F445781

General Info

Members Datasets Scaffolds Average Seq Length
446 312 305 248

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0152794|Ga0451576_0152794_489_1328
Length 279
Sequence MGANSLEYDQEFGGRVGVEISGRIGKMTEKKTVLITGAGGGIGRACVQHFSKKGWRVIGVDRSDFGDDFPKDGRFIQADISHPDSAEEIFKHARGFTSTLDALVNNAAVQVAKPLVETTVEEWDAVMASNLRSVFLFVKLAHPLMKAAGSGAIVNVSSVHAIQTSANIAAYAASKGGLLALTRAMAIEFAADNIRANAILPGAVDTPMLRAGLSRGHVGGSDMQERLDNLAKKTVNGKVGRPEEIASAVYFLADNEQSSFMTGQALVVDGGATARLSTE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
10 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
11 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
12 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
13 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
14 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
15 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
16 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
17 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
18 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
19 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
20 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
21 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
22 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
23 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
24 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
25 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
26 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
27 2643221582 Rhizobium sp. Root651 Isolate Unclassified
28 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
29 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
30 2643221723 Ensifer sp. Root278 Isolate Unclassified
31 2718218365 Rhizobium sp. N731 Isolate Nodule
32 2728369397 Rhizobium sp. N1314 Isolate Nodule
33 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
34 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
35 2773857925 Microvirga vignae BR3299 Isolate Unclassified
36 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
37 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
38 2791355261 Rhizobium sp. J15 Isolate Nodule
39 2791355265 Rhizobium sp. H4 Isolate Nodule
40 2791355266 Rhizobium sp. L43 Isolate Nodule
41 2802429633 Rhizobium anhuiense J3 Isolate Nodule
42 2802429634 Rhizobium anhuiense S10 Isolate Nodule
43 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
44 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
45 2802429637 Rhizobium anhuiense C15 Isolate Nodule
46 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
47 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
48 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
49 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
50 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
51 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
52 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
53 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
54 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
55 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
56 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
57 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
58 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
59 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
60 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
61 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
62 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
63 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
64 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
65 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
66 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
67 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
68 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
69 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
70 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
71 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
72 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
73 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
74 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
75 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
76 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
77 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
78 2936381700 Rhizobium chutanense C16 Isolate Unclassified
79 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
80 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
81 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
82 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
83 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
84 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
85 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
86 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
87 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
88 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
89 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
90 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
91 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
92 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
93 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
94 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
95 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
96 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
97 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
98 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
99 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
100 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
101 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
102 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
103 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
104 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
105 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
106 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
107 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
108 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
109 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
110 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
111 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
112 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
113 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
114 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
115 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
116 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
117 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
118 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
119 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
120 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
121 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
122 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
123 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
124 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
125 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
126 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
127 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
128 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
129 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
130 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
131 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
132 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
