3300026035 Bacteria 829
216 Ga0207641_10013622 3300026088 Bacteria 6670
217 Ga0207648_10445846 3300026089 Bacteria 1178
218 Ga0207676_10013828 3300026095 Bacteria 5793
219 Ga0207676_10190070 3300026095 Bacteria 1806
220 Ga0207676_10357668 3300026095 Bacteria 1352
221 Ga0207674_10654607 3300026116 Bacteria 1014
222 Ga0207683_10004679 3300026121 Bacteria 11790
223 Ga0207683_10026323 3300026121 Bacteria 5020
224 Ga0207683_10076700 3300026121 Bacteria 2959
225 Ga0209971_1008400 3300027682 Bacteria 2448
226 Ga0209974_10041437 3300027876 Bacteria 1533
227 Ga0207428_10059901 3300027907 Bacteria 3016
228 Ga0207428_10166480 3300027907 Bacteria 1671
229 Ga0268264_10149271 3300028381 Bacteria 2094
230 Ga0265332_10001808 3300031238 Bacteria 11498
231 Ga0265325_10000780 3300031241 Bacteria 23067
232 Ga0265340_10001397 3300031247 Bacteria 13847
233 Ga0265340_10010585 3300031247 Bacteria 4931
234 Ga0265339_10000643 3300031249 Bacteria 26946
235 Ga0265331_10013242 3300031250 Bacteria 4443
236 Ga0265331_10046781 3300031250 Bacteria 2085
237 Ga0316579_10003261 3300031691 Bacteria 6296
238 Ga0265314_10050676 3300031711 Bacteria 2896
239 Ga0265342_10000179 3300031712 Bacteria 70615
240 Ga0316576_10296155 3300031727 Unclassified 1210
241 Ga0307516_10001365 3300031730 Bacteria 33824
242 Ga0307407_10227327 3300031903 Bacteria 1265
243 Ga0307409_100191706 3300031995 Bacteria 1820
244 Ga0307416_100007819 3300032002 Bacteria 6834
245 Ga0307416_100181452 3300032002 Bacteria 1973
246 Ga0307414_10007976 3300032004 Bacteria 5981
247 Ga0307414_10107274 3300032004 Bacteria 2116
248 Ga0307411_10104474 3300032005 Bacteria 2012
249 Ga0307415_100040710 3300032126 Bacteria 3080
250 Ga0373930_0016041 3300034816 Bacteria 1413
251 Ga0373939_0005511 3300035114 Bacteria 3018
252 Ga0373954_0104929 3300035118 Bacteria 1364
253 Ga0373946_0163467 3300035171 Unclassified 1047
254 Ga0373961_0071772 3300035241 Bacteria 1072
255 Ga0373931_0032313 3300035691 Bacteria 2708
256 Ga0373931_0049940 3300035691 Bacteria 2224
257 Ga0373935_0179212 3300035692 Bacteria 1454
258 Ga0373935_0186977 3300035692 Unclassified 1425
259 Ga0373927_0062401 3300035695 Bacteria 2410
260 Ga0373927_0075482 3300035695 Bacteria 2183
261 Ga0373937_0126354 3300036401 Unclassified 2386
262 Ga0373925_0402028 3300037068 Unclassified 1117
263 Ga0242420_021805 3300038996 Bacteria 1149
264 Ga0439458_0048954 3300042157 Bacteria 1040
265 Ga0439458_0073465 3300042157 Unclassified 866
266 Ga0453683_0000163 3300044673 Bacteria 97466
267 Ga0453683_0002574 3300044673 Bacteria 13961
268 Ga0453683_0511494 3300044673 Unclassified 780
269 Ga0451576_0246037 3300045051 Bacteria 1869
270 Ga0451576_1090955 3300045051 Unclassified 835
271 Ga0495592_0060914 3300046454 Bacteria 2775
272 Ga0495592_0195400 3300046454 Bacteria 1369
273 Ga0495629_0022868 3300046459 Bacteria 4455
274 Ga0495651_0028731 3300046462 Bacteria 4333
