F445771

General Info

Members Datasets Scaffolds Average Seq Length
446 322 396 383

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0168918|Ga0436361_0168918_122_1405
Length 427
Sequence LHKSCRAKHANHLEGISPVAAEEMRSANLEGSQMIRFTRRTLIAVAAATVAATLSPLALAADTIKIGLVTALSGQSAQAGEALTRGMSIAIDEINAKGGLLGGRTLELVRRDDEGNPAKGVVAARELIFKEKVAVLFGGLDTPVSMAIVPIINQEKVPFVGPWAAGTGVTRNGANPNYAFRVSAVDELVDKAMLNYAQKTFKSSKAGLILVNNPWGESNEKGITAALAEKGMKPVGVEKFEASDVDLVPQLSRLKAAGADTLFLVGNVGPSAQVVKSLDRMGWKVPVVSHWGPAGGRFTELAGPNAKNVHFVQTFSFFGKLSPVGEKVVAELKAKYPAIKGPDDITPAVGVANAYDGMQLAALAIAKAGSTNGDAVREGFYKIDRYDGLIKTYVKPFSASVHDALQADDYVWAQFIDNRILPVGLNQ

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2643221569 Achromobacter sp. Root565 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221609 Acidovorax sp. Root217 Isolate Unclassified
9 2643221611 Acidovorax sp. Root219 Isolate Unclassified
10 2643221621 Achromobacter sp. Root83 Isolate Unclassified
11 2738541277 Variovorax sp. GV051 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2738543013 Variovorax sp. BT01 Isolate Unclassified
14 2738543019 Variovorax sp. GV040 Isolate Unclassified
15 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
16 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
17 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
18 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
19 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
20 2816332133 Acidovorax radicis 2721A Isolate Unclassified
21 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
22 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
23 2842677519 Variovorax sp. R-72495 Isolate Unclassified
24 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
25 2842733646 Variovorax sp. R-72446 Isolate Unclassified
26 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
27 2855730933 Achromobacter sp. HZ28 Isolate Nodule
28 2855767633 Achromobacter sp. HZ34 Isolate Nodule
29 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
30 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
31 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
32 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
33 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
34 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
35 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
36 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
37 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
38 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
39 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
40 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
41 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
42 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
43 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
44 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
45 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
46 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
47 2929520902 Variovorax beijingensis 502 Isolate Unclassified
48 2941479691
49 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
50 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
51 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
52 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
