metagRoot

F445789

General Info

Members	Datasets	Scaffolds	Average Seq Length
446	237	446	432

Family's Representative Sequence

Representative Sequence	3300046474\|Ga0495605_0049018\|Ga0495605_0049018_482_1777
Length	431
Sequence	MMSTRAAESPRLPGAGERVLQGKSRWGVIPFLGPAFIACVAYMDPGNFATNIAGGSKFGFTLVWVIVASNLMAMLIQTLSAKLGIATGRNLPEVCRERFSRRTSIGLWIQAELIAMATDLAEFLGAALGIKLLLHIQLFPAAVITGVITFLILGLQRYGFRPLEAVITAFIAVIGICYLAELWFAHPPLGEVAKHAVVPDFAGSESVLLAVGIIGATVMPHVIYLHSALTQNRVVPRNDDEAKRLYRYTRIDVLIAMLIAGLINMAMLVVAATVFFESGLTNVDSLEGAHRTLEPLLGGASSVLFALALTASGLSSSAVGTMSGQVVMQGFIQRRIPLFVRRLVTMIPAFVVIAIQGDGDVSRTLVISQVVLSFGIPFALIPLVMFTSRRDIMGVLVNARLTIAAAVGVAAIISALNIFLLAQTFGLLGSG

Samples

	Sample ID	Description	Type	Environment
1	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
2	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
3	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
4	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
5	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
6	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
7	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
8	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
9	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
10	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
11	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
12	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
13	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
14	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
15	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
16	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
17	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
18	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
19	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
20	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
21	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
22	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
23	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
24	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
25	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
26	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
27	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
28	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
29	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
30	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
31	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
32	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
33	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
34	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
35	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
36	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
37	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
38	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
39	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
40	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
41	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
42	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
43	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
44	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
45	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
46	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
47	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
48	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
49	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
50	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
51	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
52	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
53	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
54	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
55	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
56	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
57	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
58	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
59	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
60	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
62	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
63	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
65	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
67	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
68	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
69	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
70	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
71	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
72	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
73	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
74	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
75	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
76	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
77	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
78	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
79	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
80	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
81	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
126	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
129	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
130	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
131	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
132	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
133	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
134	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
135	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
136	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
137	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
138	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
139	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
140	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
141	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
142	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
143	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
144	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
145	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
146	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
147	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
148	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
149	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
150	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
151	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
152	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
153	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
154	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
155	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
156	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
157	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
158	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
159	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
160	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
161	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
162	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
163	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
164	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
165	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
166	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
167	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
168	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
169	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
170	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
171	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
172	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
173	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
174	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
175	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
176	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
177	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
178	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
179	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
180	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
181	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
182	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
183	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
184	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
185	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
186	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
187	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
188	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
189	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
190	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
191	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
192	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
193	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
194	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
195	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
196	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
197	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
198	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
199	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
200	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
201	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
202	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
203	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
204	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
205	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
206	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
207	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
208	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
209	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
210	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
211	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
212	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
213	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
214	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
215	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
216	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
217	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
218	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
219	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
220	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
221	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
222	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
223	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
226	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
227	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
228	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
229	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
230	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
231	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
232	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
233	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
234	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
235	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
236	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
237	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.04
Nodule	0
Rhizoplane	16.37
Rhizosphere	78.48
Stem	0
Stem Tuber	0
Unclassified	1.12