275 Ga0495662_0222907 3300046476 Bacteria 929
276 Ga0495608_0046300 3300046511 Bacteria 2895
277 Ga0495618_0071682 3300046514 Bacteria 2204
278 Ga0495628_0046641 3300046516 Bacteria 3441
279 Ga0495652_0017276 3300046529 Bacteria 6440
280 Ga0495640_0057784 3300046533 Bacteria 2647
281 Ga0495587_0071123 3300046536 Bacteria 2024
282 Ga0495587_0081842 3300046536 Bacteria 1871
283 Ga0495645_0175120 3300046543 Bacteria 1474
284 Ga0495667_0053562 3300046559 Bacteria 2657
285 Ga0495625_0000091 3300046660 Bacteria 146647
286 Ga0495599_0043564 3300046678 Bacteria 2817
287 Ga0495646_0005780 3300046680 Bacteria 7848
288 Ga0495624_0027791 3300046690 Unclassified 3701
289 Ga0495670_0054885 3300046691 Bacteria 1997
290 Ga0495600_0155064 3300046809 Bacteria 1482
291 Ga0495600_0177584 3300046809 Bacteria 1373
292 Ga0495604_0002906 3300047317 Bacteria 13735
293 Ga0495674_0013353 3300047319 Bacteria 7724
294 Ga0495674_0395302 3300047319 Bacteria 1117
295 Ga0495680_0536955 3300047322 Unclassified 790
296 Ga0495602_0014785 3300048088 Bacteria 7908
297 Ga0496100_0042543 3300048903 Bacteria 2901
298 Ga0496101_0058469 3300048904 Bacteria 2792
299 Ga0496104_0085918 3300048907 Bacteria 3003
300 Ga0496104_0732563 3300048907 Unclassified 896
301 Ga0496105_0070299 3300048908 Bacteria 2893
302 Ga0496106_0039121 3300048909 Bacteria 3552
303 Ga0496107_0269325 3300048910 Bacteria 1268
304 Ga0496110_0082279 3300048913 Bacteria 2871
305 Ga0496112_0003925 3300048915 Bacteria 12452
306 Ga0496112_0075033 3300048915 Bacteria 3344
307 Ga0496112_0267997 3300048915 Bacteria 1656
308 Ga0496113_0088894 3300048916 Bacteria 2377
309 Ga0496113_0115017 3300048916 Bacteria 2098
310 Ga0496114_0272065 3300048917 Bacteria 1493
311 Ga0496115_0069211 3300048918 Bacteria 2858
312 Ga0501299_014653 3300049522 Bacteria 1367
313 Ga0501031_0220661 3300049568 Unclassified 1234
314 Ga0501032_0212239 3300049569 Bacteria 1262
315 Ga0501034_0199323 3300049571 Bacteria 1960
316 Ga0501036_0095942 3300049572 Archaea 2507
317 Ga0501036_0107193 3300049572 Bacteria 2362
318 Ga0501036_0223325 3300049572 Bacteria 1581
319 Ga0501036_0277185 3300049572 Bacteria 1403
320 Ga0501036_0555378 3300049572 Bacteria 954
321 Ga0501037_0035192 3300049573 Bacteria 3694
322 Ga0501037_0044220 3300049573 Bacteria 3270
323 Ga0501038_0010885 3300049574 Bacteria 8306
324 Ga0501038_0038538 3300049574 Bacteria 4184
325 Ga0501038_0110269 3300049574 Unclassified 2280
326 Ga0501039_0002281 3300049575 Bacteria 14229
327 Ga0501039_0569917 3300049575 Bacteria 888
328 Ga0501040_0001858 3300049576 Bacteria 13547
329 Ga0501040_0015423 3300049576 Bacteria 5052
330 Ga0501040_0122461 3300049576 Bacteria 1826
331 Ga0501041_0000143 3300049577 Bacteria 31227
332 Ga0501041_0048004 3300049577 Archaea 2600
333 Ga0501042_0000211 3300049578 Bacteria 27761
334 Ga0501042_0014055 3300049578 Bacteria 5459
335 Ga0501042_0321638 3300049578 Bacteria 1118