133 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
134 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
135 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
136 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
137 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
138 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
139 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
140 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
141 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
142 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
143 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
144 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
145 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
146 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
147 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
148 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
149 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
150 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
151 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
152 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
153 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
154 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
155 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
156 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
157 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
158 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
159 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
160 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
161 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
162 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
163 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
164 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
165 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
166 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
167 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
168 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
169 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
170 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
171 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
172 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
173 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
174 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
175 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
176 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
177 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
178 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
179 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
180 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
181 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
182 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
183 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
184 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
185 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
186 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
187 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
188 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
189 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
190 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
191 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
192 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
195 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
196 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
197 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
233 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
234 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
239 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
240 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
241 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
242 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
243 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
244 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
247 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
286 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
287 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
288 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
289 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
302 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
303 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
307 8005395548 Rhizobium sp. R339 Isolate Nodule
308 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
309 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
310 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
311 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
312 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.39
Metatranscriptomes 0
Isolates 31.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.31
Nodule 27.58
Rhizoplane 2.02
Rhizosphere 52.69
Stem 0
Stem Tuber 0
Unclassified 7.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_134543 2162886007 Bacteria 3387
2 SwRhRL2b_contig_3384074 2162886007 Bacteria 3300
3 JGI25165J46597_1000276 3300003214 Bacteria 66076
4 JGI25153J46596_10002963 3300003215 Bacteria 9618
5 rootH2_10150611 3300003320 Bacteria 5362
6 Ga0055524_1001595 3300003775 Bacteria 12719
7 Ga0055536_1039835 3300003781 Bacteria 1124
8 Ga0055528_1000496 3300003790 Bacteria 31066
9 Ga0055540_1000077 3300003792 Bacteria 114283
10 Ga0055540_1000095 3300003792 Bacteria 97555
11 Ga0055531_10001938 3300003794 Bacteria 14455
12 Ga0055531_10006174 3300003794 Bacteria 6851
13 Ga0065704_10000545 3300005289 Bacteria 21648
14 Ga0065704_10096964 3300005289 Bacteria 2415
15 Ga0065707_10003358 3300005295 Bacteria 4001
16 Ga0065707_10082082 3300005295 Bacteria 22476
17 Ga0065707_10086992 3300005295 Bacteria 5213
18 Ga0065707_10093019 3300005295 Unclassified 3686
19 Ga0070658_10087523 3300005327 Unclassified 2564
20 Ga0070680_100651903 3300005336 Unclassified 905
21 Ga0070689_100003812 3300005340 Bacteria 10101
22 Ga0070689_100314317 3300005340 Bacteria 1307
23 Ga0070668_100159273 3300005347 Bacteria 1831
24 Ga0070705_100068880 3300005440 Bacteria 2131
25 Ga0070705_100097430 3300005440 Unclassified 1849
26 Ga0070700_100012627 3300005441 Bacteria 4722
27 Ga0070694_100017812 3300005444 Bacteria 4493
28 Ga0070694_100094885 3300005444 Unclassified 2100
29 Ga0070694_100147937 3300005444 Bacteria 1712
30 Ga0070707_100132121 3300005468 Bacteria 2428
31 Ga0070698_100033902 3300005471 Bacteria 5288
32 Ga0070699_100012037 3300005518 Bacteria 7469
33 Ga0070699_100027856 3300005518 Unclassified 4873
34 Ga0070699_100221165 3300005518 Bacteria 1687
35 Ga0070697_100100273 3300005536 Bacteria 2405
36 Ga0070697_100246415 3300005536 Bacteria 1527
37 Ga0070697_100314105 3300005536 Bacteria 1349
38 Ga0070686_100073194 3300005544 Bacteria 2249
39 Ga0070696_100670418 3300005546 Unclassified 843
40 Ga0070704_100142614 3300005549 Bacteria 1873
41 Ga0068855_100004220 3300005563 Bacteria 17542
42 Ga0068857_100144797 3300005577 Bacteria 2150
43 Ga0068859_100036786 3300005617 Bacteria 4914
44 Ga0068859_100064405 3300005617 Bacteria 3698
45 Ga0068859_100116523 3300005617 Bacteria 2736
46 Ga0068859_100552625 3300005617 Bacteria 1246
47 Ga0068858_100001349 3300005842 Bacteria 25309
48 Ga0068860_100021029 3300005843 Bacteria 6321
49 Ga0068862_100061656 3300005844 Bacteria 3224
50 Ga0068862_100321822 3300005844 Bacteria 1428