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10003186	3300001979	Bacteria	7243
2	Ga0070658_10017126	3300005327	Bacteria	5799
3	Ga0070683_100003109	3300005329	Bacteria	13374
4	Ga0070683_100012149	3300005329	Bacteria	7473
5	Ga0070683_100012949	3300005329	Bacteria	7260
6	Ga0070683_100016966	3300005329	Bacteria	6426
7	Ga0070690_100003538	3300005330	Bacteria	8563
8	Ga0070677_10000022	3300005333	Bacteria	45355
9	Ga0070666_10027363	3300005335	Bacteria	3734
10	Ga0070682_100000099	3300005337	Bacteria	77574
11	Ga0070682_100040412	3300005337	Bacteria	2870
12	Ga0070682_100045299	3300005337	Bacteria	2726
13	Ga0068868_100000450	3300005338	Bacteria	27515
14	Ga0068868_100013140	3300005338	Bacteria	6065
15	Ga0068868_100016195	3300005338	Bacteria	5531
16	Ga0070660_100105097	3300005339	Bacteria	2240
17	Ga0070691_10000379	3300005341	Bacteria	16112
18	Ga0070661_100000102	3300005344	Bacteria	69941
19	Ga0070661_100157146	3300005344	Bacteria	1721
20	Ga0070692_10020205	3300005345	Bacteria	3227
21	Ga0070668_100020258	3300005347	Bacteria	5018
22	Ga0070675_100000027	3300005354	Bacteria	106172
23	Ga0070674_100000090	3300005356	Bacteria	42115
24	Ga0070674_100000683	3300005356	Bacteria	17159
25	Ga0070673_100005169	3300005364	Bacteria	8331
26	Ga0070673_100183158	3300005364	Bacteria	1794
27	Ga0070688_100000738	3300005365	Bacteria	16106
28	Ga0070688_100003810	3300005365	Bacteria	7820
29	Ga0070688_100007428	3300005365	Bacteria	5908
30	Ga0070659_100061011	3300005366	Bacteria	2979
31	Ga0070713_100306158	3300005436	Bacteria	1464
32	Ga0070710_10012125	3300005437	Bacteria	4272
33	Ga0070701_10008254	3300005438	Bacteria	4494
34	Ga0070711_100000734	3300005439	Bacteria	17090
35	Ga0070711_100090241	3300005439	Bacteria	2207
36	Ga0070700_100003530	3300005441	Bacteria	8067
37	Ga0070700_100003961	3300005441	Bacteria	7691
38	Ga0070694_100024513	3300005444	Bacteria	3893
39	Ga0070663_100010392	3300005455	Bacteria	5801
40	Ga0070678_100001355	3300005456	Bacteria	13027
41	Ga0070678_100142066	3300005456	Bacteria	1922
42	Ga0070662_100000004	3300005457	Bacteria	195534
43	Ga0070681_10083373	3300005458	Bacteria	3150
44	Ga0068867_100000796	3300005459	Bacteria	21356
45	Ga0070685_10000141	3300005466	Bacteria	46333
46	Ga0070685_10000616	3300005466	Bacteria	19644
47	Ga0070685_10035052	3300005466	Bacteria	2830
48	Ga0070685_10122448	3300005466	Bacteria	1617
49	Ga0070706_100015559	3300005467	Bacteria	7027
50	Ga0070706_100025446	3300005467	Bacteria	5447
51	Ga0070707_100004648	3300005468	Bacteria	12854
52	Ga0070699_100019861	3300005518	Bacteria	5792
53	Ga0070679_100000243	3300005530	Bacteria	45435
54	Ga0070684_100042950	3300005535	Bacteria	3904
55	Ga0068853_100003775	3300005539	Bacteria	11609
56	Ga0070672_100031007	3300005543	Bacteria	4021
57	Ga0070686_100000601	3300005544	Bacteria	21265
58	Ga0070665_100000106	3300005548	Bacteria	157315
59	Ga0070665_100000950	3300005548	Bacteria	36935
60	Ga0070665_100037770	3300005548	Bacteria	4855
61	Ga0070665_100124655	3300005548	Bacteria	2578
62	Ga0070664_100033040	3300005564	Bacteria	4330
63	Ga0070664_100050508	3300005564	Bacteria	3520
64	Ga0070664_100168855	3300005564	Bacteria	1940
65	Ga0068854_100000156	3300005578	Bacteria	46593
66	Ga0068856_100000629	3300005614	Bacteria	38394
67	Ga0068856_100007081	3300005614	Bacteria	10950
68	Ga0068856_100009027	3300005614	Bacteria	9700
69	Ga0070702_100008617	3300005615	Bacteria	4949
70	Ga0068852_100000006	3300005616	Bacteria	159569
71	Ga0068866_10000001	3300005718	Bacteria	519680
72	Ga0068866_10000685	3300005718	Bacteria	15430
73	Ga0068866_10012660	3300005718	Bacteria	3681
74	Ga0068866_10032932	3300005718	Bacteria	2509
75	Ga0068866_10057774	3300005718	Bacteria	2001
76	Ga0068866_10087580	3300005718	Bacteria	1688
77	Ga0068861_100025203	3300005719	Bacteria	4311
78	Ga0068861_100139096	3300005719	Bacteria	1980
79	Ga0068851_10001416	3300005834	Bacteria	10485
80	Ga0068863_100000342	3300005841	Bacteria	47536
81	Ga0068858_100000009	3300005842	Bacteria	237748
82	Ga0068860_100075111	3300005843	Bacteria	3215
83	Ga0081455_10007955	3300005937	Bacteria	11088
84	Ga0081540_1000449	3300005983	Bacteria	40724
85	Ga0081539_10000246	3300005985	Bacteria	127353
86	Ga0081539_10019737	3300005985	Bacteria	4597
87	Ga0075365_10001932	3300006038	Bacteria	9782
88	Ga0075365_10002660	3300006038	Bacteria	8870
89	Ga0075365_10007452	3300006038	Bacteria	6128
90	Ga0075365_10031523	3300006038	Bacteria	3401
91	Ga0075365_10075182	3300006038	Bacteria	2279
92	Ga0075363_100077146	3300006048	Bacteria	1818
93	Ga0075364_10006609	3300006051	Bacteria	6827
94	Ga0075364_10009364	3300006051	Bacteria	5872
95	Ga0075364_10013659	3300006051	Bacteria	5000
96	Ga0075364_10124272	3300006051	Bacteria	1729
97	Ga0070715_10000001	3300006163	Bacteria	693690
98	Ga0070716_100031197	3300006173	Bacteria	2897
99	Ga0070712_100019861	3300006175	Bacteria	4391
100	Ga0070712_100021026	3300006175	Bacteria	4278
101	Ga0097621_100005876	3300006237	Bacteria	8669
102	Ga0097621_100136682	3300006237	Bacteria	2091
103	Ga0075431_100000536	3300006847	Bacteria	31867
104	Ga0075434_100001678	3300006871	Bacteria	18909
105	Ga0075434_100155239	3300006871	Bacteria	2308
106	Ga0111539_10005066	3300009094	Bacteria	17115
107	Ga0105245_10000020	3300009098	Bacteria	181774
108	Ga0105245_10000254	3300009098	Bacteria	50918
109	Ga0105245_10010405	3300009098	Bacteria	8101
110	Ga0105245_10019458	3300009098	Bacteria	5948
111	Ga0114129_10006865	3300009147	Bacteria	16187
112	Ga0114129_10166647	3300009147	Bacteria	3006
113	Ga0105243_10006240	3300009148	Bacteria	9212
114	Ga0105243_10012846	3300009148	Bacteria	6328
115	Ga0105242_10000032	3300009176	Bacteria	98198
116	Ga0105242_10000454	3300009176	Bacteria	32662
117	Ga0105248_10071294	3300009177	Bacteria	3903
118	Ga0105238_10000011	3300009551	Bacteria	261080
119	Ga0105238_10166005	3300009551	Bacteria	2183
120	Ga0105249_10000080	3300009553	Bacteria	138080
121	Ga0105239_10003834	3300010375	Bacteria	18258
122	Ga0105239_10152616	3300010375	Bacteria	2578
123	Ga0105239_10184946	3300010375	Bacteria	2332
124	Ga0157369_10000020	3300013105	Bacteria	241679
125	Ga0157374_10001772	3300013296	Bacteria	18163
126	Ga0157378_10066419	3300013297	Bacteria	3231
127	Ga0163162_10000583	3300013306	Bacteria	33791
128	Ga0157372_10000112	3300013307	Bacteria	85902
129	Ga0157375_10037053	3300013308	Bacteria	4670
130	Ga0157375_10055094	3300013308	Bacteria	3919
131	Ga0157375_10063321	3300013308	Bacteria	3679
132	Ga0157375_10064237	3300013308	Bacteria	3654
133	Ga0157379_10003159	3300014968	Bacteria	13936
134	Ga0157376_10005263	3300014969	Bacteria	9036
135	Ga0163161_10002086	3300017792	Bacteria	14485
136	Ga0207682_10000005	3300025893	Bacteria	95617
137	Ga0207642_10000002	3300025899	Bacteria	658166
138	Ga0207642_10000281	3300025899	Bacteria	15233
139	Ga0207642_10004706	3300025899	Bacteria	4411
140	Ga0207710_10000458	3300025900	Bacteria	26155
141	Ga0207688_10046442	3300025901	Bacteria	2425
142	Ga0207647_10096381	3300025904	Bacteria	1760
143	Ga0207685_10000027	3300025905	Bacteria	102101
144	Ga0207705_10032908	3300025909	Bacteria	3705
145	Ga0207707_10072992	3300025912	Bacteria	2992
146	Ga0207693_10000778	3300025915	Bacteria	28589
147	Ga0207693_10005539	3300025915	Bacteria	10504
148	Ga0207693_10015289	3300025915	Bacteria	6159
149	Ga0207663_10000498	3300025916	Bacteria	17164
150	Ga0207663_10020039	3300025916	Bacteria	3782
151	Ga0207660_10008386	3300025917	Bacteria	6684
152	Ga0207657_10009635	3300025919	Bacteria	9691
153	Ga0207649_10000009	3300025920	Bacteria	295544
154	Ga0207652_10002027	3300025921	Bacteria	17455
155	Ga0207652_10015699	3300025921	Bacteria	6168
156	Ga0207646_10000865	3300025922	Bacteria	39159
157	Ga0207694_10000004	3300025924	Bacteria	967075
158	Ga0207659_10000010	3300025926	Bacteria	286639
159	Ga0207659_10059348	3300025926	Bacteria	2750
160	Ga0207687_10000007	3300025927	Bacteria	604185
161	Ga0207687_10000013	3300025927	Bacteria	299826
162	Ga0207687_10002226	3300025927	Bacteria	13218
163	Ga0207687_10005882	3300025927	Bacteria	8110
164	Ga0207687_10040263	3300025927	Bacteria	3203
165	Ga0207687_10066105	3300025927	Bacteria	2569
166	Ga0207687_10084410	3300025927	Bacteria	2302
167	Ga0207700_10000027	3300025928	Bacteria	137708
168	Ga0207664_10024144	3300025929	Bacteria	4567
169	Ga0207706_10000012	3300025933	Bacteria	195475