336 Ga0501043_0068899 3300049579 Bacteria 2779
337 Ga0501046_0061815 3300049580 Bacteria 2926
338 Ga0501046_0291585 3300049580 Unclassified 1193
339 Ga0501046_0313672 3300049580 Bacteria 1143
340 Ga0501047_0223515 3300049581 Bacteria 1738
341 Ga0501048_0059119 3300049582 Unclassified 2716
342 Ga0501048_0065214 3300049582 Bacteria 2575
343 Ga0501048_0075227 3300049582 Bacteria 2382
344 Ga0501067_0020273 3300049583 Bacteria 3679
345 Ga0501068_0018305 3300049584 Bacteria 4058
346 Ga0501070_0010534 3300049586 Bacteria 7818
347 Ga0501071_0000432 3300049587 Bacteria 20957
348 Ga0501072_0000240 3300049588 Bacteria 40293
349 Ga0501073_0281896 3300049589 Bacteria 1147
350 Ga0501073_0330883 3300049589 Bacteria 1052
351 Ga0501074_0006989 3300049590 Bacteria 8152
352 Ga0501075_0000186 3300049591 Bacteria 32278
353 Ga0501075_0069533 3300049591 Archaea 2661
354 Ga0501075_0119439 3300049591 Bacteria 2005
355 Ga0501075_0171774 3300049591 Bacteria 1654
356 Ga0501076_0000082 3300049592 Bacteria 49503
357 Ga0501076_0047438 3300049592 Bacteria 3396
358 Ga0501076_0049618 3300049592 Bacteria 3320
359 Ga0501077_0001067 3300049593 Bacteria 16525
360 Ga0501077_0008310 3300049593 Bacteria 6419
361 Ga0501077_0175535 3300049593 Unclassified 1361
362 Ga0501209_015329 3300049656 Bacteria 1706
363 Ga0501233_037831 3300049668 Bacteria 1122
364 Ga0501079_0000078 3300049741 Bacteria 46006
365 Ga0501079_0141604 3300049741 Bacteria 1873
366 Ga0501079_0199756 3300049741 Bacteria 1562
367 Ga0501079_0426067 3300049741 Unclassified 1042
368 Ga0501080_0010320 3300049742 Bacteria 8540
369 Ga0501080_0510031 3300049742 Bacteria 1074
370 Ga0501081_0000012 3300049743 Bacteria 67174
371 Ga0501081_0030753 3300049743 Unclassified 3636
372 Ga0501081_0197995 3300049743 Bacteria 1456
373 Ga0501083_0042568 3300049744 Bacteria 3078
374 Ga0501083_0158236 3300049744 Bacteria 1482
375 Ga0501271_008936 3300049768 Bacteria 1036
376 Ga0501035_0067739 3300049822 Bacteria 3167
377 Ga0501044_0000266 3300049823 Bacteria 66205
378 Ga0501044_0069389 3300049823 Bacteria 3588
379 Ga0501044_0290734 3300049823 Bacteria 1565
380 Ga0501045_0000722 3300049824 Bacteria 21009
381 Ga0501045_0011680 3300049824 Bacteria 6168
382 Ga0501045_0026135 3300049824 Unclassified 4197
383 Ga0501204_021904 3300049850 Bacteria 840
384 nmdc:mga05p37_160680_c1 3300050507 Unclassified 2744
385 nmdc:mga05p37_23994_c1 3300050507 Bacteria 7408
386 nmdc:mga05p37_401_c1 3300050507 Bacteria 39417
387 nmdc:mga05p37_440241_c1 3300050507 Bacteria 1512
388 nmdc:mga05p37_599852_c1 3300050507 Bacteria 1243
389 nmdc:mga05p37_690373_c1 3300050507 Unclassified 1136
390 nmdc:mga0qj67_215009_c1 3300050509 Bacteria 1561
391 nmdc:mga0qj67_90668_c1 3300050509 Bacteria 2456
392 nmdc:mga06r32_108955_c1 3300050510 Bacteria 2724
393 nmdc:mga06r32_77856_c1 3300050510 Bacteria 3222
394 nmdc:mga08y16_120557_c1 3300050511 Bacteria 2729