51 Ga0081539_10000859 3300005985 Bacteria 58193
52 Ga0081539_10005055 3300005985 Bacteria 13849
53 Ga0075365_10225182 3300006038 Bacteria 1316
54 Ga0075362_10000763 3300006177 Bacteria 9576
55 Ga0075367_10023659 3300006178 Bacteria 3459
56 Ga0075369_10000669 3300006186 Bacteria 10916
57 Ga0075366_10001056 3300006195 Bacteria 13511
58 Ga0075370_10172522 3300006353 Bacteria 1271
59 Ga0075428_100078235 3300006844 Bacteria 3610
60 Ga0075428_100098958 3300006844 Unclassified 3180
61 Ga0075428_100220064 3300006844 Bacteria 2050
62 Ga0075428_100359003 3300006844 Bacteria 1563
63 Ga0075430_100291467 3300006846 Bacteria 1350
64 Ga0075430_100361033 3300006846 Bacteria 1199
65 Ga0075431_100217804 3300006847 Bacteria 1948
66 Ga0075431_100657262 3300006847 Unclassified 1028
67 Ga0075434_100027694 3300006871 Bacteria 5565
68 Ga0075429_100008920 3300006880 Bacteria 8716
69 Ga0075429_100027464 3300006880 Unclassified 4941
70 Ga0075429_100172171 3300006880 Bacteria 1896
71 Ga0075429_100256034 3300006880 Bacteria 1532
72 Ga0097620_100036784 3300006931 Bacteria 4914
73 Ga0097620_100064405 3300006931 Bacteria 3698
74 Ga0097620_100116516 3300006931 Bacteria 2736
75 Ga0097620_100552632 3300006931 Bacteria 1246
76 Ga0105251_10000038 3300009011 Bacteria 116060
77 Ga0105240_10014809 3300009093 Bacteria 10629
78 Ga0105240_10128732 3300009093 Bacteria 3039
79 Ga0105240_10314520 3300009093 Unclassified 1787
80 Ga0111539_10092543 3300009094 Bacteria 3553
81 Ga0111539_10501965 3300009094 Bacteria 1413
82 Ga0114129_10001366 3300009147 Bacteria 32807
83 Ga0114129_10009931 3300009147 Bacteria 13567
84 Ga0114129_10015137 3300009147 Bacteria 10979
85 Ga0114129_10494722 3300009147 Bacteria 1598
86 Ga0105243_10263093 3300009148 Bacteria 1545
87 Ga0105248_10036537 3300009177 Bacteria 5495
88 Ga0105237_10004469 3300009545 Bacteria 16167
89 Ga0105239_10000524 3300010375 Bacteria 55447
90 Ga0157371_10391092 3300013102 Bacteria 1016
91 Ga0157378_10285884 3300013297 Bacteria 1591
92 Ga0209437_100023 3300025233 Bacteria 614195
93 Ga0207425_1002543 3300025245 Bacteria 6352
94 Ga0209129_1000917 3300025258 Bacteria 18018
95 Ga0209233_1000062 3300025261 Bacteria 399685
96 Ga0209673_1000294 3300025273 Bacteria 93050
97 Ga0209673_1000921 3300025273 Bacteria 37249
98 Ga0209676_1001179 3300025292 Bacteria 28285
99 Ga0209676_1002471 3300025292 Bacteria 13041
100 Ga0209676_1031254 3300025292 Bacteria 1618
101 Ga0209025_1000260 3300025294 Bacteria 124240
102 Ga0209025_1001911 3300025294 Bacteria 24216
103 Ga0209564_1000341 3300025295 Bacteria 89262
104 Ga0209564_1001129 3300025295 Bacteria 31419
105 Ga0209758_1001982 3300025297 Bacteria 22133
106 Ga0209050_1009398 3300025298 Bacteria 5011
107 Ga0209256_1000719 3300025299 Bacteria 43868
108 Ga0209256_1003376 3300025299 Bacteria 11297
109 Ga0207426_1001199 3300025302 Bacteria 23041
110 Ga0209051_1000027 3300025303 Bacteria 412172
111 Ga0209051_1000534 3300025303 Bacteria 46804
112 Ga0209257_1000245 3300025304 Bacteria 125987
113 Ga0209257_1000599 3300025304 Bacteria 59865
114 Ga0209257_1015356 3300025304 Bacteria 3195
115 Ga0207655_1012261 3300025728 Bacteria 5026
116 Ga0207713_1000185 3300025735 Bacteria 88697
117 Ga0207695_10224810 3300025913 Unclassified 1783
118 Ga0207671_10005075 3300025914 Bacteria 12297
119 Ga0207662_10063825 3300025918 Unclassified 2215
120 Ga0207662_10261560 3300025918 Bacteria 1139
121 Ga0207694_10330809 3300025924 Bacteria 1259
122 Ga0207670_10035859 3300025936 Bacteria 3221
123 Ga0207667_10007813 3300025949 Bacteria 12784
124 Ga0207640_10036504 3300025981 Bacteria 3086
125 Ga0207677_10695519 3300026023 Bacteria 902
126 Ga0207703_10001781 3300026035 Bacteria 19226
127 Ga0207708_10025007 3300026075 Bacteria 4517
128 Ga0268265_10039773 3300028380 Bacteria 3468
129 Ga0268265_10129323 3300028380 Bacteria 2096
130 Ga0268265_10269229 3300028380 Bacteria 1519
131 Ga0268264_10045555 3300028381 Unclassified 3641
132 Ga0265320_10172407 3300031240 Bacteria 972
133 Ga0307408_100526194 3300031548 Bacteria 1039
134 Ga0307408_100669895 3300031548 Bacteria 929
135 Ga0307408_100701813 3300031548 Bacteria 909
136 Ga0316575_10030218 3300031665 Bacteria 2117
137 Ga0316579_10037271 3300031691 Bacteria 2246
138 Ga0307405_10007380 3300031731 Bacteria 5492
139 Ga0307405_10288282 3300031731 Bacteria 1239
140 Ga0316577_10014388 3300031733 Bacteria 4342
141 Ga0307413_10155014 3300031824 Bacteria 1601
142 Ga0307413_10256614 3300031824 Bacteria 1300
143 Ga0307410_10036117 3300031852 Bacteria 3214
144 Ga0307410_10040220 3300031852 Bacteria 3076
145 Ga0307410_10227382 3300031852 Bacteria 1438
146 Ga0307410_10249059 3300031852 Bacteria 1380
147 Ga0307410_10313642 3300031852 Bacteria 1242
148 Ga0307406_10026720 3300031901 Bacteria 3470
149 Ga0307407_10059866 3300031903 Bacteria 2220
150 Ga0307407_10360166 3300031903 Bacteria 1032
151 Ga0307412_10011597 3300031911 Bacteria 5110
152 Ga0307409_100076039 3300031995 Bacteria 2691
153 Ga0307409_100760698 3300031995 Bacteria 973
154 Ga0307416_100102310 3300032002 Bacteria 2497
155 Ga0307416_100190254 3300032002 Bacteria 1934
156 Ga0307416_100383972 3300032002 Bacteria 1436
157 Ga0307414_10096947 3300032004 Bacteria 2208
158 Ga0307414_10305458 3300032004 Bacteria 1348
159 Ga0307414_10451235 3300032004 Bacteria 1128
160 Ga0307411_10082549 3300032005 Bacteria 2217
161 Ga0307411_10248149 3300032005 Bacteria 1398
162 Ga0307415_100055017 3300032126 Bacteria 2720
163 Ga0307415_100055974 3300032126 Bacteria 2702
164 Ga0316585_10090239 3300032137 Bacteria 1001
165 Ga0316582_0029866 3300036647 Bacteria 3314
166 Ga0316582_0250420 3300036647 Bacteria 1214
167 Ga0316584_0006146 3300036712 Archaea 8123
168 Ga0316584_0024133 3300036712 Bacteria 4448
169 Ga0316584_0087737 3300036712 Archaea 2329
170 Ga0316584_0217616 3300036712 Bacteria 1404
171 Ga0395900_0344698 3300037418 Bacteria 1464
172 Ga0395898_0064324 3300037466 Bacteria 3557
173 Ga0395898_0195577 3300037466 Unclassified 1932
174 Ga0395905_0006922 3300037471 Bacteria 11333
175 Ga0316581_0020351 3300037588 Bacteria 1943
176 Ga0436363_1345356 3300039450 Bacteria 833
177 Ga0451800_0401769 3300041459 Bacteria 1838
178 Ga0451833_0068607 3300041491 Bacteria 1438
179 Ga0451837_0730833 3300041494 Bacteria 2983
180 Ga0451841_0461209 3300041498 Bacteria 2636
181 Ga0451845_0024217 3300041501 Bacteria 4537
182 Ga0451851_0778015 3300041507 Bacteria 4382
183 Ga0451843_0169011 3300041509 Bacteria 1498
184 Ga0451843_0980372 3300041509 Bacteria 1426
185 Ga0451577_0008588 3300042876 Bacteria 9932
186 Ga0451577_0037050 3300042876 Unclassified 4391
187 Ga0451577_0043839 3300042876 Bacteria 4005
188 Ga0451577_0052914 3300042876 Bacteria 3626
189 Ga0451577_0102919 3300042876 Bacteria 2552
190 Ga0451577_0285800 3300042876 Bacteria 1494
191 Ga0451577_0340988 3300042876 Bacteria 1359
192 Ga0451577_0349805 3300042876 Unclassified 1341
193 Ga0451577_0582793 3300042876 Bacteria 1015
194 Ga0453683_0000731 3300044673 Bacteria 33613
195 Ga0453683_0001275 3300044673 Bacteria 22350
196 Ga0453683_0004127 3300044673 Bacteria 10428
197 Ga0453683_0118160 3300044673 Unclassified 1669
198 Ga0453683_0250853 3300044673 Bacteria 1128
199 Ga0453684_0000012 3300044712 Bacteria 1062512
200 Ga0453684_0000535 3300044712 Bacteria 144635
201 Ga0453684_0000718 3300044712 Bacteria 117108
202 Ga0453684_0000899 3300044712 Bacteria 99196
203 Ga0453684_0006997 3300044712 Bacteria 21096
204 Ga0453684_0016234 3300044712 Bacteria 11666
205 Ga0453684_0027195 3300044712 Bacteria 8214
206 Ga0453684_0061771 3300044712 Bacteria 4807
207 Ga0453684_0066141 3300044712 Bacteria 4604