53 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
54 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
55 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
56 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
57 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
58 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
59 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
60 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
65 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
66 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
96 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
114 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
135 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
148 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
193 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
204 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
205 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
206 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
207 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
208 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
209 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
210 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
229 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
278 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
279 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
316 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
317 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
318 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
319 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.57
Metatranscriptomes 0.22
Isolates 11.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.23
Nodule 1.79
Rhizoplane 2.91
Rhizosphere 68.83
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1004586 3300002737 Bacteria 3133
2 JGI25151J46595_10013441 3300003187 Bacteria 3683
3 Ga0055538_1000141 3300003751 Bacteria 50563
4 Ga0055539_1000192 3300003752 Bacteria 50563
5 Ga0055533_1000192 3300003756 Bacteria 50563
6 Ga0055525_1000260 3300003759 Bacteria 50563
7 Ga0055526_1006883 3300003771 Bacteria 6057
8 Ga0055526_1006931 3300003771 Bacteria 6029
9 Ga0055524_1000158 3300003775 Bacteria 78973
10 Ga0055536_1000677 3300003781 Bacteria 22946
11 Ga0055534_1000904 3300003784 Bacteria 13385
12 Ga0055534_1000985 3300003784 Bacteria 12573
13 Ga0055534_1001105 3300003784 Bacteria 11469
14 Ga0055530_10003217 3300003791 Bacteria 9557
15 Ga0055540_1000035 3300003792 Bacteria 166843
16 Ga0055531_10011903 3300003794 Bacteria 4142
17 Ga0055541_1000127 3300003841 Bacteria 50563
18 Ga0070676_10006449 3300005328 Bacteria 6272
19 Ga0070690_100001379 3300005330 Bacteria 12655
20 Ga0070670_100135094 3300005331 Bacteria 2131
21 Ga0070677_10091672 3300005333 Bacteria 1323
22 Ga0070666_10030465 3300005335 Bacteria 3555
23 Ga0068868_100000620 3300005338 Bacteria 23878
24 Ga0070660_100005338 3300005339 Bacteria 8891
25 Ga0070669_100069692 3300005353 Bacteria 2598
26 Ga0070675_100000657 3300005354 Bacteria 23889
27 Ga0070675_100006788 3300005354 Bacteria 8789
28 Ga0070675_100015987 3300005354 Bacteria 5946
29 Ga0070675_100146949 3300005354 Bacteria 2019