395 nmdc:mga08y16_150646_c1 3300050511 Bacteria 2418
396 nmdc:mga08y16_170731_c1 3300050511 Bacteria 2259
397 nmdc:mga08y16_402767_c1 3300050511 Bacteria 1400
398 nmdc:mga0n895_120084_c1 3300050512 Bacteria 2650
399 nmdc:mga0n895_141749_c1 3300050512 Unclassified 2432
400 nmdc:mga0n895_15730_c1 3300050512 Bacteria 6914
401 nmdc:mga0n895_193_c1 3300050512 Bacteria 37906
402 nmdc:mga0n895_2363_c1 3300050512 Bacteria 14710
403 nmdc:mga0n895_283173_c1 3300050512 Bacteria 1681
404 nmdc:mga0n895_4678_c1 3300050512 Bacteria 11291
405 nmdc:mga0n895_6383_c1 3300050512 Bacteria 10008
406 nmdc:mga0rr50_173155_c1 3300050513 Bacteria 1760
407 nmdc:mga0rr50_18876_c1 3300050513 Bacteria 4642
408 nmdc:mga0rr50_391939_c1 3300050513 Bacteria 1172
409 nmdc:mga0rr50_49174_c1 3300050513 Unclassified 3121
410 nmdc:mga0rr50_667_c1 3300050513 Bacteria 18375
411 nmdc:mga08x19_132746_c1 3300050514 Unclassified 1676
412 nmdc:mga08x19_241326_c1 3300050514 Unclassified 1246
413 nmdc:mga08x19_313871_c1 3300050514 Bacteria 1090
414 nmdc:mga0a205_16110_c1 3300050515 Bacteria 6999
415 nmdc:mga0a205_1860_c1 3300050515 Bacteria 18269
416 nmdc:mga0a205_209722_c1 3300050515 Unclassified 1837
417 nmdc:mga0a205_286877_c1 3300050515 Bacteria 1521
418 nmdc:mga0a205_4058_c1 3300050515 Bacteria 13087
419 nmdc:mga0a205_90404_c1 3300050515 Bacteria 2959
420 Ga0495601_0001225 3300053077 Bacteria 14078
421 Ga0495601_0170879 3300053077 Bacteria 1421
422 Ga0495612_0006214 3300053078 Unclassified 4917
423 Ga0495595_0069404 3300053084 Unclassified 1663
424 Ga0495619_0001936 3300053085 Bacteria 13804
425 Ga0500644_0000035 3300053088 Bacteria 82815
426 Ga0500595_024656 3300053119 Bacteria 2097
427 Ga0500607_044201 3300053121 Bacteria 2397
428 Ga0500642_0091697 3300053130 Bacteria 1405
429 Ga0500559_0086298 3300053136 Bacteria 1432
430 Ga0500616_0018499 3300053153 Bacteria 3940
431 Ga0501084_0000958 3300054114 Bacteria 22337
432 Ga0501084_0537601 3300054114 Bacteria 988
433 Ga0501082_0002038 3300060353 Bacteria 17755
434 Ga0501082_0022848 3300060353 Bacteria 5387
435 Ga0501082_0069287 3300060353 Bacteria 3037
436 Ga0501082_0112030 3300060353 Archaea 2362
437 Ga0501082_0318733 3300060353 Bacteria 1354
438 Ga0501082_0498265 3300060353 Bacteria 1065
439 Ga0530510_0000996 3300061734 Bacteria 18800
440 Ga0530510_0008049 3300061734 Bacteria 7353
441 Ga0530510_0154061 3300061734 Bacteria 1698
442 Ga0530510_0223968 3300061734 Bacteria 1398
443 Ga0530510_0333099 3300061734 Bacteria 1139
444 Ga0530510_0402837 3300061734 Bacteria 1031
445 2644041044 2643221605 Bacteria 4772303
446 8056215774 8056207758 Bacteria 8639239
447 Ga0501084_0195769
448 MRS1b_contig_2929384
449 Ga0065712_10068174
450 Ga0065715_10000256
451 Ga0065715_10014844
452 Ga0065707_10192212
453 Ga0070658_10008996
454 Ga0070658_10074772
455 Ga0070690_100008136
456 Ga0070690_100019777
457 Ga0070690_100051410