208 Ga0453684_0068091 3300044712 Bacteria 4522
209 Ga0453684_0071752 3300044712 Bacteria 4377
210 Ga0453684_0160712 3300044712 Unclassified 2657
211 Ga0453684_0174199 3300044712 Bacteria 2532
212 Ga0453684_0199929 3300044712 Bacteria 2330
213 Ga0453684_0204800 3300044712 Bacteria 2297
214 Ga0453684_0248049 3300044712 Bacteria 2046
215 Ga0453684_0254828 3300044712 Unclassified 2013
216 Ga0453684_0311960 3300044712 Unclassified 1784
217 Ga0453684_0329279 3300044712 Bacteria 1727
218 Ga0453684_0368163 3300044712 Bacteria 1616
219 Ga0453684_0390480 3300044712 Bacteria 1561
220 Ga0453684_0424347 3300044712 Bacteria 1485
221 Ga0453684_0530212 3300044712 Bacteria 1300
222 Ga0451576_0020715 3300045051 Bacteria 7158
223 Ga0451576_0152794 3300045051 Unclassified 2407
224 Ga0451576_0391019 3300045051 Unclassified 1458
225 Ga0451576_0395779 3300045051 Bacteria 1448
226 Ga0451576_0459988 3300045051 Bacteria 1336
227 Ga0451576_0652283 3300045051 Bacteria 1106
228 Ga0495627_096085 3300046453 Bacteria 849
229 Ga0495591_001339 3300046458 Bacteria 15482
230 Ga0495650_0026464 3300046471 Bacteria 2698
231 Ga0495585_0020079 3300046492 Bacteria 3844
232 Ga0495585_0030037 3300046492 Bacteria 3092
233 Ga0495607_0033131 3300046501 Bacteria 3145
234 Ga0495607_0152217 3300046501 Bacteria 1183
235 Ga0495583_0002791 3300046506 Bacteria 14384
236 Ga0495610_0008138 3300046512 Bacteria 6848
237 Ga0495610_0013890 3300046512 Bacteria 4759
238 Ga0495620_0030659 3300046515 Bacteria 2473
239 Ga0495620_0089485 3300046515 Bacteria 1236
240 Ga0495620_0197598 3300046515 Bacteria 774
241 Ga0495637_0002338 3300046520 Bacteria 10499
242 Ga0495643_0029930 3300046522 Bacteria 3044
243 Ga0495648_0023358 3300046524 Bacteria 4236
244 Ga0495654_0052066 3300046530 Bacteria 1996
245 Ga0495665_0005676 3300046531 Bacteria 6733
246 Ga0495609_0000961 3300046538 Bacteria 20682
247 Ga0495668_0000079 3300046616 Bacteria 157703
248 Ga0495668_0045850 3300046616 Bacteria 2430
249 Ga0495625_0003332 3300046660 Bacteria 16170
250 Ga0495625_0005428 3300046660 Bacteria 11638
251 Ga0495625_0193921 3300046660 Bacteria 1344
252 Ga0495661_0198514 3300046665 Bacteria 1052
253 Ga0495588_0000638 3300046674 Bacteria 16289
254 Ga0495588_0133676 3300046674 Bacteria 1309
255 Ga0495670_0028488 3300046691 Bacteria 2769
256 Ga0495660_0062799 3300046810 Bacteria 1990
257 Ga0495660_0251400 3300046810 Bacteria 820
258 Ga0495581_0001699 3300047315 Bacteria 12258
259 Ga0495687_052451 3300047443 Bacteria 1724
260 Ga0495679_059944 3300047446 Bacteria 1118
261 Ga0495681_0007910 3300047470 Bacteria 6721
262 Ga0495686_0049022 3300047472 Bacteria 2660
263 Ga0496102_0324853 3300048905 Bacteria 1449
264 Ga0496105_0273813 3300048908 Bacteria 1363
265 Ga0496110_0146880 3300048913 Bacteria 2133
266 Ga0496111_0084282 3300048914 Bacteria 2323
267 Ga0496111_0172790 3300048914 Bacteria 1606
268 Ga0496113_0010874 3300048916 Bacteria 6038
269 Ga0496115_0012469 3300048918 Bacteria 6398
270 Ga0496115_0397575 3300048918 Bacteria 1119
271 Ga0496117_0100737 3300048920 Bacteria 1829
272 Ga0496119_0091224 3300048922 Bacteria 1731
273 Ga0496121_0000078 3300048924 Bacteria 233455
274 Ga0496121_0000293 3300048924 Bacteria 103372
275 Ga0496121_0009631 3300048924 Bacteria 11067
276 Ga0496122_0000244 3300048925 Bacteria 122107
277 Ga0496122_0074815 3300048925 Bacteria 2393
278 Ga0496123_0000201 3300048926 Bacteria 121915
279 Ga0496123_0031727 3300048926 Bacteria 3838
280 Ga0496125_0041715 3300048928 Bacteria 3920
281 Ga0496126_0012733 3300048929 Bacteria 8598
282 Ga0496126_0022079 3300048929 Bacteria 6200
283 Ga0501292_019870 3300049515 Bacteria 1078
284 Ga0501038_0051386 3300049574 Bacteria 3557
285 Ga0501043_0010826 3300049579 Bacteria 7141
286 Ga0501075_0280091 3300049591 Bacteria 1271
287 Ga0501076_0529777 3300049592 Bacteria 971
288 nmdc:mga0yw44_281254_c1 3300050492 Bacteria 1112
289 nmdc:mga0yw44_404903_c1 3300050492 Bacteria 923
290 nmdc:mga0k408_333929_c1 3300050493 Bacteria 904
291 nmdc:mga06z11_4618_c1 3300050494 Bacteria 5432
292 nmdc:mga05p37_130947_c1 3300050507 Unclassified 3078
293 nmdc:mga05p37_937_c1 3300050507 Bacteria 32838
294 nmdc:mga09592_141429_c1 3300050508 Bacteria 2075
295 nmdc:mga09592_2099_c1 3300050508 Bacteria 16089
296 nmdc:mga09592_33667_c1 3300050508 Unclassified 4279
297 nmdc:mga0qj67_270980_c1 3300050509 Bacteria 1376
298 nmdc:mga06r32_155001_c1 3300050510 Bacteria 2271
299 nmdc:mga06r32_726507_c1 3300050510 Unclassified 957
300 nmdc:mga06r32_812527_c1 3300050510 Bacteria 895
301 Ga0500610_0123346 3300053079 Bacteria 1323
302 Ga0500560_030948 3300053107 Bacteria 1617
303 Ga0500569_035620 3300053109 Bacteria 1428
304 Ga0500658_0026698 3300053134 Bacteria 2227
305 Ga0501084_0272388 3300054114 Bacteria 1429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8005376324 8005380250 199
2 3300031903 Ga0307407_10059866 Ga0307407_100598662 208
3 3300003781 Ga0055536_1039835 Ga0055536_10398352 210
4 3300013102 Ga0157371_10391092 Ga0157371_103910922 210
5 3300025292 Ga0209676_1001179 Ga0209676_10011796 210
6 3300003794 Ga0055531_10006174 Ga0055531_100061741 212
7 3300025304 Ga0209257_1000245 Ga0209257_100024588 212
8 3300032004 Ga0307414_10096947 Ga0307414_100969472 212
9 3300005536 Ga0070697_100100273 Ga0070697_1001002734 213
10 3300046515 Ga0495620_0197598 Ga0495620_0197598_79_759 215
11 3300050492 nmdc:mga0yw44_404903_c1 nmdc:mga0yw44_404903_c1_206_886 215
12 3300050493 nmdc:mga0k408_333929_c1 nmdc:mga0k408_333929_c1_136_816 215
13 3300050494 nmdc:mga06z11_4618_c1 nmdc:mga06z11_4618_c1_3344_4024 215
14 3300005536 Ga0070697_100246415 Ga0070697_1002464152 217
15 3300046458 Ga0495591_001339 Ga0495591_001339_6745_7500 219
16 3300048922 Ga0496119_0091224 Ga0496119_0091224_648_1403 220
17 3300044712 Ga0453684_0424347 Ga0453684_0424347_568_1302 222
18 3300046453 Ga0495627_096085 Ga0495627_096085_65_820 222
19 3300009148 Ga0105243_10263093 Ga0105243_102630932 223
20 3300025728 Ga0207655_1012261 Ga0207655_10122615 224
21 iso_pu_bacteria 2739367756 2739790689 225
22 3300046515 Ga0495620_0089485 Ga0495620_0089485_317_1081 227
23 3300003792 Ga0055540_1000077 Ga0055540_100007743 228
24 3300003792 Ga0055540_1000095 Ga0055540_100009585 228
25 3300006038 Ga0075365_10225182 Ga0075365_102251822 228
26 3300009011 Ga0105251_10000038 Ga0105251_1000003878 228
27 3300025292 Ga0209676_1031254 Ga0209676_10312542 228
28 3300025294 Ga0209025_1001911 Ga0209025_10019112 228
29 3300025303 Ga0209051_1000027 Ga0209051_1000027294 228
30 3300025304 Ga0209257_1015356 Ga0209257_10153562 228
31 3300025735 Ga0207713_1000185 Ga0207713_100018546 228
32 3300048924 Ga0496121_0009631 Ga0496121_0009631_1937_2692 228
33 3300048925 Ga0496122_0000244 Ga0496122_0000244_102617_103372 228
34 3300048926 Ga0496123_0000201 Ga0496123_0000201_102670_103425 228
35 3300050492 nmdc:mga0yw44_281254_c1 nmdc:mga0yw44_281254_c1_229_984 228
36 3300003215 JGI25153J46596_10002963 JGI25153J46596_1000296312 229
37 3300025245 Ga0207425_1002543 Ga0207425_10025432 229
38 3300025258 Ga0209129_1000917 Ga0209129_10009174 229
39 3300025294 Ga0209025_1000260 Ga0209025_1000260114 229
40 3300025297 Ga0209758_1001982 Ga0209758_100198211 229
41 iso_pu_bacteria 2524023250 2524612327 229
42 3300046471 Ga0495650_0026464 Ga0495650_0026464_703_1458 230
43 3300003320 rootH2_10150611 rootH2_101506114 231
44 3300005327 Ga0070658_10087523 Ga0070658_100875232 231
45 3300005347 Ga0070668_100159273 Ga0070668_1001592733 231
46 3300005536 Ga0070697_100314105 Ga0070697_1003141052 231
47 3300005563 Ga0068855_100004220 Ga0068855_10000422011 231