30 Ga0070671_100003866 3300005355 Bacteria 11774
31 Ga0070671_100011204 3300005355 Bacteria 7202
32 Ga0070671_100024730 3300005355 Bacteria 4919
33 Ga0070674_100057254 3300005356 Bacteria 2705
34 Ga0070673_100023967 3300005364 Bacteria 4466
35 Ga0070673_100090814 3300005364 Bacteria 2495
36 Ga0070673_100101773 3300005364 Bacteria 2367
37 Ga0070659_100003900 3300005366 Bacteria 10621
38 Ga0070659_100139421 3300005366 Bacteria 1974
39 Ga0070667_100125127 3300005367 Bacteria 2240
40 Ga0070705_100034293 3300005440 Bacteria 2836
41 Ga0070663_100005608 3300005455 Bacteria 7471
42 Ga0070678_100204936 3300005456 Bacteria 1630
43 Ga0070662_100000114 3300005457 Bacteria 45016
44 Ga0068867_100112621 3300005459 Bacteria 2092
45 Ga0068867_100115405 3300005459 Bacteria 2068
46 Ga0070707_100095896 3300005468 Bacteria 2873
47 Ga0070698_100004336 3300005471 Bacteria 15595
48 Ga0070699_100003076 3300005518 Bacteria 14790
49 Ga0070699_100008557 3300005518 Bacteria 8866
50 Ga0070699_100079418 3300005518 Bacteria 2858
51 Ga0070679_100108404 3300005530 Bacteria 2763
52 Ga0070697_100016288 3300005536 Bacteria 5846
53 Ga0070697_100236743 3300005536 Bacteria 1558
54 Ga0068853_100013366 3300005539 Bacteria 6702
55 Ga0070672_100013802 3300005543 Bacteria 5713
56 Ga0070672_100027953 3300005543 Bacteria 4213
57 Ga0070672_100042182 3300005543 Bacteria 3512
58 Ga0070672_100053736 3300005543 Bacteria 3150
59 Ga0070672_100055826 3300005543 Bacteria 3095
60 Ga0070672_100104701 3300005543 Bacteria 2299
61 Ga0070686_100004065 3300005544 Bacteria 8045
62 Ga0070695_100011344 3300005545 Bacteria 5331
63 Ga0070696_100018308 3300005546 Bacteria 4733
64 Ga0070665_100001724 3300005548 Bacteria 25012
65 Ga0070665_100050322 3300005548 Bacteria 4181
66 Ga0068855_100000832 3300005563 Bacteria 38157
67 Ga0068855_100047077 3300005563 Bacteria 5096
68 Ga0068855_100119379 3300005563 Bacteria 3019
69 Ga0070664_100000514 3300005564 Bacteria 29415
70 Ga0068856_100000679 3300005614 Bacteria 36874
71 Ga0068852_100184890 3300005616 Bacteria 1962
72 Ga0068859_100141282 3300005617 Bacteria 2481
73 Ga0068864_100000413 3300005618 Bacteria 37037
74 Ga0068863_100001085 3300005841 Bacteria 27245
75 Ga0068863_100007527 3300005841 Bacteria 10650
76 Ga0068863_100213756 3300005841 Bacteria 1857
77 Ga0068858_100003733 3300005842 Bacteria 15071
78 Ga0068860_100195910 3300005843 Bacteria 1956
79 Ga0068862_100006430 3300005844 Bacteria 9767
80 Ga0075365_10001468 3300006038 Bacteria 10712
81 Ga0075365_10051041 3300006038 Bacteria 2730
82 Ga0075366_10146294 3300006195 Bacteria 1430
83 Ga0097621_100004313 3300006237 Bacteria 9881
84 Ga0097621_100024442 3300006237 Bacteria 4718
85 Ga0097621_100056910 3300006237 Bacteria 3195
86 Ga0068871_100008335 3300006358 Bacteria 7451
87 Ga0068871_100015571 3300006358 Bacteria 5698
88 Ga0075434_100036572 3300006871 Bacteria 4857
89 Ga0068865_100033065 3300006881 Bacteria 3460
90 Ga0075436_100000152 3300006914 Bacteria 42960
91 Ga0097620_100141285 3300006931 Bacteria 2481
92 Ga0079104_1000024 3300006946 Bacteria 219543
93 Ga0099826_10000113 3300006948 Bacteria 36930
94 Ga0105240_10002050 3300009093 Bacteria 33144
95 Ga0105240_10006656 3300009093 Bacteria 16948
96 Ga0105240_10030486 3300009093 Bacteria 7010
97 Ga0111539_10101724 3300009094 Bacteria 3374