458 Ga0070670_100000121
459 Ga0070666_10006088
460 Ga0070666_10289889
461 Ga0070680_100018148
462 Ga0070680_100020314
463 Ga0070680_100121831
464 Ga0070682_100023251
465 Ga0070682_100182863
466 Ga0068868_100150094
467 Ga0068868_100514399
468 Ga0070660_100020663
469 Ga0070660_100162786
470 Ga0070691_10062910
471 Ga0070687_100277547
472 Ga0070661_100025716
473 Ga0070669_100248217
474 Ga0070671_100100512
475 Ga0070671_100170590
476 Ga0070671_100246176
477 Ga0070671_100718225
478 Ga0070674_100012180
479 Ga0070674_100046737
480 Ga0070674_100086825
481 Ga0070673_100072121
482 Ga0070673_100178056
483 Ga0070673_100314962
484 Ga0070688_100289518
485 Ga0070659_100023080
486 Ga0070659_100074810
487 Ga0070667_100310256
488 Ga0070667_100478766
489 Ga0070709_10035322
490 Ga0070714_100007134
491 Ga0070713_100221556
492 Ga0070710_10015563
493 Ga0070711_100312756
494 Ga0070700_100004625
495 Ga0070708_100279143
496 Ga0070678_100027509
497 Ga0070662_100095578
498 Ga0070681_10013999
499 Ga0068867_100516919
500 Ga0070706_100631925
501 Ga0070707_100141653
502 Ga0070698_100023885
503 Ga0070679_100019779
504 Ga0070679_100056571
505 Ga0070697_100148430
506 Ga0068853_100039307
507 Ga0070696_100086463
508 Ga0070693_100010574
509 Ga0070704_100387450
510 Ga0068855_100703525
511 Ga0070664_100003298
512 Ga0070664_100082760
513 Ga0068854_100018613
514 Ga0068864_100027239
515 Ga0068864_100929811
516 Ga0068870_10305504
517 Ga0068863_100016965
518 Ga0068860_100170244
519 Ga0081455_10000240
520 Ga0081538_10000858
521 Ga0081538_10129299
522 Ga0081540_1000027
523 Ga0070715_10143676
524 Ga0070716_100073552
525 Ga0070712_100258312
526 Ga0075362_10044934
527 Ga0097621_100062107
528 Ga0097621_100186123
529 Ga0068871_100015554
530 Ga0075428_100125835
531 Ga0075428_100155533
532 Ga0075428_100606108
533 Ga0075428_100820611
534 Ga0075430_100019890
535 Ga0075430_100074007
536 Ga0075430_100099668
537 Ga0075431_100015740
538 Ga0075431_100169511
539 Ga0075431_100422398
540 Ga0075433_10012051
541 Ga0075433_10021438
542 Ga0075433_10041055
543 Ga0075433_10182087
544 Ga0075433_10411537
545 Ga0075433_10659601
546 Ga0075434_100000644
547 Ga0075434_100003205
548 Ga0075434_100012637
549 Ga0075434_100013269
550 Ga0075434_100017418
551 Ga0075434_100018475
552 Ga0075434_100103592
553 Ga0075434_100148840
554 Ga0075429_100174668
555 Ga0075429_100582213
556 Ga0068865_100024500
557 Ga0068865_100084404
558 Ga0075436_100054544
559 Ga0075436_100073976
560 Ga0075436_100087227
561 Ga0075435_100000588
562 Ga0075435_100004481
563 Ga0075435_100095651
564 Ga0075435_100119289
565 Ga0075435_100190603
566 Ga0075435_100453433
567 Ga0111539_10186556
568 Ga0111539_10274112
569 Ga0111539_10477032
570 Ga0111539_10517487
571 Ga0105245_10001238
572 Ga0105247_10139353
573 Ga0114129_10002603
574 Ga0114129_10040175
575 Ga0114129_10099052
576 Ga0114129_10157370
577 Ga0114129_10206839
578 Ga0114129_10208212