48 3300005617 Ga0068859_100064405 Ga0068859_1000644052 231
49 3300005842 Ga0068858_100001349 Ga0068858_10000134910 231
50 3300006931 Ga0097620_100064405 Ga0097620_1000644052 231
51 3300009093 Ga0105240_10014809 Ga0105240_100148098 231
52 3300010375 Ga0105239_10000524 Ga0105239_1000052440 231
53 3300025273 Ga0209673_1000921 Ga0209673_10009215 231
54 3300025914 Ga0207671_10005075 Ga0207671_100050754 231
55 3300025924 Ga0207694_10330809 Ga0207694_103308092 231
56 3300025949 Ga0207667_10007813 Ga0207667_100078138 231
57 3300025981 Ga0207640_10036504 Ga0207640_100365043 231
58 3300026035 Ga0207703_10001781 Ga0207703_100017812 231
59 3300032004 Ga0307414_10451235 Ga0307414_104512352 231
60 3300037471 Ga0395905_0006922 Ga0395905_0006922_3102_3839 231
61 3300048905 Ga0496102_0324853 Ga0496102_0324853_585_1325 231
62 3300048908 Ga0496105_0273813 Ga0496105_0273813_339_1079 231
63 3300048913 Ga0496110_0146880 Ga0496110_0146880_1092_1823 231
64 3300048914 Ga0496111_0084282 Ga0496111_0084282_678_1409 231
65 3300048914 Ga0496111_0172790 Ga0496111_0172790_647_1387 231
66 3300048916 Ga0496113_0010874 Ga0496113_0010874_1819_2559 231
67 3300048920 Ga0496117_0100737 Ga0496117_0100737_468_1202 231
68 3300048924 Ga0496121_0000078 Ga0496121_0000078_124674_125408 231
69 3300048924 Ga0496121_0000293 Ga0496121_0000293_11573_12307 231
70 3300048925 Ga0496122_0074815 Ga0496122_0074815_1502_2242 231
71 3300048926 Ga0496123_0031727 Ga0496123_0031727_793_1533 231
72 3300048928 Ga0496125_0041715 Ga0496125_0041715_2601_3341 231
73 3300048929 Ga0496126_0012733 Ga0496126_0012733_7063_7797 231
74 3300048929 Ga0496126_0022079 Ga0496126_0022079_3438_4169 231
75 3300006353 Ga0075370_10172522 Ga0075370_101725222 232
76 3300026023 Ga0207677_10695519 Ga0207677_106955192 232
77 3300031240 Ga0265320_10172407 Ga0265320_101724072 232
78 3300048918 Ga0496115_0397575 Ga0496115_0397575_303_1043 232
79 3300003794 Ga0055531_10001938 Ga0055531_100019384 233
80 3300005544 Ga0070686_100073194 Ga0070686_1000731942 233
81 3300009093 Ga0105240_10314520 Ga0105240_103145202 233
82 3300009094 Ga0111539_10501965 Ga0111539_105019651 233
83 3300009545 Ga0105237_10004469 Ga0105237_1000446911 233
84 3300013297 Ga0157378_10285884 Ga0157378_102858841 233
85 3300025913 Ga0207695_10224810 Ga0207695_102248102 233
86 3300037418 Ga0395900_0344698 Ga0395900_0344698_35_937 233
87 3300039450 Ga0436363_1345356 Ga0436363_1345356_71_808 233
88 3300046492 Ga0495585_0030037 Ga0495585_0030037_1789_2544 233
89 3300046616 Ga0495668_0000079 Ga0495668_0000079_47353_48090 233
90 3300009093 Ga0105240_10128732 Ga0105240_101287323 234
91 3300048918 Ga0496115_0012469 Ga0496115_0012469_4270_5049 234
92 iso_pu_bacteria 2509276021 2509391284 234
93 iso_pu_bacteria 2509276033 2509445469 234
94 iso_pu_bacteria 2510461076 2510892565 234
95 iso_pu_bacteria 2511231052 2511499497 234
96 iso_pu_bacteria 2513237084 2513568323 234
97 iso_pu_bacteria 2513237086 2513586229 234
98 iso_pu_bacteria 2513237093 2513634771 234
99 iso_pu_bacteria 2513237162 2514018562 234
100 iso_pu_bacteria 2551306084 2551676110 234
101 iso_pu_bacteria 2551306085 2551683919 234
102 iso_pu_bacteria 2551306086 2551693263 234
103 iso_pu_bacteria 2551306087 2551701924 234
104 iso_pu_bacteria 2551306090 2551721483 234
105 iso_pu_bacteria 2551306092 2551732165 234
106 iso_pu_bacteria 2551306093 2551739674 234
107 iso_pu_bacteria 2582581306 2585270140 234
108 iso_pu_bacteria 2582581865 2585391215 234
109 iso_pu_bacteria 2582581866 2585397924 234
110 iso_pu_bacteria 2585427528 2585541723 234
111 iso_pu_bacteria 2585427593 2585840058 234
112 iso_pu_bacteria 2585427608 2585902479 234
113 iso_pu_bacteria 2599185170 2599416154 234
114 iso_pu_bacteria 2615840624 2616294931 234
115 iso_pu_bacteria 2617270742 2617384093 234
116 iso_pu_bacteria 2643221582 2643918419 234
117 iso_pu_bacteria 2643221634 2644194474 234
118 iso_pu_bacteria 2643221636 2644200477 234
119 iso_pu_bacteria 2643221723 2644672373 234
120 iso_pu_bacteria 2718218365 2721156121 234
121 iso_pu_bacteria 2728369397 2730295654 234
122 iso_pu_bacteria 2738541333 2739036337 234
123 iso_pu_bacteria 2773857925 2774872463 234
124 iso_pu_bacteria 2775507266 2778176599 234
125 iso_pu_bacteria 2791355259 2793317418 234
126 iso_pu_bacteria 2791355261 2793327987 234
127 iso_pu_bacteria 2791355265 2793354513 234
128 iso_pu_bacteria 2791355266 2793362360 234
129 iso_pu_bacteria 2802429633 2806046440 234
130 iso_pu_bacteria 2802429634 2806053024 234
131 iso_pu_bacteria 2802429635 2806059768 234
132 iso_pu_bacteria 2802429636 2806068494 234
133 iso_pu_bacteria 2802429637 2806074916 234
134 iso_pu_bacteria 2838022645 2838027428 234
135 iso_pu_bacteria 2841864319 2841868591 234
136 iso_pu_bacteria 2842198810 2842202968 234
137 iso_pu_bacteria 2842298080 2842303049 234
138 iso_pu_bacteria 2842341865 2842342540 234
139 iso_pu_bacteria 2842357229 2842361543 234
140 iso_pu_bacteria 2842363717 2842365687 234
141 iso_pu_bacteria 2842482326 2842487394 234
142 iso_pu_bacteria 2842509118 2842513556 234
143 iso_pu_bacteria 2855825444 2855830287 234
144 iso_pu_bacteria 2855839649 2855845935 234
145 iso_pu_bacteria 2915993759 2915995868 234
146 iso_pu_bacteria 2916007675 2916012831 234
147 iso_pu_bacteria 2916014648 2916017682 234
148 iso_pu_bacteria 2916028427 2916031359 234
149 iso_pu_bacteria 2916055098 2916058098 234
150 iso_pu_bacteria 2916068649 2916071670 234
151 iso_pu_bacteria 2921201388 2921206825 234
152 iso_pu_bacteria 2921237296 2921239181 234
153 iso_pu_bacteria 2921263974 2921266811 234
154 iso_pu_bacteria 2921289301 2921293904 234
155 iso_pu_bacteria 2921296804 2921303169 234
156 iso_pu_bacteria 2923556063 2923560448 234
157 iso_pu_bacteria 2924150972 2924155609 234
158 iso_pu_bacteria 2924158325 2924162929 234
159 iso_pu_bacteria 2924165586 2924169614 234
160 iso_pu_bacteria 2924172951 2924175579 234
161 iso_pu_bacteria 2924186466 2924190055 234
162 iso_pu_bacteria 2924214083 2924220385 234
163 iso_pu_bacteria 2924221636 2924224564 234
164 iso_pu_bacteria 2924228884 2924233311 234
165 iso_pu_bacteria 2936381700 2936383190 234
166 iso_pu_bacteria 2937002841 2937006558 234
167 iso_pu_bacteria 2937042894 2937043081 234
168 iso_pu_bacteria 2937049772 2937055856 234
169 iso_pu_bacteria 2937056579 2937061245 234
170 iso_pu_bacteria 2937071275 2937072515 234
171 iso_pu_bacteria 2937091812 2937096259 234
172 iso_pu_bacteria 2937098957 2937103877 234
173 iso_pu_bacteria 2937106411 2937110453 234
174 iso_pu_bacteria 2937126314 2937132811 234
175 iso_pu_bacteria 2957422303 2957428787 234
176 iso_pu_bacteria 2957430029 2957436230 234
177 iso_pu_bacteria 2957457609 2957458292 234
178 iso_pu_bacteria 2957471148 2957474977 234
179 iso_pu_bacteria 2957478035 2957480820 234
180 iso_pu_bacteria 2957484790 2957485181 234
181 iso_pu_bacteria 2957498199 2957503158 234
182 iso_pu_bacteria 2957505466 2957509534 234
183 iso_pu_bacteria 2960603979 2960608205 234
184 iso_pu_bacteria 2960624210 2960627507 234
185 iso_pu_bacteria 2960637947 2960644963 234
186 iso_pu_bacteria 2960645483 2960649319 234
187 iso_pu_bacteria 2960652885 2960656454 234
188 iso_pu_bacteria 2964607997 2964612642 234
189 iso_pu_bacteria 2964628898 2964633448 234
190 iso_pu_bacteria 2964649959 2964654220 234
191 iso_pu_bacteria 2964656573 2964661354 234
192 iso_pu_bacteria 2964678106 2964683984 234
193 iso_pu_bacteria 2964719344 2964726381 234
194 iso_pu_bacteria 2967664464 2967670903 234
195 iso_pu_bacteria 2967678726 2967683582 234
196 iso_pu_bacteria 2967693043 2967695856 234