170	Ga0207686_10000048	3300025934	Bacteria	115595
171	Ga0207686_10000447	3300025934	Bacteria	27400
172	Ga0207709_10029668	3300025935	Bacteria	3175
173	Ga0207669_10000018	3300025937	Bacteria	114254
174	Ga0207669_10000096	3300025937	Bacteria	44213
175	Ga0207669_10093578	3300025937	Bacteria	1964
176	Ga0207704_10000159	3300025938	Bacteria	36005
177	Ga0207665_10044289	3300025939	Bacteria	2978
178	Ga0207665_10045813	3300025939	Bacteria	2929
179	Ga0207691_10005986	3300025940	Bacteria	11745
180	Ga0207691_10015355	3300025940	Bacteria	7285
181	Ga0207711_10000006	3300025941	Bacteria	792692
182	Ga0207661_10000253	3300025944	Bacteria	34627
183	Ga0207661_10000347	3300025944	Bacteria	29715
184	Ga0207661_10011874	3300025944	Bacteria	6327
185	Ga0207679_10208271	3300025945	Bacteria	1638
186	Ga0207651_10033652	3300025960	Bacteria	3308
187	Ga0207651_10156507	3300025960	Bacteria	1781
188	Ga0207712_10000007	3300025961	Bacteria	539589
189	Ga0207712_10003829	3300025961	Bacteria	9499
190	Ga0207640_10000038	3300025981	Bacteria	108630
191	Ga0207640_10003186	3300025981	Bacteria	8830
192	Ga0207677_10000200	3300026023	Bacteria	48320
193	Ga0207677_10013068	3300026023	Bacteria	4797
194	Ga0207703_10000023	3300026035	Bacteria	222018
195	Ga0207639_10108827	3300026041	Bacteria	2254
196	Ga0207708_10000468	3300026075	Bacteria	31201
197	Ga0207708_10005074	3300026075	Bacteria	9711
198	Ga0207702_10000158	3300026078	Bacteria	79984
199	Ga0207702_10004125	3300026078	Bacteria	13025
200	Ga0207702_10074400	3300026078	Bacteria	2932
201	Ga0207641_10000238	3300026088	Bacteria	71152
202	Ga0207648_10008647	3300026089	Bacteria	9832
203	Ga0207674_10238110	3300026116	Bacteria	1767
204	Ga0207675_100050607	3300026118	Bacteria	3876
205	Ga0207675_100160408	3300026118	Bacteria	2145
206	Ga0207683_10000041	3300026121	Bacteria	94017
207	Ga0207683_10004283	3300026121	Bacteria	12324
208	Ga0207683_10106454	3300026121	Bacteria	2508
209	Ga0207683_10181464	3300026121	Bacteria	1908
210	Ga0207698_10000013	3300026142	Bacteria	255414
211	Ga0207698_10049913	3300026142	Bacteria	3188
212	Ga0207698_10051367	3300026142	Bacteria	3152
213	Ga0207428_10021246	3300027907	Bacteria	5497
214	Ga0268266_10000047	3300028379	Bacteria	310996
215	Ga0268266_10006385	3300028379	Bacteria	10799
216	Ga0268266_10109698	3300028379	Bacteria	2444
217	Ga0268265_10255098	3300028380	Bacteria	1556
218	Ga0265337_1000807	3300028556	Bacteria	16498
219	Ga0265326_10000252	3300028558	Bacteria	25133
220	Ga0265319_1000020	3300028563	Bacteria	153921
221	Ga0265319_1002134	3300028563	Bacteria	11067
222	Ga0265318_10000604	3300028577	Bacteria	25020
223	Ga0265318_10000968	3300028577	Bacteria	18432
224	Ga0265323_10006182	3300028653	Bacteria	5049
225	Ga0265322_10000001	3300028654	Bacteria	543854
226	Ga0265336_10021526	3300028666	Bacteria	2060
227	Ga0265338_10001248	3300028800	Bacteria	41926
228	Ga0265338_10006184	3300028800	Bacteria	15349
229	Ga0265324_10000755	3300029957	Bacteria	21443
230	Ga0265330_10003122	3300031235	Bacteria	8773
231	Ga0265328_10000719	3300031239	Bacteria	15346
232	Ga0265328_10001094	3300031239	Bacteria	12441
233	Ga0265320_10000002	3300031240	Bacteria	542875
234	Ga0265325_10002559	3300031241	Bacteria	12232
235	Ga0265325_10027972	3300031241	Bacteria	3044
236	Ga0265329_10010994	3300031242	Bacteria	3303
237	Ga0265340_10002638	3300031247	Bacteria	10198
238	Ga0265331_10007296	3300031250	Bacteria	6406
239	Ga0265331_10009837	3300031250	Bacteria	5330
240	Ga0265327_10000011	3300031251	Bacteria	543807
241	Ga0265327_10006079	3300031251	Bacteria	9793
242	Ga0265327_10015893	3300031251	Bacteria	4822
243	Ga0265316_10002341	3300031344	Bacteria	19753
244	Ga0265316_10011610	3300031344	Bacteria	7932
245	Ga0265313_10050483	3300031595	Bacteria	1995
246	Ga0265314_10000062	3300031711	Bacteria	159496
247	Ga0265314_10007971	3300031711	Bacteria	9136
248	Ga0265314_10012920	3300031711	Bacteria	6781
249	Ga0265342_10029532	3300031712	Bacteria	3403
250	Ga0316578_10024138	3300031728	Bacteria	3410
251	Ga0307416_100215792	3300032002	Bacteria	1835
252	Ga0373943_0077568	3300035170	Bacteria	1697
253	Ga0395899_0244141	3300037312	Bacteria	1235
254	Ga0395900_0002249	3300037418	Bacteria	21466
255	Ga0395900_0014396	3300037418	Bacteria	8073
256	Ga0395898_0001408	3300037466	Bacteria	34249
257	Ga0395898_0035326	3300037466	Bacteria	4972
258	Ga0395898_0088007	3300037466	Bacteria	2991
259	Ga0395905_0004021	3300037471	Bacteria	15433
260	Ga0436364_1554384	3300037853	Bacteria	1642
261	Ga0395901_0000809	3300038443	Bacteria	34767
262	Ga0395901_0004783	3300038443	Bacteria	13666
263	Ga0395901_0028296	3300038443	Bacteria	5764
264	Ga0395901_0085659	3300038443	Bacteria	3294
265	Ga0451577_0000243	3300042876	Bacteria	107789
266	Ga0466963_0000153	3300044694	Bacteria	27553
267	Ga0453684_0000804	3300044712	Bacteria	106902
268	Ga0466957_0044462	3300044842	Bacteria	2691
269	Ga0466958_0030687	3300045836	Bacteria	3194
270	Ga0466967_0000009	3300045976	Bacteria	122610
271	Ga0466967_0001283	3300045976	Bacteria	14292
272	Ga0495592_0102659	3300046454	Bacteria	2035
273	Ga0495603_0001462	3300046455	Bacteria	13743
274	Ga0495603_0081390	3300046455	Bacteria	1897
275	Ga0495629_0003113	3300046459	Bacteria	12579
276	Ga0495629_0045971	3300046459	Bacteria	3063
277	Ga0495641_0000228	3300046461	Bacteria	43671
278	Ga0495641_0076043	3300046461	Bacteria	1505
279	Ga0495582_0000081	3300046473	Bacteria	48557
280	Ga0495605_0049018	3300046474	Bacteria	2065
281	Ga0495662_0094228	3300046476	Bacteria	1462
282	Ga0495594_0000029	3300046499	Bacteria	66789
283	Ga0495594_0061289	3300046499	Bacteria	2082
284	Ga0495606_0000072	3300046507	Bacteria	173678
285	Ga0495608_0000060	3300046511	Bacteria	88189
286	Ga0495608_0000529	3300046511	Bacteria	26174
287	Ga0495618_0000008	3300046514	Bacteria	204578
288	Ga0495620_0000824	3300046515	Bacteria	19119
289	Ga0495628_0009655	3300046516	Bacteria	8232
290	Ga0495628_0041865	3300046516	Bacteria	3655
291	Ga0495628_0122216	3300046516	Bacteria	1996
292	Ga0495630_0000020	3300046517	Bacteria	176389
293	Ga0495630_0139721	3300046517	Bacteria	1841
294	Ga0495652_0000407	3300046529	Bacteria	50232
295	Ga0495652_0045375	3300046529	Bacteria	3779
296	Ga0495586_0071704	3300046535	Bacteria	1893
297	Ga0495587_0019281	3300046536	Bacteria	4224
298	Ga0495645_0006445	3300046543	Bacteria	8142
299	Ga0495645_0019986	3300046543	Bacteria	4828
300	Ga0495622_0000550	3300046557	Bacteria	22511
301	Ga0495667_0000018	3300046559	Bacteria	188610
302	Ga0495634_0015499	3300046642	Bacteria	5475
303	Ga0495634_0132262	3300046642	Bacteria	1589
304	Ga0495635_0000044	3300046663	Bacteria	83945
305	Ga0495588_0000134	3300046674	Bacteria	117581
306	Ga0495657_0000004	3300046675	Bacteria	266465
307	Ga0495657_0022928	3300046675	Bacteria	4468
308	Ga0495657_0051214	3300046675	Bacteria	2773
309	Ga0495599_0018403	3300046678	Bacteria	4352
310	Ga0495647_0000018	3300046681	Bacteria	81701
311	Ga0495647_0000156	3300046681	Bacteria	17539
312	Ga0495658_0000034	3300046683	Bacteria	69176
313	Ga0495669_0014521	3300046684	Bacteria	3365
314	Ga0495669_0018748	3300046684	Bacteria	2978
315	Ga0495613_0000801	3300046689	Bacteria	24391
316	Ga0495613_0004320	3300046689	Bacteria	10639
317	Ga0495613_0071867	3300046689	Bacteria	2522
318	Ga0495613_0090691	3300046689	Bacteria	2214
319	Ga0495624_0000647	3300046690	Bacteria	27259
320	Ga0495624_0002509	3300046690	Bacteria	13903
321	Ga0495624_0088870	3300046690	Bacteria	1907
322	Ga0495649_0008541	3300046694	Bacteria	6154
323	Ga0495600_0099031	3300046809	Bacteria	1900
324	Ga0495581_0013243	3300047315	Bacteria	4783
325	Ga0495604_0000055	3300047317	Bacteria	100430
326	Ga0495604_0000137	3300047317	Bacteria	62542
327	Ga0495604_0009878	3300047317	Bacteria	7555
328	Ga0495674_0000064	3300047319	Bacteria	71275
329	Ga0495674_0112482	3300047319	Bacteria	2307
330	Ga0495676_0000130	3300047321	Bacteria	56693
331	Ga0495676_0021340	3300047321	Bacteria	5660
332	Ga0495676_0117044	3300047321	Bacteria	1945
333	Ga0495680_0000550	3300047322	Bacteria	42291
334	Ga0495680_0003958	3300047322	Bacteria	14324
335	Ga0495680_0004286	3300047322	Bacteria	13686
336	Ga0495675_0000842	3300047444	Bacteria	18758
337	Ga0495679_010145	3300047446	Bacteria	3718
338	Ga0495602_0000041	3300048088	Bacteria	126954
339	Ga0495602_0013815	3300048088	Bacteria	8231