579 Ga0114129_10617113
580 Ga0114129_10664541
581 Ga0114129_10768615
582 Ga0105243_10026995
583 Ga0105242_10237720
584 Ga0105242_10452690
585 Ga0105248_10236492
586 Ga0105248_10481297
587 Ga0105238_10000499
588 Ga0105238_10055931
589 Ga0105238_10743287
590 Ga0105239_10228953
591 Ga0105239_10466784
592 Ga0157371_10020081
593 Ga0157374_10008639
594 Ga0157378_10025375
595 Ga0157378_10087290
596 Ga0157378_10352764
597 Ga0163162_10039767
598 Ga0163162_10759386
599 Ga0157372_10336380
600 Ga0157375_10161071
601 Ga0157375_10181043
602 Ga0163163_10121197
603 Ga0157379_10091761
604 Ga0157376_10008228
605 Ga0163161_10060544
606 Ga0163161_10199382
607 Ga0207697_10056410
608 Ga0207653_10092512
609 Ga0207642_10017520
610 Ga0207680_10211403
611 Ga0207680_10283447
612 Ga0207699_10030267
613 Ga0207645_10002520
614 Ga0207643_10308908
615 Ga0207705_10007374
616 Ga0207707_10006403
617 Ga0207707_10040557
618 Ga0207707_10676468
619 Ga0207693_10106660
620 Ga0207693_10119830
621 Ga0207660_10018642
622 Ga0207662_10050372
623 Ga0207657_10001479
624 Ga0207657_10129662
625 Ga0207649_10088487
626 Ga0207652_10055099
627 Ga0207652_10160736
628 Ga0207652_10302215
629 Ga0207646_10027557
630 Ga0207646_10236557
631 Ga0207646_10328868
632 Ga0207681_10085781
633 Ga0207694_10006805
634 Ga0207694_10044287
635 Ga0207659_10329355
636 Ga0207687_10008390
637 Ga0207664_10002106
638 Ga0207644_10032045
639 Ga0207644_10117697
640 Ga0207644_10235536
641 Ga0207706_10003428
642 Ga0207706_10053436
643 Ga0207686_10156737
644 Ga0207709_10042377
645 Ga0207709_10210393
646 Ga0207669_10082669
647 Ga0207704_10055496
648 Ga0207704_10456105
649 Ga0207691_10003335
650 Ga0207691_10320405
651 Ga0207711_10064816
652 Ga0207689_10048881
653 Ga0207679_10051273
654 Ga0207679_10052744
655 Ga0207667_10608875
656 Ga0207651_10610606
657 Ga0207668_10050379
658 Ga0207640_10602575
659 Ga0207658_10104449
660 Ga0207658_10651482
661 Ga0207703_10939645
662 Ga0207641_10013622
663 Ga0207648_10445846
664 Ga0207676_10013828
665 Ga0207676_10190070
666 Ga0207676_10357668
667 Ga0207674_10654607
668 Ga0207683_10004679
669 Ga0207683_10026323
670 Ga0207683_10076700
671 Ga0209971_1008400
672 Ga0209974_10041437
673 Ga0207428_10059901
674 Ga0207428_10166480
675 Ga0268264_10149271
676 Ga0265332_10001808
677 Ga0265325_10000780
678 Ga0265340_10001397
679 Ga0265340_10010585
680 Ga0265339_10000643
681 Ga0265331_10013242
682 Ga0265331_10046781
683 Ga0316579_10003261
684 Ga0265314_10050676
685 Ga0265342_10000179
686 Ga0316576_10296155
687 Ga0307516_10001365
688 Ga0307407_10227327
689 Ga0307409_100191706
690 Ga0307416_100007819
691 Ga0307416_100181452
692 Ga0307414_10007976
693 Ga0307414_10107274
694 Ga0307411_10104474
695 Ga0307415_100040710
696 Ga0373930_0016041
697 Ga0373939_0005511
698 Ga0373954_0104929
699 Ga0373946_0163467
700 Ga0373961_0071772
701 Ga0373931_0032313
702 Ga0373931_0049940
703 Ga0373935_0179212