197 iso_pu_bacteria 2967706974 2967708752 234
198 iso_pu_bacteria 2967714385 2967719142 234
199 iso_pu_bacteria 2967721400 2967725620 234
200 iso_pu_bacteria 2967735183 2967739096 234
201 iso_pu_bacteria 2967762386 2967763042 234
202 iso_pu_bacteria 2967775926 2967777434 234
203 iso_pu_bacteria 2970019648 2970026301 234
204 iso_pu_bacteria 2970040964 2970043105 234
205 iso_pu_bacteria 2970047711 2970047749 234
206 iso_pu_bacteria 2970054988 2970058122 234
207 iso_pu_bacteria 2970061556 2970066062 234
208 iso_pu_bacteria 2970088815 2970092970 234
209 iso_pu_bacteria 2970109326 2970114860 234
210 iso_pu_bacteria 2970116247 2970117488 234
211 iso_pu_bacteria 2970129317 2970132350 234
212 iso_pu_bacteria 2970136068 2970139477 234
213 iso_pu_bacteria 2970149975 2970150941 234
214 iso_pu_bacteria 2970164137 2970168028 234
215 iso_pu_bacteria 2970170962 2970174599 234
216 iso_pu_bacteria 2970184632 2970189098 234
217 iso_pu_bacteria 2970191845 2970195510 234
218 iso_pu_bacteria 2977537788 2977542130 234
219 iso_pu_bacteria 2977551784 2977556602 234
220 iso_pu_bacteria 2977572785 2977575829 234
221 iso_pu_bacteria 2977579622 2977581913 234
222 iso_pu_bacteria 8005376324 8005380056 234
223 iso_pu_bacteria 8005395548 8005398589 234
224 iso_pu_bacteria 8005556819 8005563502 234
225 iso_pu_bacteria 8005563573 8005565281 234
226 iso_pu_bacteria 8005570704 8005572445 234
227 iso_pu_bacteria 8018163183 8018168686 234
228 iso_pu_bacteria 8056375014 8056377664 234
229 3300031548 Ga0307408_100526194 Ga0307408_1005261941 235
230 3300031548 Ga0307408_100669895 Ga0307408_1006698951 235
231 3300031548 Ga0307408_100701813 Ga0307408_1007018131 235
232 3300031731 Ga0307405_10007380 Ga0307405_100073803 235
233 3300031731 Ga0307405_10288282 Ga0307405_102882822 235
234 3300031824 Ga0307413_10256614 Ga0307413_102566141 235
235 3300031852 Ga0307410_10036117 Ga0307410_100361172 235
236 3300031852 Ga0307410_10249059 Ga0307410_102490592 235
237 3300031901 Ga0307406_10026720 Ga0307406_100267202 235
238 3300031903 Ga0307407_10360166 Ga0307407_103601662 235
239 3300031911 Ga0307412_10011597 Ga0307412_100115976 235
240 3300031995 Ga0307409_100076039 Ga0307409_1000760392 235
241 3300031995 Ga0307409_100760698 Ga0307409_1007606982 235
242 3300032002 Ga0307416_100102310 Ga0307416_1001023102 235
243 3300032002 Ga0307416_100190254 Ga0307416_1001902542 235
244 3300032004 Ga0307414_10305458 Ga0307414_103054581 235
245 3300032005 Ga0307411_10248149 Ga0307411_102481491 235
246 3300032126 Ga0307415_100055017 Ga0307415_1000550172 235
247 3300025292 Ga0209676_1002471 Ga0209676_100247112 236
248 3300025295 Ga0209564_1000341 Ga0209564_100034117 236
249 3300025298 Ga0209050_1009398 Ga0209050_10093984 236
250 3300025299 Ga0209256_1003376 Ga0209256_10033764 236
251 3300025304 Ga0209257_1000599 Ga0209257_100059951 236
252 3300003214 JGI25165J46597_1000276 JGI25165J46597_100027618 237
253 3300003775 Ga0055524_1001595 Ga0055524_100159513 237
254 3300003790 Ga0055528_1000496 Ga0055528_100049621 237
255 3300006177 Ga0075362_10000763 Ga0075362_100007634 237
256 3300006178 Ga0075367_10023659 Ga0075367_100236591 237
257 3300006186 Ga0075369_10000669 Ga0075369_1000066911 237
258 3300006195 Ga0075366_10001056 Ga0075366_100010562 237
259 3300025233 Ga0209437_100023 Ga0209437_100023456 237
260 3300025261 Ga0209233_1000062 Ga0209233_100006219 237
261 3300025273 Ga0209673_1000294 Ga0209673_100029410 237
262 3300025295 Ga0209564_1001129 Ga0209564_100112924 237
263 3300025299 Ga0209256_1000719 Ga0209256_100071924 237
264 3300025302 Ga0207426_1001199 Ga0207426_100119910 237
265 3300025303 Ga0209051_1000534 Ga0209051_100053434 237
266 3300041491 Ga0451833_0068607 Ga0451833_0068607_480_1235 237
267 3300041494 Ga0451837_0730833 Ga0451837_0730833_1416_2171 237
268 3300041498 Ga0451841_0461209 Ga0451841_0461209_1181_1936 237
269 3300041501 Ga0451845_0024217 Ga0451845_0024217_3114_3869 237
270 3300041507 Ga0451851_0778015 Ga0451851_0778015_3119_3874 237
271 3300041509 Ga0451843_0169011 Ga0451843_0169011_668_1423 237
272 3300041509 Ga0451843_0980372 Ga0451843_0980372_326_1081 237
273 3300046492 Ga0495585_0020079 Ga0495585_0020079_2243_2998 237
274 3300046501 Ga0495607_0033131 Ga0495607_0033131_1970_2725 237
275 3300046501 Ga0495607_0152217 Ga0495607_0152217_283_1038 237
276 3300046506 Ga0495583_0002791 Ga0495583_0002791_897_1652 237
277 3300046512 Ga0495610_0008138 Ga0495610_0008138_317_1072 237
278 3300046512 Ga0495610_0013890 Ga0495610_0013890_2379_3134 237
279 3300046515 Ga0495620_0030659 Ga0495620_0030659_678_1433 237
280 3300046520 Ga0495637_0002338 Ga0495637_0002338_8962_9717 237
281 3300046522 Ga0495643_0029930 Ga0495643_0029930_1089_1844 237
282 3300046524 Ga0495648_0023358 Ga0495648_0023358_2368_3123 237
283 3300046530 Ga0495654_0052066 Ga0495654_0052066_502_1257 237
284 3300046531 Ga0495665_0005676 Ga0495665_0005676_2481_3254 237
285 3300046538 Ga0495609_0000961 Ga0495609_0000961_2970_3725 237
286 3300046616 Ga0495668_0045850 Ga0495668_0045850_1442_2197 237
287 3300046660 Ga0495625_0003332 Ga0495625_0003332_12473_13228 237
288 3300046660 Ga0495625_0005428 Ga0495625_0005428_644_1399 237
289 3300046660 Ga0495625_0193921 Ga0495625_0193921_340_1095 237
290 3300046665 Ga0495661_0198514 Ga0495661_0198514_104_859 237
291 3300046674 Ga0495588_0000638 Ga0495588_0000638_2781_3536 237
292 3300046674 Ga0495588_0133676 Ga0495588_0133676_237_1010 237
293 3300046691 Ga0495670_0028488 Ga0495670_0028488_1786_2541 237
294 3300046810 Ga0495660_0062799 Ga0495660_0062799_974_1729 237
295 3300046810 Ga0495660_0251400 Ga0495660_0251400_25_780 237
296 3300047315 Ga0495581_0001699 Ga0495581_0001699_2292_3065 237
297 3300047443 Ga0495687_052451 Ga0495687_052451_135_890 237
298 3300047446 Ga0495679_059944 Ga0495679_059944_18_773 237
299 3300047470 Ga0495681_0007910 Ga0495681_0007910_3159_3914 237
300 3300047472 Ga0495686_0049022 Ga0495686_0049022_572_1327 237
301 3300053079 Ga0500610_0123346 Ga0500610_0123346_285_1040 237
302 3300053107 Ga0500560_030948 Ga0500560_030948_308_1063 237
303 3300053109 Ga0500569_035620 Ga0500569_035620_282_1037 237
304 3300053134 Ga0500658_0026698 Ga0500658_0026698_130_885 237
305 iso_pu_bacteria 2808606357 2808828815 237
306 3300031852 Ga0307410_10227382 Ga0307410_102273822 238
307 3300032002 Ga0307416_100383972 Ga0307416_1003839722 238
308 3300037466 Ga0395898_0064324 Ga0395898_0064324_2383_3171 238
309 3300049574 Ga0501038_0051386 Ga0501038_0051386_1252_2040 238
310 3300049579 Ga0501043_0010826 Ga0501043_0010826_2950_3738 238
311 3300005340 Ga0070689_100003812 Ga0070689_1000038121 243
312 3300005617 Ga0068859_100116523 Ga0068859_1001165233 243
313 3300005617 Ga0068859_100552625 Ga0068859_1005526252 243
314 3300005843 Ga0068860_100021029 Ga0068860_1000210294 243
315 3300006931 Ga0097620_100116516 Ga0097620_1001165163 243
316 3300006931 Ga0097620_100552632 Ga0097620_1005526322 243
317 3300009177 Ga0105248_10036537 Ga0105248_100365372 243
318 3300025918 Ga0207662_10063825 Ga0207662_100638252 243
319 3300028380 Ga0268265_10269229 Ga0268265_102692292 243
320 3300028381 Ga0268264_10045555 Ga0268264_100455554 243
321 3300037466 Ga0395898_0195577 Ga0395898_0195577_425_1201 243
322 3300036647 Ga0316582_0250420 Ga0316582_0250420_31_774 247
323 3300036712 Ga0316584_0087737 Ga0316584_0087737_1214_1957 247
324 3300042876 Ga0451577_0582793 Ga0451577_0582793_79_822 247
325 3300044712 Ga0453684_0061771 Ga0453684_0061771_816_1559 247
326 3300044673 Ga0453683_0001275 Ga0453683_0001275_19179_19931 249
327 3300044712 Ga0453684_0368163 Ga0453684_0368163_124_876 249