98 Ga0111539_10165546 3300009094 Bacteria 2585
99 Ga0114129_10058647 3300009147 Bacteria 5384
100 Ga0105248_10017581 3300009177 Bacteria 7886
101 Ga0105248_10068130 3300009177 Bacteria 3996
102 Ga0105248_10280463 3300009177 Bacteria 1876
103 Ga0105237_10021166 3300009545 Bacteria 6689
104 Ga0105238_10000006 3300009551 Bacteria 346249
105 Ga0105239_10002999 3300010375 Bacteria 21046
106 Ga0157373_10091852 3300013100 Bacteria 2138
107 Ga0157371_10000273 3300013102 Bacteria 70036
108 Ga0157369_10027101 3300013105 Bacteria 6354
109 Ga0157369_10453631 3300013105 Bacteria 1328
110 Ga0157378_10026912 3300013297 Bacteria 5072
111 Ga0157372_10002025 3300013307 Bacteria 22020
112 Ga0157375_10033534 3300013308 Bacteria 4879
113 Ga0157375_10104919 3300013308 Bacteria 2916
114 Ga0157380_10046333 3300014326 Bacteria 3414
115 Ga0157379_10003077 3300014968 Bacteria 14101
116 Ga0157379_10283436 3300014968 Bacteria 1508
117 Ga0157376_10002703 3300014969 Bacteria 12074
118 Ga0182006_1001498 3300015261 Bacteria 14002
119 Ga0182006_1037449 3300015261 Bacteria 1922
120 Ga0163161_10022160 3300017792 Bacteria 4471
121 Ga0213872_10018675 3300021361 Bacteria 3195
122 Ga0213875_10000045 3300021388 Bacteria 150013
123 Ga0209784_100009 3300025224 Bacteria 688031
124 Ga0209566_100007 3300025225 Bacteria 688031
125 Ga0209674_100018 3300025226 Bacteria 688031
126 Ga0209563_100020 3300025230 Bacteria 688031
127 Ga0209437_100117 3300025233 Bacteria 209271
128 Ga0209677_100010 3300025253 Bacteria 688031
129 Ga0209565_1000426 3300025263 Bacteria 34052
130 Ga0209130_1012022 3300025284 Bacteria 2287
131 Ga0209675_1000174 3300025291 Bacteria 74594
132 Ga0209675_1000426 3300025291 Bacteria 34022
133 Ga0209675_1001705 3300025291 Bacteria 12141
134 Ga0209675_1003777 3300025291 Bacteria 7010
135 Ga0209675_1005891 3300025291 Bacteria 5027
136 Ga0209676_1001413 3300025292 Bacteria 22998
137 Ga0209676_1003226 3300025292 Bacteria 10303
138 Ga0209025_1000019 3300025294 Bacteria 631548
139 Ga0209025_1001481 3300025294 Bacteria 30488
140 Ga0209025_1001800 3300025294 Bacteria 25408
141 Ga0209025_1012535 3300025294 Bacteria 5424
142 Ga0209564_1000145 3300025295 Bacteria 175251
143 Ga0209564_1001261 3300025295 Bacteria 27868
144 Ga0209564_1004730 3300025295 Bacteria 8150
145 Ga0209758_1015363 3300025297 Bacteria 3972
146 Ga0209050_1000995 3300025298 Bacteria 35798
147 Ga0209050_1002538 3300025298 Bacteria 15264
148 Ga0209050_1011490 3300025298 Bacteria 4189
149 Ga0209256_1000011 3300025299 Bacteria 865309
150 Ga0209256_1003493 3300025299 Bacteria 10955
151 Ga0209051_1000016 3300025303 Bacteria 541891
152 Ga0209257_1000102 3300025304 Bacteria 251074
153 Ga0209257_1011872 3300025304 Bacteria 4119
154 Ga0207656_10024353 3300025321 Bacteria 2447
155 Ga0207682_10001414 3300025893 Bacteria 11095
156 Ga0207680_10143542 3300025903 Bacteria 1585
157 Ga0207680_10246582 3300025903 Bacteria 1232
158 Ga0207685_10028511 3300025905 Bacteria 1967
159 Ga0207699_10096866 3300025906 Bacteria 1863
160 Ga0207645_10029835 3300025907 Bacteria 3514
161 Ga0207645_10076706 3300025907 Bacteria 2141
162 Ga0207684_10002044 3300025910 Bacteria 20769
163 Ga0207684_10003548 3300025910 Bacteria 15204
164 Ga0207695_10002139 3300025913 Bacteria 29918