340	Ga0496100_0000002	3300048903	Bacteria	489057
341	Ga0496100_0000005	3300048903	Bacteria	312112
342	Ga0496100_0003241	3300048903	Bacteria	8456
343	Ga0496100_0005439	3300048903	Bacteria	6860
344	Ga0496101_0000001	3300048904	Bacteria	489057
345	Ga0496101_0000101	3300048904	Bacteria	89424
346	Ga0496101_0002936	3300048904	Bacteria	10480
347	Ga0496101_0013582	3300048904	Bacteria	5460
348	Ga0496102_0000115	3300048905	Bacteria	114224
349	Ga0496102_0005991	3300048905	Bacteria	10353
350	Ga0496102_0012047	3300048905	Bacteria	7473
351	Ga0496103_0000008	3300048906	Bacteria	340474
352	Ga0496103_0001248	3300048906	Bacteria	17374
353	Ga0496104_0000004	3300048907	Bacteria	641830
354	Ga0496104_0000009	3300048907	Bacteria	488055
355	Ga0496104_0006952	3300048907	Bacteria	9977
356	Ga0496104_0011990	3300048907	Bacteria	7776
357	Ga0496105_0000001	3300048908	Bacteria	1328178
358	Ga0496105_0000007	3300048908	Bacteria	339658
359	Ga0496105_0000650	3300048908	Bacteria	23286
360	Ga0496105_0002671	3300048908	Bacteria	12983
361	Ga0496105_0062754	3300048908	Bacteria	3066
362	Ga0496106_0000084	3300048909	Bacteria	74135
363	Ga0496106_0000151	3300048909	Bacteria	51430
364	Ga0496106_0000682	3300048909	Bacteria	24335
365	Ga0496106_0003662	3300048909	Bacteria	11458
366	Ga0496106_0004801	3300048909	Bacteria	9999
367	Ga0496106_0109106	3300048909	Bacteria	2153
368	Ga0496107_0000003	3300048910	Bacteria	304038
369	Ga0496107_0000011	3300048910	Bacteria	201631
370	Ga0496107_0005800	3300048910	Bacteria	8453
371	Ga0496107_0006797	3300048910	Bacteria	7878
372	Ga0496107_0009590	3300048910	Bacteria	6713
373	Ga0496108_0000001	3300048911	Bacteria	919044
374	Ga0496108_0000175	3300048911	Bacteria	59373
375	Ga0496108_0029134	3300048911	Bacteria	4570
376	Ga0496108_0070281	3300048911	Bacteria	2954
377	Ga0496108_0294858	3300048911	Bacteria	1412
378	Ga0496109_0000003	3300048912	Bacteria	420862
379	Ga0496109_0000121	3300048912	Bacteria	81487
380	Ga0496109_0000249	3300048912	Bacteria	51718
381	Ga0496109_0002789	3300048912	Bacteria	14634
382	Ga0496109_0004424	3300048912	Bacteria	11742
383	Ga0496109_0004990	3300048912	Bacteria	11082
384	Ga0496109_0013347	3300048912	Bacteria	7122
385	Ga0496109_0121266	3300048912	Bacteria	2436
386	Ga0496110_0000021	3300048913	Bacteria	77064
387	Ga0496110_0004679	3300048913	Bacteria	10644
388	Ga0496110_0023470	3300048913	Bacteria	5247
389	Ga0496110_0028592	3300048913	Bacteria	4790
390	Ga0496110_0080736	3300048913	Bacteria	2898
391	Ga0496111_0000009	3300048914	Bacteria	93943
392	Ga0496111_0011152	3300048914	Bacteria	6050
393	Ga0496111_0019839	3300048914	Bacteria	4675
394	Ga0496111_0094164	3300048914	Bacteria	2197
395	Ga0496112_0000006	3300048915	Bacteria	365227
396	Ga0496112_0056312	3300048915	Bacteria	3869
397	Ga0496112_0067246	3300048915	Bacteria	3537
398	Ga0496112_0075670	3300048915	Bacteria	3329
399	Ga0496112_0085412	3300048915	Bacteria	3122
400	Ga0496112_0108075	3300048915	Bacteria	2752
401	Ga0496112_0205549	3300048915	Bacteria	1927
402	Ga0496113_0000004	3300048916	Bacteria	109489
403	Ga0496114_0000101	3300048917	Bacteria	61589
404	Ga0496114_0002457	3300048917	Bacteria	14154
405	Ga0496114_0012931	3300048917	Bacteria	6686
406	Ga0496114_0024341	3300048917	Bacteria	4940
407	Ga0496114_0054067	3300048917	Bacteria	3347
408	Ga0496114_0066853	3300048917	Bacteria	3015
409	Ga0496115_0000003	3300048918	Bacteria	354994
410	Ga0496115_0000200	3300048918	Bacteria	55755
411	Ga0496115_0005151	3300048918	Bacteria	9511
412	Ga0496115_0057641	3300048918	Bacteria	3124
413	Ga0496116_0000735	3300048919	Bacteria	41771
414	Ga0496118_0093077	3300048921	Bacteria	2066
415	Ga0496119_0001290	3300048922	Bacteria	30949
416	Ga0496119_0029762	3300048922	Bacteria	3693
417	Ga0501069_0044708	3300049585	Bacteria	2452
418	Ga0501070_0085465	3300049586	Bacteria	2612
419	nmdc:mga00v17_26204_c1	3300050491	Bacteria	3395
420	nmdc:mga00v17_77461_c1	3300050491	Bacteria	2070
421	nmdc:mga0yw44_11863_c1	3300050492	Bacteria	4521
422	nmdc:mga0yw44_20151_c1	3300050492	Bacteria	3695
423	nmdc:mga0yw44_208360_c1	3300050492	Bacteria	1293
424	nmdc:mga0yw44_43697_c1	3300050492	Bacteria	2677
425	nmdc:mga0yw44_62154_c1	3300050492	Bacteria	2293
426	nmdc:mga05p37_43026_c1	3300050507	Bacteria	5553
427	nmdc:mga06r32_5859_c1	3300050510	Bacteria	11060
428	nmdc:mga08y16_9469_c1	3300050511	Bacteria	10222
429	nmdc:mga0n895_111605_c1	3300050512	Bacteria	2750
430	nmdc:mga0n895_35202_c1	3300050512	Bacteria	4825
431	nmdc:mga0n895_41795_c1	3300050512	Bacteria	4458
432	nmdc:mga0n895_55001_c1	3300050512	Bacteria	3916
433	Ga0495601_0000855	3300053077	Bacteria	16586
434	Ga0495601_0073067	3300053077	Bacteria	2192
435	Ga0495601_0167943	3300053077	Bacteria	1434
436	Ga0495612_0000164	3300053078	Bacteria	27579
437	Ga0495612_0006025	3300053078	Bacteria	4995
438	Ga0495655_0000001	3300053083	Bacteria	419518
439	Ga0495595_0000003	3300053084	Bacteria	266465
440	Ga0495595_0001270	3300053084	Bacteria	9828
441	Ga0495619_0000116	3300053085	Bacteria	58748
442	Ga0495619_0000131	3300053085	Bacteria	55500
443	Ga0495619_0001204	3300053085	Bacteria	16989
444	Ga0495619_0003131	3300053085	Bacteria	10732
445	Ga0500628_000033	3300053129	Bacteria	52431
446	Ga0501084_0051196	3300054114	Bacteria	3456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048913	Ga0496110_0080736	Ga0496110_0080736_1644_2849	378
2	3300028563	Ga0265319_1002134	Ga0265319_100213412	379
3	3300028577	Ga0265318_10000968	Ga0265318_1000096820	379
4	3300028800	Ga0265338_10006184	Ga0265338_100061843	379
5	3300031251	Ga0265327_10015893	Ga0265327_100158935	379
6	3300031344	Ga0265316_10011610	Ga0265316_100116104	379
7	3300031711	Ga0265314_10007971	Ga0265314_100079714	379
8	3300031712	Ga0265342_10029532	Ga0265342_100295322	379
9	3300048903	Ga0496100_0005439	Ga0496100_0005439_2562_3833	380
10	3300048905	Ga0496102_0005991	Ga0496102_0005991_8584_9855	380
11	3300048907	Ga0496104_0011990	Ga0496104_0011990_6493_7764	380
12	3300048908	Ga0496105_0002671	Ga0496105_0002671_7513_8784	380
13	3300048910	Ga0496107_0005800	Ga0496107_0005800_2187_3458	380
14	3300048912	Ga0496109_0002789	Ga0496109_0002789_7068_8339	380
15	3300048913	Ga0496110_0023470	Ga0496110_0023470_1648_2919	380
16	3300048915	Ga0496112_0056312	Ga0496112_0056312_2562_3833	380
17	3300048917	Ga0496114_0002457	Ga0496114_0002457_6493_7764	380
18	3300048918	Ga0496115_0005151	Ga0496115_0005151_7344_8615	380
19	3300048909	Ga0496106_0003662	Ga0496106_0003662_9628_10899	381
20	3300009094	Ga0111539_10005066	Ga0111539_1000506612	382
21	3300037312	Ga0395899_0244141	Ga0395899_0244141_49_1203	382
22	3300050492	nmdc:mga0yw44_208360_c1	nmdc:mga0yw44_208360_c1_133_1281	382
23	3300050511	nmdc:mga08y16_9469_c1	nmdc:mga08y16_9469_c1_8003_9358	382
24	3300006847	Ga0075431_100000536	Ga0075431_10000053631	383
25	3300009147	Ga0114129_10006865	Ga0114129_1000686516	383
26	3300027907	Ga0207428_10021246	Ga0207428_100212464	383
27	3300050507	nmdc:mga05p37_43026_c1	nmdc:mga05p37_43026_c1_3108_4463	383
28	3300050510	nmdc:mga06r32_5859_c1	nmdc:mga06r32_5859_c1_9124_10479	383
29	3300005458	Ga0070681_10083373	Ga0070681_100833733	394
30	3300025912	Ga0207707_10072992	Ga0207707_100729922	394
31	3300037466	Ga0395898_0035326	Ga0395898_0035326_3767_4960	394
32	3300053084	Ga0495595_0001270	Ga0495595_0001270_58_1251	397
33	3300006871	Ga0075434_100001678	Ga0075434_10000167812	401
34	3300048915	Ga0496112_0085412	Ga0496112_0085412_1854_3077	401
35	3300050512	nmdc:mga0n895_41795_c1	nmdc:mga0n895_41795_c1_1821_3167	401
36	3300046461	Ga0495641_0076043	Ga0495641_0076043_216_1454	407
37	3300005718	Ga0068866_10032932	Ga0068866_100329324	410
38	3300013308	Ga0157375_10055094	Ga0157375_100550944	410
39	3300026121	Ga0207683_10106454	Ga0207683_101064542	410
40	3300048910	Ga0496107_0009590	Ga0496107_0009590_5263_6612	410
41	3300048917	Ga0496114_0024341	Ga0496114_0024341_3554_4903	410
42	3300005338	Ga0068868_100016195	Ga0068868_1000161956	411
43	3300005439	Ga0070711_100090241	Ga0070711_1000902412	411
44	3300006038	Ga0075365_10001932	Ga0075365_100019327	411
45	3300006175	Ga0070712_100019861	Ga0070712_1000198615	411
46	3300025915	Ga0207693_10005539	Ga0207693_100055393	411
47	3300025916	Ga0207663_10020039	Ga0207663_100200392	411
48	3300048903	Ga0496100_0003241	Ga0496100_0003241_279_1631	411
49	3300048904	Ga0496101_0002936	Ga0496101_0002936_2872_4224	411