328 3300045051 Ga0451576_0459988 Ga0451576_0459988_48_800 249
329 3300006846 Ga0075430_100361033 Ga0075430_1003610332 250
330 3300006847 Ga0075431_100657262 Ga0075431_1006572621 250
331 3300006880 Ga0075429_100027464 Ga0075429_1000274644 250
332 3300044712 Ga0453684_0160712 Ga0453684_0160712_75_833 250
333 3300050508 nmdc:mga09592_33667_c1 nmdc:mga09592_33667_c1_3388_4140 250
334 3300050510 nmdc:mga06r32_726507_c1 nmdc:mga06r32_726507_c1_159_911 250
335 3300005440 Ga0070705_100097430 Ga0070705_1000974302 251
336 3300005549 Ga0070704_100142614 Ga0070704_1001426141 251
337 3300006844 Ga0075428_100098958 Ga0075428_1000989582 251
338 3300006844 Ga0075428_100220064 Ga0075428_1002200642 251
339 3300006847 Ga0075431_100217804 Ga0075431_1002178042 251
340 3300006880 Ga0075429_100008920 Ga0075429_1000089209 251
341 3300006880 Ga0075429_100172171 Ga0075429_1001721712 251
342 3300006880 Ga0075429_100256034 Ga0075429_1002560342 251
343 3300009147 Ga0114129_10001366 Ga0114129_100013663 251
344 3300009147 Ga0114129_10494722 Ga0114129_104947222 251
345 3300031691 Ga0316579_10037271 Ga0316579_100372711 251
346 3300032126 Ga0307415_100055974 Ga0307415_1000559743 251
347 3300042876 Ga0451577_0008588 Ga0451577_0008588_8426_9181 251
348 3300042876 Ga0451577_0340988 Ga0451577_0340988_151_927 251
349 3300044712 Ga0453684_0000012 Ga0453684_0000012_358131_358886 251
350 3300044712 Ga0453684_0000718 Ga0453684_0000718_72228_72983 251
351 3300044712 Ga0453684_0204800 Ga0453684_0204800_834_1610 251
352 3300044712 Ga0453684_0248049 Ga0453684_0248049_1260_2015 251
353 3300044712 Ga0453684_0254828 Ga0453684_0254828_391_1146 251
354 3300044712 Ga0453684_0311960 Ga0453684_0311960_936_1691 251
355 3300044712 Ga0453684_0329279 Ga0453684_0329279_706_1500 251
356 3300045051 Ga0451576_0395779 Ga0451576_0395779_650_1405 251
357 3300049515 Ga0501292_019870 Ga0501292_019870_145_900 251
358 3300049591 Ga0501075_0280091 Ga0501075_0280091_415_1176 251
359 3300049592 Ga0501076_0529777 Ga0501076_0529777_111_866 251
360 3300050507 nmdc:mga05p37_937_c1 nmdc:mga05p37_937_c1_28903_29658 251
361 3300050508 nmdc:mga09592_2099_c1 nmdc:mga09592_2099_c1_315_1070 251
362 3300050510 nmdc:mga06r32_155001_c1 nmdc:mga06r32_155001_c1_1499_2254 251
363 3300050510 nmdc:mga06r32_812527_c1 nmdc:mga06r32_812527_c1_77_832 251
364 3300054114 Ga0501084_0272388 Ga0501084_0272388_414_1169 251
365 3300005295 Ga0065707_10086992 Ga0065707_100869923 252
366 3300005336 Ga0070680_100651903 Ga0070680_1006519031 252
367 3300005440 Ga0070705_100068880 Ga0070705_1000688801 252
368 3300005444 Ga0070694_100147937 Ga0070694_1001479372 252
369 3300005468 Ga0070707_100132121 Ga0070707_1001321211 252
370 3300005518 Ga0070699_100012037 Ga0070699_1000120375 252
371 3300005518 Ga0070699_100027856 Ga0070699_1000278565 252
372 3300005546 Ga0070696_100670418 Ga0070696_1006704181 252
373 3300005577 Ga0068857_100144797 Ga0068857_1001447972 252
374 3300006844 Ga0075428_100359003 Ga0075428_1003590032 252
375 3300028380 Ga0268265_10129323 Ga0268265_101293232 252
376 3300031824 Ga0307413_10155014 Ga0307413_101550142 252
377 3300031852 Ga0307410_10040220 Ga0307410_100402202 252
378 3300032005 Ga0307411_10082549 Ga0307411_100825492 252
379 3300041459 Ga0451800_0401769 Ga0451800_0401769_1008_1766 252
380 3300042876 Ga0451577_0037050 Ga0451577_0037050_570_1328 252
381 3300042876 Ga0451577_0052914 Ga0451577_0052914_1620_2414 252
382 3300044712 Ga0453684_0066141 Ga0453684_0066141_598_1356 252
383 3300044712 Ga0453684_0174199 Ga0453684_0174199_1177_1935 252
384 3300044712 Ga0453684_0199929 Ga0453684_0199929_339_1097 252
385 3300044712 Ga0453684_0390480 Ga0453684_0390480_475_1269 252
386 2162886007 SwRhRL2b_contig_134543 SwRhRL2b_0084.00001870 253
387 2162886007 SwRhRL2b_contig_3384074 SwRhRL2b_0693.00005960 253
388 3300005289 Ga0065704_10000545 Ga0065704_100005455 253
389 3300005289 Ga0065704_10096964 Ga0065704_100969642 253
390 3300005295 Ga0065707_10003358 Ga0065707_100033582 253
391 3300005295 Ga0065707_10082082 Ga0065707_100820826 253
392 3300005295 Ga0065707_10093019 Ga0065707_100930193 253
393 3300005340 Ga0070689_100314317 Ga0070689_1003143172 253
394 3300005441 Ga0070700_100012627 Ga0070700_1000126272 253
395 3300005444 Ga0070694_100017812 Ga0070694_1000178124 253
396 3300005444 Ga0070694_100094885 Ga0070694_1000948853 253
397 3300005471 Ga0070698_100033902 Ga0070698_1000339024 253
398 3300005518 Ga0070699_100221165 Ga0070699_1002211652 253
399 3300005617 Ga0068859_100036786 Ga0068859_1000367862 253
400 3300005844 Ga0068862_100061656 Ga0068862_1000616562 253
401 3300005844 Ga0068862_100321822 Ga0068862_1003218222 253
402 3300005985 Ga0081539_10000859 Ga0081539_1000085914 253
403 3300005985 Ga0081539_10005055 Ga0081539_100050555 253
404 3300006844 Ga0075428_100078235 Ga0075428_1000782353 253
405 3300006846 Ga0075430_100291467 Ga0075430_1002914672 253
406 3300006871 Ga0075434_100027694 Ga0075434_1000276944 253
407 3300006931 Ga0097620_100036784 Ga0097620_1000367842 253
408 3300009094 Ga0111539_10092543 Ga0111539_100925432 253
409 3300009147 Ga0114129_10009931 Ga0114129_1000993112 253
410 3300009147 Ga0114129_10015137 Ga0114129_100151377 253
411 3300025918 Ga0207662_10261560 Ga0207662_102615602 253
412 3300025936 Ga0207670_10035859 Ga0207670_100358593 253
413 3300026075 Ga0207708_10025007 Ga0207708_100250073 253
414 3300028380 Ga0268265_10039773 Ga0268265_100397733 253
415 3300031665 Ga0316575_10030218 Ga0316575_100302182 253
416 3300031733 Ga0316577_10014388 Ga0316577_100143883 253
417 3300031852 Ga0307410_10313642 Ga0307410_103136422 253
418 3300032137 Ga0316585_10090239 Ga0316585_100902391 253
419 3300036647 Ga0316582_0029866 Ga0316582_0029866_1483_2253 253
420 3300036712 Ga0316584_0006146 Ga0316584_0006146_2153_2935 253
421 3300036712 Ga0316584_0024133 Ga0316584_0024133_2705_3475 253
422 3300036712 Ga0316584_0217616 Ga0316584_0217616_56_823 253
423 3300037588 Ga0316581_0020351 Ga0316581_0020351_975_1745 253
424 3300042876 Ga0451577_0043839 Ga0451577_0043839_1612_2373 253
425 3300042876 Ga0451577_0102919 Ga0451577_0102919_926_1690 253
426 3300042876 Ga0451577_0285800 Ga0451577_0285800_380_1141 253
427 3300042876 Ga0451577_0349805 Ga0451577_0349805_85_846 253
428 3300044673 Ga0453683_0000731 Ga0453683_0000731_6970_7731 253
429 3300044673 Ga0453683_0004127 Ga0453683_0004127_178_939 253
430 3300044673 Ga0453683_0118160 Ga0453683_0118160_793_1557 253
431 3300044673 Ga0453683_0250853 Ga0453683_0250853_109_870 253
432 3300044712 Ga0453684_0000535 Ga0453684_0000535_31168_31932 253
433 3300044712 Ga0453684_0000899 Ga0453684_0000899_43532_44293 253
434 3300044712 Ga0453684_0006997 Ga0453684_0006997_821_1582 253
435 3300044712 Ga0453684_0016234 Ga0453684_0016234_7019_7780 253
436 3300044712 Ga0453684_0027195 Ga0453684_0027195_7253_8014 253
437 3300044712 Ga0453684_0068091 Ga0453684_0068091_429_1190 253
438 3300044712 Ga0453684_0071752 Ga0453684_0071752_3270_4049 253
439 3300044712 Ga0453684_0530212 Ga0453684_0530212_144_908 253
440 3300045051 Ga0451576_0020715 Ga0451576_0020715_3507_4286 253
441 3300045051 Ga0451576_0152794 Ga0451576_0152794_489_1328 253
442 3300045051 Ga0451576_0391019 Ga0451576_0391019_612_1373 253
443 3300045051 Ga0451576_0652283 Ga0451576_0652283_68_829 253
444 3300050507 nmdc:mga05p37_130947_c1 nmdc:mga05p37_130947_c1_1783_2544 253
445 3300050508 nmdc:mga09592_141429_c1 nmdc:mga09592_141429_c1_245_1006 253
446 3300050509 nmdc:mga0qj67_270980_c1 nmdc:mga0qj67_270980_c1_444_1205 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