704 Ga0373935_0186977
705 Ga0373927_0062401
706 Ga0373927_0075482
707 Ga0373937_0126354
708 Ga0373925_0402028
709 Ga0242420_021805
710 Ga0439458_0048954
711 Ga0439458_0073465
712 Ga0453683_0000163
713 Ga0453683_0002574
714 Ga0453683_0511494
715 Ga0451576_0246037
716 Ga0451576_1090955
717 Ga0495592_0060914
718 Ga0495592_0195400
719 Ga0495629_0022868
720 Ga0495651_0028731
721 Ga0495662_0222907
722 Ga0495608_0046300
723 Ga0495618_0071682
724 Ga0495628_0046641
725 Ga0495652_0017276
726 Ga0495640_0057784
727 Ga0495587_0071123
728 Ga0495587_0081842
729 Ga0495645_0175120
730 Ga0495667_0053562
731 Ga0495625_0000091
732 Ga0495599_0043564
733 Ga0495646_0005780
734 Ga0495624_0027791
735 Ga0495670_0054885
736 Ga0495600_0155064
737 Ga0495600_0177584
738 Ga0495604_0002906
739 Ga0495674_0013353
740 Ga0495674_0395302
741 Ga0495680_0536955
742 Ga0495602_0014785
743 Ga0496100_0042543
744 Ga0496101_0058469
745 Ga0496104_0085918
746 Ga0496104_0732563
747 Ga0496105_0070299
748 Ga0496106_0039121
749 Ga0496107_0269325
750 Ga0496110_0082279
751 Ga0496112_0003925
752 Ga0496112_0075033
753 Ga0496112_0267997
754 Ga0496113_0088894
755 Ga0496113_0115017
756 Ga0496114_0272065
757 Ga0496115_0069211
758 Ga0501299_014653
759 Ga0501031_0220661
760 Ga0501032_0212239
761 Ga0501034_0199323
762 Ga0501036_0095942
763 Ga0501036_0107193
764 Ga0501036_0223325
765 Ga0501036_0277185
766 Ga0501036_0555378
767 Ga0501037_0035192
768 Ga0501037_0044220
769 Ga0501038_0010885
770 Ga0501038_0038538
771 Ga0501038_0110269
772 Ga0501039_0002281
773 Ga0501039_0569917
774 Ga0501040_0001858
775 Ga0501040_0015423
776 Ga0501040_0122461
777 Ga0501041_0000143
778 Ga0501041_0048004
779 Ga0501042_0000211
780 Ga0501042_0014055
781 Ga0501042_0321638
782 Ga0501043_0068899
783 Ga0501046_0061815
784 Ga0501046_0291585
785 Ga0501046_0313672
786 Ga0501047_0223515
787 Ga0501048_0059119
788 Ga0501048_0065214
789 Ga0501048_0075227
790 Ga0501067_0020273
791 Ga0501068_0018305
792 Ga0501070_0010534
793 Ga0501071_0000432
794 Ga0501072_0000240
795 Ga0501073_0281896
796 Ga0501073_0330883
797 Ga0501074_0006989
798 Ga0501075_0000186
799 Ga0501075_0069533
800 Ga0501075_0119439
801 Ga0501075_0171774
802 Ga0501076_0000082
803 Ga0501076_0047438
804 Ga0501076_0049618
805 Ga0501077_0001067
806 Ga0501077_0008310
807 Ga0501077_0175535
808 Ga0501209_015329
809 Ga0501233_037831
810 Ga0501079_0000078
811 Ga0501079_0141604
812 Ga0501079_0199756
813 Ga0501079_0426067
814 Ga0501080_0010320
815 Ga0501080_0510031
816 Ga0501081_0000012
817 Ga0501081_0030753
818 Ga0501081_0197995
819 Ga0501083_0042568
820 Ga0501083_0158236
821 Ga0501271_008936
822 Ga0501035_0067739
823 Ga0501044_0000266
824 Ga0501044_0069389
825 Ga0501044_0290734
826 Ga0501045_0000722
827 Ga0501045_0011680
828 Ga0501045_0026135
829 Ga0501204_021904
830 nmdc:mga05p37_160680_c1
831 nmdc:mga05p37_23994_c1
832 nmdc:mga05p37_401_c1
833 nmdc:mga05p37_440241_c1