50	3300048905	Ga0496102_0012047	Ga0496102_0012047_2296_3648	411
51	3300048908	Ga0496105_0062754	Ga0496105_0062754_582_1934	411
52	3300048914	Ga0496111_0011152	Ga0496111_0011152_1857_3209	411
53	3300048915	Ga0496112_0075670	Ga0496112_0075670_653_1990	411
54	3300050492	nmdc:mga0yw44_43697_c1	nmdc:mga0yw44_43697_c1_632_1981	411
55	3300013297	Ga0157378_10066419	Ga0157378_100664191	412
56	3300046536	Ga0495587_0019281	Ga0495587_0019281_1372_2688	412
57	3300005457	Ga0070662_100000004	Ga0070662_100000004158	413
58	3300025933	Ga0207706_10000012	Ga0207706_1000001260	413
59	3300026142	Ga0207698_10051367	Ga0207698_100513671	413
60	3300046455	Ga0495603_0001462	Ga0495603_0001462_2008_3324	413
61	3300006038	Ga0075365_10031523	Ga0075365_100315233	414
62	3300006051	Ga0075364_10006609	Ga0075364_100066097	414
63	3300028556	Ga0265337_1000807	Ga0265337_10008077	414
64	3300028558	Ga0265326_10000252	Ga0265326_100002526	414
65	3300028654	Ga0265322_10000001	Ga0265322_10000001378	414
66	3300028666	Ga0265336_10021526	Ga0265336_100215263	414
67	3300029957	Ga0265324_10000755	Ga0265324_100007556	414
68	3300031239	Ga0265328_10001094	Ga0265328_100010948	414
69	3300031240	Ga0265320_10000002	Ga0265320_10000002377	414
70	3300031242	Ga0265329_10010994	Ga0265329_100109943	414
71	3300031250	Ga0265331_10009837	Ga0265331_100098376	414
72	3300031251	Ga0265327_10000011	Ga0265327_10000011377	414
73	3300031711	Ga0265314_10000062	Ga0265314_10000062111	414
74	3300046684	Ga0495669_0018748	Ga0495669_0018748_864_2192	414
75	3300050491	nmdc:mga00v17_26204_c1	nmdc:mga00v17_26204_c1_978_2354	414
76	3300050492	nmdc:mga0yw44_20151_c1	nmdc:mga0yw44_20151_c1_788_2164	414
77	3300025921	Ga0207652_10015699	Ga0207652_100156998	415
78	3300032002	Ga0307416_100215792	Ga0307416_1002157921	415
79	3300045976	Ga0466967_0001283	Ga0466967_0001283_6759_8015	415
80	3300049585	Ga0501069_0044708	Ga0501069_0044708_440_1702	416
81	3300054114	Ga0501084_0051196	Ga0501084_0051196_434_1768	416
82	3300025929	Ga0207664_10024144	Ga0207664_100241444	417
83	3300005467	Ga0070706_100015559	Ga0070706_1000155591	419
84	3300006038	Ga0075365_10002660	Ga0075365_100026604	419
85	3300035170	Ga0373943_0077568	Ga0373943_0077568_228_1508	419
86	3300046499	Ga0495594_0061289	Ga0495594_0061289_357_1637	419
87	3300046689	Ga0495613_0090691	Ga0495613_0090691_530_1810	419
88	3300047315	Ga0495581_0013243	Ga0495581_0013243_108_1388	419
89	3300050492	nmdc:mga0yw44_11863_c1	nmdc:mga0yw44_11863_c1_2583_3932	419
90	3300005330	Ga0070690_100003538	Ga0070690_1000035383	420
91	3300005335	Ga0070666_10027363	Ga0070666_100273632	420
92	3300005338	Ga0068868_100013140	Ga0068868_1000131405	420
93	3300005345	Ga0070692_10020205	Ga0070692_100202053	420
94	3300005347	Ga0070668_100020258	Ga0070668_1000202583	420
95	3300005365	Ga0070688_100007428	Ga0070688_1000074284	420
96	3300005366	Ga0070659_100061011	Ga0070659_1000610114	420
97	3300005436	Ga0070713_100306158	Ga0070713_1003061581	420
98	3300005437	Ga0070710_10012125	Ga0070710_100121254	420
99	3300005441	Ga0070700_100003530	Ga0070700_1000035306	420
100	3300005444	Ga0070694_100024513	Ga0070694_1000245132	420
101	3300005456	Ga0070678_100001355	Ga0070678_10000135510	420
102	3300005466	Ga0070685_10122448	Ga0070685_101224482	420
103	3300005467	Ga0070706_100025446	Ga0070706_1000254462	420
104	3300005468	Ga0070707_100004648	Ga0070707_10000464811	420
105	3300005518	Ga0070699_100019861	Ga0070699_1000198613	420
106	3300005539	Ga0068853_100003775	Ga0068853_10000377511	420
107	3300005544	Ga0070686_100000601	Ga0070686_1000006014	420
108	3300005548	Ga0070665_100037770	Ga0070665_1000377705	420
109	3300005614	Ga0068856_100007081	Ga0068856_1000070819	420
110	3300005615	Ga0070702_100008617	Ga0070702_1000086175	420
111	3300005718	Ga0068866_10012660	Ga0068866_100126603	420
112	3300005843	Ga0068860_100075111	Ga0068860_1000751114	420
113	3300006175	Ga0070712_100021026	Ga0070712_1000210261	420
114	3300006237	Ga0097621_100005876	Ga0097621_1000058765	420
115	3300025899	Ga0207642_10004706	Ga0207642_100047062	420
116	3300025915	Ga0207693_10000778	Ga0207693_1000077825	420
117	3300025917	Ga0207660_10008386	Ga0207660_100083867	420
118	3300025927	Ga0207687_10040263	Ga0207687_100402631	420
119	3300025939	Ga0207665_10045813	Ga0207665_100458134	420
120	3300025940	Ga0207691_10015355	Ga0207691_100153556	420
121	3300025960	Ga0207651_10156507	Ga0207651_101565072	420
122	3300025961	Ga0207712_10003829	Ga0207712_100038299	420
123	3300026023	Ga0207677_10013068	Ga0207677_100130686	420
124	3300026075	Ga0207708_10000468	Ga0207708_100004685	420
125	3300026121	Ga0207683_10000041	Ga0207683_1000004171	420
126	3300038443	Ga0395901_0028296	Ga0395901_0028296_3051_4334	420
127	3300046474	Ga0495605_0049018	Ga0495605_0049018_482_1777	420
128	3300005337	Ga0070682_100045299	Ga0070682_1000452991	421
129	3300005364	Ga0070673_100183158	Ga0070673_1001831582	421
130	3300005543	Ga0070672_100031007	Ga0070672_1000310073	421
131	3300006871	Ga0075434_100155239	Ga0075434_1001552392	421
132	3300009147	Ga0114129_10166647	Ga0114129_101666473	421
133	3300009148	Ga0105243_10006240	Ga0105243_100062408	421
134	3300009177	Ga0105248_10071294	Ga0105248_100712942	421
135	3300010375	Ga0105239_10003834	Ga0105239_1000383411	421
136	3300013306	Ga0163162_10000583	Ga0163162_1000058327	421
137	3300013308	Ga0157375_10063321	Ga0157375_100633214	421
138	3300014969	Ga0157376_10005263	Ga0157376_100052635	421
139	3300025922	Ga0207646_10000865	Ga0207646_1000086542	421
140	3300026142	Ga0207698_10049913	Ga0207698_100499132	421
141	3300028577	Ga0265318_10000604	Ga0265318_1000060418	421
142	3300028653	Ga0265323_10006182	Ga0265323_100061824	421
143	3300031235	Ga0265330_10003122	Ga0265330_100031228	421
144	3300031239	Ga0265328_10000719	Ga0265328_100007197	421
145	3300031241	Ga0265325_10002559	Ga0265325_1000255910	421
146	3300031247	Ga0265340_10002638	Ga0265340_100026389	421
147	3300031250	Ga0265331_10007296	Ga0265331_100072966	421
148	3300031251	Ga0265327_10006079	Ga0265327_100060794	421
149	3300031344	Ga0265316_10002341	Ga0265316_100023418	421
150	3300031595	Ga0265313_10050483	Ga0265313_100504831	421
151	3300031711	Ga0265314_10012920	Ga0265314_100129204	421
152	3300037418	Ga0395900_0002249	Ga0395900_0002249_16304_17587	421
153	3300037471	Ga0395905_0004021	Ga0395905_0004021_8495_9778	421
154	3300038443	Ga0395901_0000809	Ga0395901_0000809_20058_21341	421
155	3300048904	Ga0496101_0013582	Ga0496101_0013582_182_1468	421
156	3300048906	Ga0496103_0001248	Ga0496103_0001248_15742_17028	421
157	3300048909	Ga0496106_0004801	Ga0496106_0004801_159_1445	421
158	3300048911	Ga0496108_0294858	Ga0496108_0294858_71_1354	421
159	3300048912	Ga0496109_0004424	Ga0496109_0004424_3593_4876	421
160	3300048912	Ga0496109_0004990	Ga0496109_0004990_9455_10741	421
161	3300048913	Ga0496110_0028592	Ga0496110_0028592_422_1705	421
162	3300048915	Ga0496112_0108075	Ga0496112_0108075_64_1347	421
163	3300048915	Ga0496112_0205549	Ga0496112_0205549_272_1558	421
164	3300048917	Ga0496114_0054067	Ga0496114_0054067_1634_2920	421
165	3300048918	Ga0496115_0057641	Ga0496115_0057641_212_1498	421
166	3300050512	nmdc:mga0n895_111605_c1	nmdc:mga0n895_111605_c1_381_1661	421
167	3300050512	nmdc:mga0n895_35202_c1	nmdc:mga0n895_35202_c1_3065_4345	421
168	3300005564	Ga0070664_100050508	Ga0070664_1000505083	422
169	3300046454	Ga0495592_0102659	Ga0495592_0102659_685_1956	423
170	3300046511	Ga0495608_0000060	Ga0495608_0000060_519_1862	423
171	3300046515	Ga0495620_0000824	Ga0495620_0000824_15818_17158	423
172	3300046675	Ga0495657_0000004	Ga0495657_0000004_178795_180138	423
173	3300047444	Ga0495675_0000842	Ga0495675_0000842_17364_18707	423
174	3300048917	Ga0496114_0012931	Ga0496114_0012931_50_1390	423
175	3300053084	Ga0495595_0000003	Ga0495595_0000003_178795_180138	423
176	3300053085	Ga0495619_0000116	Ga0495619_0000116_25562_26905	423
177	3300048907	Ga0496104_0000009	Ga0496104_0000009_294567_295922	424
178	3300048908	Ga0496105_0000007	Ga0496105_0000007_192134_193489	424
179	3300042876	Ga0451577_0000243	Ga0451577_0000243_17492_18790	425
180	3300044712	Ga0453684_0000804	Ga0453684_0000804_88113_89411	425
181	3300047322	Ga0495680_0000550	Ga0495680_0000550_31444_32787	426
182	3300025927	Ga0207687_10002226	Ga0207687_100022263	427