215

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

273

0.92

PF08659

KR

KR domain

71

196

0.87

PF23441

90

274

0.77

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

191

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uxy-assembly1.cif.gz_D the crystal structure of short chain dehydrogenase from rhodobacter sphaeroides 0.9579 5 245
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9541 2 249
2d1y-assembly1.cif.gz_C crystal structure of tt0321 from thermus thermophilus hb8 0.9522 5 250
2d1y-assembly1.cif.gz_D crystal structure of tt0321 from thermus thermophilus hb8 0.9502 5 250
5itv-assembly1.cif.gz_A crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9498 5 249
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9573 3 172 3.40.50.720
3uxyD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9559 5 245 3.40.50.720
af_A0A0R0JBZ9_6_171_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9551 78 247 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 2 249 3.40.50.720
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9522 5 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N5S1U9-F1-model_v4 SDR family oxidoreductase 0.9944 45 253 GO:0016491
AF-A0A533SSM5-F1-model_v4 SDR family oxidoreductase 0.9918 2 226 GO:0016491
AF-A0A3N5S1U9-F1-model_v4 SDR family oxidoreductase 0.9896 45 253 GO:0016491
AF-A0A1M3KEM3-F1-model_v4 Short-chain dehydrogenase 0.9849 4 253 GO:0016491
AF-A0A662CS22-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9796 3 171 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.18 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map