165 Ga0207695_10004925 3300025913 Bacteria 17994
166 Ga0207695_10163480 3300025913 Bacteria 2155
167 Ga0207671_10009496 3300025914 Bacteria 8125
168 Ga0207657_10000751 3300025919 Bacteria 34386
169 Ga0207652_10078365 3300025921 Bacteria 2885
170 Ga0207652_10161059 3300025921 Bacteria 2012
171 Ga0207681_10049443 3300025923 Bacteria 2842
172 Ga0207681_10057988 3300025923 Bacteria 2649
173 Ga0207694_10000110 3300025924 Bacteria 85854
174 Ga0207650_10006132 3300025925 Bacteria 8189
175 Ga0207659_10009868 3300025926 Bacteria 5977
176 Ga0207659_10034922 3300025926 Bacteria 3471
177 Ga0207659_10119529 3300025926 Bacteria 2017
178 Ga0207659_10180678 3300025926 Bacteria 1671
179 Ga0207644_10010435 3300025931 Bacteria 6122
180 Ga0207644_10011942 3300025931 Bacteria 5759
181 Ga0207644_10023170 3300025931 Bacteria 4249
182 Ga0207690_10000861 3300025932 Bacteria 19453
183 Ga0207706_10000386 3300025933 Bacteria 48203
184 Ga0207706_10041990 3300025933 Bacteria 4052
185 Ga0207706_10224636 3300025933 Bacteria 1644
186 Ga0207670_10039906 3300025936 Bacteria 3078
187 Ga0207669_10055768 3300025937 Bacteria 2395
188 Ga0207669_10081515 3300025937 Bacteria 2073
189 Ga0207704_10031264 3300025938 Bacteria 2997
190 Ga0207665_10003961 3300025939 Bacteria 9907
191 Ga0207665_10165952 3300025939 Bacteria 1591
192 Ga0207691_10021182 3300025940 Bacteria 6142
193 Ga0207691_10025603 3300025940 Bacteria 5538
194 Ga0207691_10025760 3300025940 Bacteria 5520
195 Ga0207691_10159540 3300025940 Bacteria 1979
196 Ga0207711_10018500 3300025941 Bacteria 5793
197 Ga0207711_10027259 3300025941 Bacteria 4798
198 Ga0207711_10120386 3300025941 Bacteria 2343
199 Ga0207711_10130440 3300025941 Bacteria 2253
200 Ga0207679_10003757 3300025945 Bacteria 9409
201 Ga0207679_10072842 3300025945 Bacteria 2596
202 Ga0207667_10006563 3300025949 Bacteria 14075
203 Ga0207667_10009687 3300025949 Bacteria 11334
204 Ga0207667_10016670 3300025949 Bacteria 8292
205 Ga0207667_10022444 3300025949 Bacteria 6971
206 Ga0207651_10012347 3300025960 Bacteria 4830
207 Ga0207651_10040198 3300025960 Bacteria 3091
208 Ga0207651_10047941 3300025960 Bacteria 2884
209 Ga0207712_10017156 3300025961 Bacteria 4698
210 Ga0207640_10085914 3300025981 Bacteria 2164
211 Ga0207658_10094268 3300025986 Bacteria 2329
212 Ga0207703_10018295 3300026035 Bacteria 5472
213 Ga0207639_10002272 3300026041 Bacteria 12924
214 Ga0207639_10093290 3300026041 Bacteria 2414
215 Ga0207678_10118830 3300026067 Bacteria 2256
216 Ga0207702_10012900 3300026078 Bacteria 6950
217 Ga0207702_10023862 3300026078 Bacteria 5074
218 Ga0207641_10001191 3300026088 Bacteria 26088
219 Ga0207641_10001998 3300026088 Bacteria 19461
220 Ga0207641_10184377 3300026088 Bacteria 1914
221 Ga0207648_10063998 3300026089 Bacteria 3205
222 Ga0207676_10000453 3300026095 Bacteria 34510
223 Ga0207676_10076869 3300026095 Bacteria 2699
224 Ga0207676_10251720 3300026095 Bacteria 1590
225 Ga0207675_100054172 3300026118 Bacteria 3742
226 Ga0207675_100096651 3300026118 Bacteria 2781
227 Ga0207675_100135936 3300026118 Bacteria 2332
228 Ga0207683_10063706 3300026121 Bacteria 3248
229 Ga0207698_10026389 3300026142 Bacteria 4109
230 Ga0207698_10246277 3300026142 Bacteria 1632
231 Ga0209281_1000104 3300027111 Bacteria 221056
232 Ga0209371_1010344 3300027312 Bacteria 2880