183	3300046455	Ga0495603_0081390	Ga0495603_0081390_21_1361	427
184	3300046535	Ga0495586_0071704	Ga0495586_0071704_16_1317	427
185	3300046678	Ga0495599_0018403	Ga0495599_0018403_525_1820	427
186	3300046681	Ga0495647_0000018	Ga0495647_0000018_80309_81646	427
187	3300053077	Ga0495601_0000855	Ga0495601_0000855_13929_15224	427
188	3300037466	Ga0395898_0088007	Ga0395898_0088007_204_1580	428
189	3300038443	Ga0395901_0085659	Ga0395901_0085659_776_2152	428
190	3300046476	Ga0495662_0094228	Ga0495662_0094228_105_1391	428
191	3300046642	Ga0495634_0132262	Ga0495634_0132262_290_1576	428
192	3300046690	Ga0495624_0002509	Ga0495624_0002509_4342_5682	428
193	3300048909	Ga0496106_0000151	Ga0496106_0000151_9523_10866	428
194	3300048914	Ga0496111_0094164	Ga0496111_0094164_790_2130	428
195	3300048915	Ga0496112_0067246	Ga0496112_0067246_200_1486	428
196	3300048916	Ga0496113_0000004	Ga0496113_0000004_541_1884	428
197	3300009176	Ga0105242_10000032	Ga0105242_1000003228	429
198	3300013308	Ga0157375_10037053	Ga0157375_100370535	429
199	3300025934	Ga0207686_10000048	Ga0207686_1000004828	429
200	3300046516	Ga0495628_0009655	Ga0495628_0009655_3618_4931	429
201	3300046517	Ga0495630_0139721	Ga0495630_0139721_444_1787	429
202	3300047317	Ga0495604_0000055	Ga0495604_0000055_60495_61838	429
203	3300048088	Ga0495602_0013815	Ga0495602_0013815_2320_3633	429
204	3300048919	Ga0496116_0000735	Ga0496116_0000735_12842_14161	429
205	3300048921	Ga0496118_0093077	Ga0496118_0093077_531_1850	429
206	3300048922	Ga0496119_0001290	Ga0496119_0001290_2065_3384	429
207	3300046694	Ga0495649_0008541	Ga0495649_0008541_96_1391	430
208	3300005356	Ga0070674_100000090	Ga0070674_10000009024	431
209	3300005718	Ga0068866_10000685	Ga0068866_100006853	431
210	3300005985	Ga0081539_10000246	Ga0081539_10000246113	431
211	3300025899	Ga0207642_10000281	Ga0207642_1000028117	431
212	3300025937	Ga0207669_10000096	Ga0207669_1000009625	431
213	3300046543	Ga0495645_0019986	Ga0495645_0019986_686_2002	431
214	3300048907	Ga0496104_0006952	Ga0496104_0006952_2431_3750	431
215	3300048908	Ga0496105_0000650	Ga0496105_0000650_1873_3192	431
216	3300048917	Ga0496114_0066853	Ga0496114_0066853_706_2016	431
217	3300005329	Ga0070683_100003109	Ga0070683_1000031094	432
218	3300005439	Ga0070711_100000734	Ga0070711_1000007345	432
219	3300005614	Ga0068856_100000629	Ga0068856_1000006297	432
220	3300009551	Ga0105238_10000011	Ga0105238_10000011217	432
221	3300017792	Ga0163161_10002086	Ga0163161_1000208610	432
222	3300025916	Ga0207663_10000498	Ga0207663_100004985	432
223	3300025924	Ga0207694_10000004	Ga0207694_10000004405	432
224	3300025944	Ga0207661_10011874	Ga0207661_100118744	432
225	3300026078	Ga0207702_10000158	Ga0207702_1000015871	432
226	3300028563	Ga0265319_1000020	Ga0265319_1000020140	432
227	3300028800	Ga0265338_10001248	Ga0265338_100012483	432
228	3300031241	Ga0265325_10027972	Ga0265325_100279722	432
229	3300046459	Ga0495629_0045971	Ga0495629_0045971_474_1805	432
230	3300046499	Ga0495594_0000029	Ga0495594_0000029_31924_33240	432
231	3300046511	Ga0495608_0000529	Ga0495608_0000529_22284_23627	432
232	3300046529	Ga0495652_0000407	Ga0495652_0000407_25121_26437	432
233	3300046557	Ga0495622_0000550	Ga0495622_0000550_20308_21624	432
234	3300047321	Ga0495676_0021340	Ga0495676_0021340_675_2006	432
235	3300048911	Ga0496108_0029134	Ga0496108_0029134_2234_3562	432
236	3300048912	Ga0496109_0121266	Ga0496109_0121266_82_1410	432
237	3300005329	Ga0070683_100012149	Ga0070683_1000121496	433
238	3300005841	Ga0068863_100000342	Ga0068863_10000034243	433
239	3300005985	Ga0081539_10019737	Ga0081539_100197374	433
240	3300006038	Ga0075365_10075182	Ga0075365_100751822	433
241	3300006051	Ga0075364_10013659	Ga0075364_100136595	433
242	3300006051	Ga0075364_10124272	Ga0075364_101242722	433
243	3300025944	Ga0207661_10000253	Ga0207661_1000025333	433
244	3300026088	Ga0207641_10000238	Ga0207641_1000023877	433
245	3300037853	Ga0436364_1554384	Ga0436364_1554384_157_1470	433
246	3300047319	Ga0495674_0112482	Ga0495674_0112482_746_2056	433
247	3300048913	Ga0496110_0004679	Ga0496110_0004679_7401_8711	433
248	3300050492	nmdc:mga0yw44_62154_c1	nmdc:mga0yw44_62154_c1_371_1705	433
249	3300053077	Ga0495601_0167943	Ga0495601_0167943_78_1388	433
250	3300053078	Ga0495612_0000164	Ga0495612_0000164_20197_21507	433
251	3300053085	Ga0495619_0001204	Ga0495619_0001204_10987_12303	433
252	3300005333	Ga0070677_10000022	Ga0070677_1000002235	434
253	3300005337	Ga0070682_100000099	Ga0070682_10000009988	434
254	3300005338	Ga0068868_100000450	Ga0068868_10000045015	434
255	3300005341	Ga0070691_10000379	Ga0070691_1000037911	434
256	3300005530	Ga0070679_100000243	Ga0070679_1000002432	434
257	3300005548	Ga0070665_100000106	Ga0070665_10000010616	434
258	3300005718	Ga0068866_10087580	Ga0068866_100875802	434
259	3300005719	Ga0068861_100139096	Ga0068861_1001390962	434
260	3300005842	Ga0068858_100000009	Ga0068858_100000009171	434
261	3300006173	Ga0070716_100031197	Ga0070716_1000311973	434
262	3300006237	Ga0097621_100136682	Ga0097621_1001366822	434
263	3300009098	Ga0105245_10000020	Ga0105245_1000002015	434
264	3300009553	Ga0105249_10000080	Ga0105249_1000008038	434
265	3300014968	Ga0157379_10003159	Ga0157379_1000315914	434
266	3300025893	Ga0207682_10000005	Ga0207682_1000000544	434
267	3300025921	Ga0207652_10002027	Ga0207652_1000202717	434
268	3300025927	Ga0207687_10000013	Ga0207687_1000001357	434
269	3300025939	Ga0207665_10044289	Ga0207665_100442893	434
270	3300025961	Ga0207712_10000007	Ga0207712_10000007431	434
271	3300025981	Ga0207640_10003186	Ga0207640_100031866	434
272	3300026023	Ga0207677_10000200	Ga0207677_1000020033	434
273	3300026035	Ga0207703_10000023	Ga0207703_1000002378	434
274	3300026041	Ga0207639_10108827	Ga0207639_101088271	434
275	3300026078	Ga0207702_10004125	Ga0207702_1000412514	434
276	3300026118	Ga0207675_100160408	Ga0207675_1001604082	434
277	3300028379	Ga0268266_10000047	Ga0268266_10000047168	434
278	3300037418	Ga0395900_0014396	Ga0395900_0014396_4500_5843	434
279	3300037466	Ga0395898_0001408	Ga0395898_0001408_6448_7791	434
280	3300038443	Ga0395901_0004783	Ga0395901_0004783_5777_7120	434
281	3300046461	Ga0495641_0000228	Ga0495641_0000228_12844_14190	434
282	3300046516	Ga0495628_0041865	Ga0495628_0041865_105_1430	434
283	3300046517	Ga0495630_0000020	Ga0495630_0000020_90940_92271	434
284	3300046529	Ga0495652_0045375	Ga0495652_0045375_1946_3271	434
285	3300046543	Ga0495645_0006445	Ga0495645_0006445_6565_7890	434
286	3300046559	Ga0495667_0000018	Ga0495667_0000018_66742_68055	434
287	3300046681	Ga0495647_0000156	Ga0495647_0000156_12976_14304	434
288	3300046684	Ga0495669_0014521	Ga0495669_0014521_1986_3302	434
289	3300046689	Ga0495613_0071867	Ga0495613_0071867_650_1984	434
290	3300046690	Ga0495624_0000647	Ga0495624_0000647_8679_10007	434
291	3300047319	Ga0495674_0000064	Ga0495674_0000064_42353_43666	434
292	3300047321	Ga0495676_0117044	Ga0495676_0117044_558_1886	434
293	3300047322	Ga0495680_0003958	Ga0495680_0003958_4339_5679	434
294	3300047322	Ga0495680_0004286	Ga0495680_0004286_3316_4629	434
295	3300047446	Ga0495679_010145	Ga0495679_010145_667_2007	434
296	3300048903	Ga0496100_0000002	Ga0496100_0000002_436277_437593	434
297	3300048904	Ga0496101_0000001	Ga0496101_0000001_436277_437593	434
298	3300048909	Ga0496106_0000084	Ga0496106_0000084_51437_52753	434
299	3300048910	Ga0496107_0000003	Ga0496107_0000003_85020_86336	434
300	3300048910	Ga0496107_0006797	Ga0496107_0006797_4985_6343	434
301	3300048911	Ga0496108_0000001	Ga0496108_0000001_731776_733092	434
302	3300048912	Ga0496109_0000003	Ga0496109_0000003_406322_407638	434
303	3300048915	Ga0496112_0000006	Ga0496112_0000006_277989_279305	434
304	3300048917	Ga0496114_0000101	Ga0496114_0000101_24436_25746	434
305	3300048918	Ga0496115_0000200	Ga0496115_0000200_30010_31320	434
306	3300050512	nmdc:mga0n895_55001_c1	nmdc:mga0n895_55001_c1_488_1846	434
307	3300005456	Ga0070678_100142066	Ga0070678_1001420662	435
308	3300006163	Ga0070715_10000001	Ga0070715_10000001388	435
309	3300009098	Ga0105245_10010405	Ga0105245_100104058	435
310	3300013296	Ga0157374_10001772	Ga0157374_100017727	435
311	3300025905	Ga0207685_10000027	Ga0207685_1000002781	435
312	3300025927	Ga0207687_10005882	Ga0207687_100058823	435
313	3300026121	Ga0207683_10181464	Ga0207683_101814642	435