834 nmdc:mga05p37_599852_c1
835 nmdc:mga05p37_690373_c1
836 nmdc:mga0qj67_215009_c1
837 nmdc:mga0qj67_90668_c1
838 nmdc:mga06r32_108955_c1
839 nmdc:mga06r32_77856_c1
840 nmdc:mga08y16_120557_c1
841 nmdc:mga08y16_150646_c1
842 nmdc:mga08y16_170731_c1
843 nmdc:mga08y16_402767_c1
844 nmdc:mga0n895_120084_c1
845 nmdc:mga0n895_141749_c1
846 nmdc:mga0n895_15730_c1
847 nmdc:mga0n895_193_c1
848 nmdc:mga0n895_2363_c1
849 nmdc:mga0n895_283173_c1
850 nmdc:mga0n895_4678_c1
851 nmdc:mga0n895_6383_c1
852 nmdc:mga0rr50_173155_c1
853 nmdc:mga0rr50_18876_c1
854 nmdc:mga0rr50_391939_c1
855 nmdc:mga0rr50_49174_c1
856 nmdc:mga0rr50_667_c1
857 nmdc:mga08x19_132746_c1
858 nmdc:mga08x19_241326_c1
859 nmdc:mga08x19_313871_c1
860 nmdc:mga0a205_16110_c1
861 nmdc:mga0a205_1860_c1
862 nmdc:mga0a205_209722_c1
863 nmdc:mga0a205_286877_c1
864 nmdc:mga0a205_4058_c1
865 nmdc:mga0a205_90404_c1
866 Ga0495601_0001225
867 Ga0495601_0170879
868 Ga0495612_0006214
869 Ga0495595_0069404
870 Ga0495619_0001936
871 Ga0500644_0000035
872 Ga0500595_024656
873 Ga0500607_044201
874 Ga0500642_0091697
875 Ga0500559_0086298
876 Ga0500616_0018499
877 Ga0501084_0000958
878 Ga0501084_0537601
879 Ga0501082_0002038
880 Ga0501082_0022848
881 Ga0501082_0069287
882 Ga0501082_0112030
883 Ga0501082_0318733
884 Ga0501082_0498265
885 Ga0530510_0000996
886 Ga0530510_0008049
887 Ga0530510_0154061
888 Ga0530510_0223968
889 Ga0530510_0333099
890 Ga0530510_0402837
891 2644041044
892 8056215774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

51

243

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

57

290

0.95

PF08659

KR

KR domain

51

233

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ew8-assembly1.cif.gz_C crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9684 6 251
2ew8-assembly1.cif.gz_D crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 0.9678 6 251
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9621 7 249
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9605 7 248
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9602 6 249
ID Description Score Start End Superfamily
af_P9WGQ9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9628 7 251 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9621 7 249 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9602 6 249 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.957 6 248 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9519 1 191 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A534UHB7-F1-model_v4 SDR family oxidoreductase 0.9895 6 192 GO:0016616
AF-A0A836TP84-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9891 7 189 GO:0016491
AF-A0A439LSN5-F1-model_v4 SDR family oxidoreductase 0.9883 6 248 GO:0016616
AF-A0A6L8I6P3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9853 6 198 GO:0016616
AF-A0A383BQ32-F1-model_v4 Uncharacterized protein 0.9843 5 190 GO:0016616
GO:0030497

Map