233 Ga0209969_1009871 3300027360 Bacteria 1363
234 Ga0209995_1001845 3300027471 Bacteria 3306
235 Ga0209968_1003707 3300027526 Bacteria 2291
236 Ga0209970_1000507 3300027614 Bacteria 6685
237 Ga0209983_1002261 3300027665 Bacteria 4231
238 Ga0209966_1001408 3300027695 Bacteria 4199
239 Ga0209974_10001561 3300027876 Bacteria 8314
240 Ga0209974_10010175 3300027876 Bacteria 3176
241 Ga0268266_10049171 3300028379 Bacteria 3615
242 Ga0268265_10034016 3300028380 Bacteria 3711
243 Ga0268256_1010656 3300030500 Bacteria 2963
244 Ga0316177_1014409 3300030731 Bacteria 1649
245 Ga0314311_1073099 3300030733 Bacteria 10180
246 Ga0316178_1052160 3300030735 Bacteria 3081
247 Ga0316180_1060727 3300030736 Bacteria 3607
248 Ga0316181_1164487 3300030744 Bacteria 4254
249 Ga0316182_1166823 3300030745 Bacteria 2521
250 Ga0265760_10031859 3300031090 Bacteria 1555
251 Ga0307408_100004825 3300031548 Bacteria 9086
252 Ga0307408_100041232 3300031548 Bacteria 3272
253 Ga0307408_100075171 3300031548 Bacteria 2509
254 Ga0307408_100228062 3300031548 Bacteria 1523
255 Ga0307405_10001413 3300031731 Bacteria 10109
256 Ga0307413_10012313 3300031824 Bacteria 4253
257 Ga0307410_10012649 3300031852 Bacteria 4889
258 Ga0307406_10000689 3300031901 Bacteria 19156
259 Ga0307406_10005939 3300031901 Bacteria 6700
260 Ga0307412_10000106 3300031911 Bacteria 67067
261 Ga0307412_10004832 3300031911 Bacteria 7519
262 Ga0307409_100018299 3300031995 Bacteria 4705
263 Ga0307416_100040546 3300032002 Bacteria 3618
264 Ga0307414_10048259 3300032004 Bacteria 2936
265 Ga0307411_10022114 3300032005 Bacteria 3737
266 Ga0307415_100021137 3300032126 Bacteria 3993
267 Ga0307510_10037495 3300033180 Bacteria 5377
268 Ga0373923_0005608 3300035111 Bacteria 4273
269 Ga0373954_0003159 3300035118 Bacteria 6963
270 Ga0373956_0016609 3300035119 Bacteria 3093
271 Ga0373946_0013795 3300035171 Bacteria 3042
272 Ga0373955_0001386 3300035172 Bacteria 10297
273 Ga0316574_0002857 3300035398 Bacteria 8770
274 Ga0373924_0010132 3300035410 Bacteria 3470
275 Ga0373935_0022754 3300035692 Bacteria 3847
276 Ga0373927_0057904 3300035695 Bacteria 2506
277 Ga0373933_0005542 3300035724 Bacteria 6877
278 Ga0373937_0002028 3300036401 Bacteria 16914
279 Ga0373937_0088349 3300036401 Bacteria 2869
280 Ga0373937_0151730 3300036401 Bacteria 2171
281 Ga0373925_0024184 3300037068 Bacteria 4434
282 Ga0373925_0157331 3300037068 Bacteria 1788
283 Ga0373925_0275735 3300037068 Bacteria 1354
284 Ga0436364_0195675 3300037853 Bacteria 22937
285 Ga0436361_0168918 3300039447 Bacteria 13423
286 Ga0451807_1918916 3300041486 Bacteria 1999
287 Ga0450911_000322 3300042115 Bacteria 17149
288 Ga0451576_0258790 3300045051 Bacteria 1819
289 Ga0495592_0103981 3300046454 Unclassified 2020
290 Ga0495629_0002190 3300046459 Bacteria 15079
291 Ga0495638_0172116 3300046460 Bacteria 1241
292 Ga0495641_0039006 3300046461 Bacteria 2217
293 Ga0495651_0001006 3300046462 Bacteria 21897
294 Ga0495653_0011823 3300046463 Bacteria 7128
295 Ga0495582_0086577 3300046473 Bacteria 1744
296 Ga0495662_0072540 3300046476 Bacteria 1669
297 Ga0495664_0003228 3300046477 Bacteria 8854
298 Ga0495607_0000468 3300046501 Bacteria 40674
299 Ga0495608_0004042 3300046511 Bacteria 10529
300 Ga0495618_0000741 3300046514 Bacteria 22826