314	3300044694	Ga0466963_0000153	Ga0466963_0000153_7032_8348	435
315	3300046473	Ga0495582_0000081	Ga0495582_0000081_47156_48496	435
316	3300046514	Ga0495618_0000008	Ga0495618_0000008_8581_9921	435
317	3300046516	Ga0495628_0122216	Ga0495628_0122216_541_1881	435
318	3300046642	Ga0495634_0015499	Ga0495634_0015499_3072_4391	435
319	3300046663	Ga0495635_0000044	Ga0495635_0000044_82507_83847	435
320	3300046675	Ga0495657_0051214	Ga0495657_0051214_531_1871	435
321	3300046683	Ga0495658_0000034	Ga0495658_0000034_49656_50996	435
322	3300046689	Ga0495613_0004320	Ga0495613_0004320_5723_7063	435
323	3300046690	Ga0495624_0088870	Ga0495624_0088870_22_1362	435
324	3300046809	Ga0495600_0099031	Ga0495600_0099031_68_1408	435
325	3300047321	Ga0495676_0000130	Ga0495676_0000130_22285_23601	435
326	3300048903	Ga0496100_0000005	Ga0496100_0000005_271460_272776	435
327	3300048904	Ga0496101_0000101	Ga0496101_0000101_58278_59594	435
328	3300048905	Ga0496102_0000115	Ga0496102_0000115_100130_101461	435
329	3300048906	Ga0496103_0000008	Ga0496103_0000008_107155_108486	435
330	3300048909	Ga0496106_0000682	Ga0496106_0000682_9653_10969	435
331	3300048910	Ga0496107_0000011	Ga0496107_0000011_39107_40423	435
332	3300048913	Ga0496110_0000021	Ga0496110_0000021_2866_4206	435
333	3300048914	Ga0496111_0000009	Ga0496111_0000009_72895_74235	435
334	3300049586	Ga0501070_0085465	Ga0501070_0085465_447_1766	435
335	3300053083	Ga0495655_0000001	Ga0495655_0000001_293440_294771	435
336	3300053129	Ga0500628_000033	Ga0500628_000033_45471_46802	435
337	3300005329	Ga0070683_100016966	Ga0070683_1000169666	436
338	3300005337	Ga0070682_100040412	Ga0070682_1000404122	436
339	3300005339	Ga0070660_100105097	Ga0070660_1001050972	436
340	3300005344	Ga0070661_100157146	Ga0070661_1001571462	436
341	3300005356	Ga0070674_100000683	Ga0070674_1000006836	436
342	3300005365	Ga0070688_100003810	Ga0070688_1000038107	436
343	3300005438	Ga0070701_10008254	Ga0070701_100082545	436
344	3300005441	Ga0070700_100003961	Ga0070700_1000039615	436
345	3300005455	Ga0070663_100010392	Ga0070663_1000103922	436
346	3300005466	Ga0070685_10000141	Ga0070685_1000014148	436
347	3300005466	Ga0070685_10035052	Ga0070685_100350523	436
348	3300005535	Ga0070684_100042950	Ga0070684_1000429503	436
349	3300005548	Ga0070665_100124655	Ga0070665_1001246553	436
350	3300005564	Ga0070664_100033040	Ga0070664_1000330404	436
351	3300005578	Ga0068854_100000156	Ga0068854_10000015647	436
352	3300005614	Ga0068856_100009027	Ga0068856_1000090276	436
353	3300005616	Ga0068852_100000006	Ga0068852_100000006142	436
354	3300005718	Ga0068866_10000001	Ga0068866_10000001421	436
355	3300005719	Ga0068861_100025203	Ga0068861_1000252035	436
356	3300005834	Ga0068851_10001416	Ga0068851_100014167	436
357	3300005937	Ga0081455_10007955	Ga0081455_100079557	436
358	3300006038	Ga0075365_10007452	Ga0075365_100074526	436
359	3300006048	Ga0075363_100077146	Ga0075363_1000771462	436
360	3300006051	Ga0075364_10009364	Ga0075364_100093642	436
361	3300009098	Ga0105245_10000254	Ga0105245_1000025412	436
362	3300009098	Ga0105245_10019458	Ga0105245_100194585	436
363	3300009551	Ga0105238_10166005	Ga0105238_101660052	436
364	3300010375	Ga0105239_10152616	Ga0105239_101526162	436
365	3300010375	Ga0105239_10184946	Ga0105239_101849463	436
366	3300013105	Ga0157369_10000020	Ga0157369_10000020183	436
367	3300013307	Ga0157372_10000112	Ga0157372_1000011242	436
368	3300025899	Ga0207642_10000002	Ga0207642_10000002140	436
369	3300025901	Ga0207688_10046442	Ga0207688_100464422	436
370	3300025919	Ga0207657_10009635	Ga0207657_100096359	436
371	3300025926	Ga0207659_10059348	Ga0207659_100593482	436
372	3300025927	Ga0207687_10000007	Ga0207687_10000007438	436
373	3300025927	Ga0207687_10066105	Ga0207687_100661051	436
374	3300025927	Ga0207687_10084410	Ga0207687_100844102	436
375	3300025937	Ga0207669_10000018	Ga0207669_100000186	436
376	3300025937	Ga0207669_10093578	Ga0207669_100935782	436
377	3300025938	Ga0207704_10000159	Ga0207704_1000015921	436
378	3300025940	Ga0207691_10005986	Ga0207691_1000598610	436
379	3300025941	Ga0207711_10000006	Ga0207711_10000006696	436
380	3300025945	Ga0207679_10208271	Ga0207679_102082712	436
381	3300025981	Ga0207640_10000038	Ga0207640_1000003846	436
382	3300026075	Ga0207708_10005074	Ga0207708_100050749	436
383	3300026078	Ga0207702_10074400	Ga0207702_100744003	436
384	3300026116	Ga0207674_10238110	Ga0207674_102381101	436
385	3300026118	Ga0207675_100050607	Ga0207675_1000506073	436
386	3300026142	Ga0207698_10000013	Ga0207698_1000001347	436
387	3300028379	Ga0268266_10109698	Ga0268266_101096983	436
388	3300028380	Ga0268265_10255098	Ga0268265_102550982	436
389	3300031728	Ga0316578_10024138	Ga0316578_100241384	436
390	3300044842	Ga0466957_0044462	Ga0466957_0044462_877_2214	436
391	3300045836	Ga0466958_0030687	Ga0466958_0030687_24_1367	436
392	3300045976	Ga0466967_0000009	Ga0466967_0000009_117916_119253	436
393	3300046675	Ga0495657_0022928	Ga0495657_0022928_377_1711	436
394	3300048909	Ga0496106_0109106	Ga0496106_0109106_714_2063	436
395	3300048911	Ga0496108_0000175	Ga0496108_0000175_3440_4783	436
396	3300048911	Ga0496108_0070281	Ga0496108_0070281_744_2093	436
397	3300048912	Ga0496109_0000121	Ga0496109_0000121_3432_4775	436
398	3300048912	Ga0496109_0013347	Ga0496109_0013347_244_1593	436
399	3300048918	Ga0496115_0000003	Ga0496115_0000003_110806_112122	436
400	3300050491	nmdc:mga00v17_77461_c1	nmdc:mga00v17_77461_c1_313_1662	436
401	3300053077	Ga0495601_0073067	Ga0495601_0073067_157_1491	436
402	3300053085	Ga0495619_0000131	Ga0495619_0000131_540_1883	436
403	3300053085	Ga0495619_0003131	Ga0495619_0003131_5044_6378	436
404	3300001979	JGI24740J21852_10003186	JGI24740J21852_100031868	437
405	3300005327	Ga0070658_10017126	Ga0070658_100171265	437
406	3300005329	Ga0070683_100012949	Ga0070683_1000129497	437
407	3300005344	Ga0070661_100000102	Ga0070661_10000010221	437
408	3300005354	Ga0070675_100000027	Ga0070675_10000002741	437
409	3300005364	Ga0070673_100005169	Ga0070673_1000051698	437
410	3300005365	Ga0070688_100000738	Ga0070688_10000073813	437
411	3300005459	Ga0068867_100000796	Ga0068867_1000007966	437
412	3300005466	Ga0070685_10000616	Ga0070685_1000061619	437
413	3300005548	Ga0070665_100000950	Ga0070665_10000095031	437
414	3300005564	Ga0070664_100168855	Ga0070664_1001688552	437
415	3300005718	Ga0068866_10057774	Ga0068866_100577742	437
416	3300005983	Ga0081540_1000449	Ga0081540_100044937	437
417	3300009148	Ga0105243_10012846	Ga0105243_100128462	437
418	3300009176	Ga0105242_10000454	Ga0105242_100004547	437
419	3300013308	Ga0157375_10064237	Ga0157375_100642372	437
420	3300025900	Ga0207710_10000458	Ga0207710_1000045810	437
421	3300025904	Ga0207647_10096381	Ga0207647_100963812	437
422	3300025909	Ga0207705_10032908	Ga0207705_100329084	437
423	3300025915	Ga0207693_10015289	Ga0207693_100152895	437
424	3300025920	Ga0207649_10000009	Ga0207649_10000009231	437
425	3300025926	Ga0207659_10000010	Ga0207659_1000001058	437
426	3300025928	Ga0207700_10000027	Ga0207700_1000002748	437
427	3300025934	Ga0207686_10000447	Ga0207686_1000044714	437
428	3300025935	Ga0207709_10029668	Ga0207709_100296682	437
429	3300025944	Ga0207661_10000347	Ga0207661_1000034732	437
430	3300025960	Ga0207651_10033652	Ga0207651_100336522	437
431	3300026089	Ga0207648_10008647	Ga0207648_100086476	437
432	3300026121	Ga0207683_10004283	Ga0207683_100042834	437
433	3300028379	Ga0268266_10006385	Ga0268266_100063855	437
434	3300046459	Ga0495629_0003113	Ga0495629_0003113_4663_6003	437
435	3300046507	Ga0495606_0000072	Ga0495606_0000072_19792_21132	437
436	3300046674	Ga0495588_0000134	Ga0495588_0000134_22237_23574	437
437	3300046689	Ga0495613_0000801	Ga0495613_0000801_19713_21062	437
438	3300047317	Ga0495604_0000137	Ga0495604_0000137_56601_57947	437
439	3300047317	Ga0495604_0009878	Ga0495604_0009878_1491_2834	437
440	3300048088	Ga0495602_0000041	Ga0495602_0000041_70066_71409	437
441	3300048907	Ga0496104_0000004	Ga0496104_0000004_355630_356943	437
442	3300048908	Ga0496105_0000001	Ga0496105_0000001_284888_286201	437
443	3300048912	Ga0496109_0000249	Ga0496109_0000249_36860_38200	437
444	3300048914	Ga0496111_0019839	Ga0496111_0019839_2084_3424	437
445	3300048922	Ga0496119_0029762	Ga0496119_0029762_551_1864	437
446	3300053078	Ga0495612_0006025	Ga0495612_0006025_417_1757	437

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

48

400

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6c3i-assembly2.cif.gz_B	crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state	0.9501	46	437
8e5v-assembly1.cif.gz_A	x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state	0.9496	45	437
6c3i-assembly1.cif.gz_A	crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state	0.9479	46	437
8e5v-assembly1.cif.gz_A	x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state	0.9473	45	437
8e6h-assembly1.cif.gz_A	x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter a47w mutant in an occluded, manganese-bound state	0.9459	45	437

ID	Description	Score	Start	End	Superfamily
af_P0A769_38_384_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9489	61	410	1.20.1740.10
af_P0A769_38_384_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9436	61	410	1.20.1740.10
af_Q2G2G3_53_420_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9338	61	409	1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9217	61	410	1.20.1740.10
af_Q653V6_68_493_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9193	59	435	1.20.1740.10

ID	Description	Score	Start	End	GO Terms
AF-A0A6N7ZNB7-F1-model_v4	Divalent metal cation transporter	0.9519	34	399	GO:0005384 GO:0005886 GO:0012505 GO:0015086 GO:0034755
AF-A0A0F2JGB0-F1-model_v4	Manganese transport protein MntH	0.9487	85	435	GO:0005384 GO:0005886 GO:0012505 GO:0015086 GO:0034755
AF-A0A0X3AN95-F1-model_v4	Divalent metal cation transporter MntH	0.9365	35	433	GO:0005384 GO:0005886 GO:0012505 GO:0015086 GO:0015293 GO:0034755 GO:0046872
AF-A0A2Z6TAC0-F1-model_v4	deleted	0.9365	33	434
AF-A0A522QGR2-F1-model_v4	Divalent metal cation transporter MntH	0.936	34	434	GO:0005384 GO:0005886 GO:0012505 GO:0015086 GO:0015293 GO:0034755 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
79.07	0.82	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445789

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01566

Nramp

Natural resistance-associated macrophage protein-like

48

400

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map