301 Ga0495654_0003050 3300046530 Bacteria 10432
302 Ga0495640_0005375 3300046533 Bacteria 10189
303 Ga0495586_0003565 3300046535 Bacteria 8342
304 Ga0495621_0034949 3300046539 Bacteria 1738
305 Ga0495621_0036317 3300046539 Bacteria 1710
306 Ga0495645_0076077 3300046543 Bacteria 2416
307 Ga0495667_0000654 3300046559 Bacteria 22139
308 Ga0495656_0000176 3300046615 Bacteria 22627
309 Ga0495634_0004062 3300046642 Bacteria 11588
310 Ga0495625_0002799 3300046660 Bacteria 18380
311 Ga0495635_0003108 3300046663 Bacteria 11421
312 Ga0495657_0010768 3300046675 Bacteria 6870
313 Ga0495623_0005708 3300046679 Bacteria 8129
314 Ga0495646_0001331 3300046680 Bacteria 14585
315 Ga0495658_0009649 3300046683 Bacteria 4813
316 Ga0495658_0141609 3300046683 Bacteria 1471
317 Ga0495613_0335844 3300046689 Bacteria 1040
318 Ga0495624_0009016 3300046690 Bacteria 6933
319 Ga0495600_0027570 3300046809 Bacteria 3670
320 Ga0495581_0224721 3300047315 Bacteria 1098
321 Ga0495604_0001231 3300047317 Bacteria 20971
322 Ga0495674_0002137 3300047319 Bacteria 19412
323 Ga0495680_0002906 3300047322 Bacteria 17209
324 Ga0495687_006653 3300047443 Bacteria 7023
325 Ga0495675_0017647 3300047444 Bacteria 4525
326 Ga0495684_0002299 3300047471 Bacteria 15301
327 Ga0495602_0011794 3300048088 Bacteria 9027
328 Ga0495615_0007864 3300048090 Bacteria 2039
329 Ga0495615_0008656 3300048090 Bacteria 1976
330 Ga0496102_0064195 3300048905 Bacteria 3363
331 Ga0496102_0372928 3300048905 Bacteria 1343
332 Ga0496103_0048741 3300048906 Bacteria 2618
333 Ga0496104_0068141 3300048907 Bacteria 3381
334 Ga0496105_0139402 3300048908 Bacteria 1997
335 Ga0496108_0175913 3300048911 Bacteria 1853
336 Ga0496109_0421429 3300048912 Bacteria 1261
337 Ga0496110_0087967 3300048913 Bacteria 2774
338 Ga0496110_0299077 3300048913 Bacteria 1466
339 Ga0496114_0007110 3300048917 Bacteria 8831
340 Ga0496114_0128126 3300048917 Bacteria 2190
341 Ga0496116_0010215 3300048919 Bacteria 7896
342 Ga0496116_0015566 3300048919 Bacteria 6007
343 Ga0496116_0041832 3300048919 Bacteria 3140
344 Ga0496118_0009498 3300048921 Bacteria 9806
345 Ga0496120_0003586 3300048923 Bacteria 13947
346 Ga0496121_0000165 3300048924 Bacteria 145052
347 Ga0496121_0003822 3300048924 Bacteria 20965
348 Ga0496121_0004161 3300048924 Bacteria 19780
349 Ga0496121_0013484 3300048924 Bacteria 8774
350 Ga0496121_0016988 3300048924 Bacteria 7470
351 Ga0496121_0085333 3300048924 Bacteria 2486
352 Ga0496122_0000618 3300048925 Bacteria 72850
353 Ga0496122_0000936 3300048925 Bacteria 53067
354 Ga0496122_0001626 3300048925 Bacteria 35051
355 Ga0496122_0144006 3300048925 Bacteria 1485
356 Ga0496123_0001075 3300048926 Bacteria 41273
357 Ga0496123_0001275 3300048926 Bacteria 36068
358 Ga0496123_0001319 3300048926 Bacteria 35071
359 Ga0496124_0000046 3300048927 Bacteria 287043
360 Ga0496124_0055511 3300048927 Bacteria 3347
361 Ga0496124_0084004 3300048927 Bacteria 2611
362 Ga0496124_0112734 3300048927 Bacteria 2186
363 Ga0496125_0000121 3300048928 Bacteria 174971
364 Ga0496125_0002327 3300048928 Bacteria 25024
365 Ga0501039_0020589 3300049575 Bacteria 5055
366 Ga0501040_0025479 3300049576 Bacteria 3976
367 Ga0501041_0007764 3300049577 Bacteria 6299
368 Ga0501042_0016216 3300049578 Bacteria 5111
369 Ga0501046_0063123 3300049580 Bacteria 2893
370 Ga0501069_0041582 3300049585 Bacteria 2541
371 Ga0501071_0089139 3300049587 Bacteria 2263
372 Ga0501072_0034096 3300049588 Bacteria 3989
373 Ga0501075_0084581 3300049591 Bacteria 2403
374 Ga0501076_0053398 3300049592 Bacteria 3202
375 Ga0501225_0004004 3300049705 Bacteria 4410
376 Ga0501081_0011654 3300049743 Bacteria 5755
377 Ga0501262_000429 3300049759 Bacteria 5047
378 Ga0501045_0002422 3300049824 Bacteria 12679
379 nmdc:mga0yw44_109886_c1 3300050492 Bacteria 1765
380 nmdc:mga0yw44_12493_c1 3300050492 Bacteria 4430
381 nmdc:mga0n895_8462_c1 3300050512 Bacteria 8908
382 nmdc:mga08x19_7794_c1 3300050514 Bacteria 6361
383 Ga0495601_0014875 3300053077 Bacteria 4697
384 Ga0495601_0048126 3300053077 Bacteria 2685
385 Ga0495612_0005438 3300053078 Bacteria 5265
386 Ga0495595_0005927 3300053084 Bacteria 4956
387 Ga0495619_0049364 3300053085 Bacteria 2775
388 Ga0500562_002948 3300053108 Bacteria 4246
389 Ga0500593_043661 3300053117 Bacteria 2000
390 Ga0500618_000716 3300053125 Bacteria 19145
391 Ga0500618_000823 3300053125 Bacteria 17028
392 Ga0500559_0003326 3300053136 Bacteria 7962
393 Ga0500637_0118115 3300053178 Bacteria 1539
394 Ga0501084_0045106 3300054114 Bacteria 3692
395 Ga0501082_0013050 3300060353 Bacteria 7141
396 Ga0530510_0002791 3300061734 Bacteria 12020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0224721 Ga0495581_0224721_158_1075 303
2 3300046473 Ga0495582_0086577 Ga0495582_0086577_764_1729 319
3 3300046689 Ga0495613_0335844 Ga0495613_0335844_27_992 319
4 3300048913 Ga0496110_0299077 Ga0496110_0299077_88_1287 332
5 3300005544 Ga0070686_100004065 Ga0070686_1000040656 335
6 3300006237 Ga0097621_100004313 Ga0097621_10000431310 335
7 3300006358 Ga0068871_100008335 Ga0068871_1000083355 335
8 3300049585 Ga0501069_0041582 Ga0501069_0041582_147_1304 336
9 3300006914 Ga0075436_100000152 Ga0075436_10000015231 337
10 3300053117 Ga0500593_043661 Ga0500593_043661_100_1287 337
11 3300025936 Ga0207670_10039906 Ga0207670_100399064 338
12 3300025941 Ga0207711_10120386 Ga0207711_101203861 338
13 3300048912 Ga0496109_0421429 Ga0496109_0421429_117_1208 338
14 3300035111 Ga0373923_0005608 Ga0373923_0005608_1470_2660 339
15 3300035118 Ga0373954_0003159 Ga0373954_0003159_3583_4773 339
16 3300035119 Ga0373956_0016609 Ga0373956_0016609_1803_2993 339
17 3300035171 Ga0373946_0013795 Ga0373946_0013795_968_2158 339
18 3300035172 Ga0373955_0001386 Ga0373955_0001386_5418_6608 339
19 3300035410 Ga0373924_0010132 Ga0373924_0010132_446_1636 339
20 3300035692 Ga0373935_0022754 Ga0373935_0022754_340_1530 339
21 3300035724 Ga0373933_0005542 Ga0373933_0005542_4852_6042 339
22 3300036401 Ga0373937_0002028 Ga0373937_0002028_4597_5787 339
23 3300037068 Ga0373925_0024184 Ga0373925_0024184_3178_4368 339
24 3300046459 Ga0495629_0002190 Ga0495629_0002190_11747_12937 339
25 3300046461 Ga0495641_0039006 Ga0495641_0039006_154_1344 339
26 3300046462 Ga0495651_0001006 Ga0495651_0001006_9962_11152 339
27 3300046463 Ga0495653_0011823 Ga0495653_0011823_2356_3546 339
28 3300046476 Ga0495662_0072540 Ga0495662_0072540_388_1578 339
29 3300046477 Ga0495664_0003228 Ga0495664_0003228_5324_6514 339
30 3300046511 Ga0495608_0004042 Ga0495608_0004042_3224_4414 339
31 3300046514 Ga0495618_0000741 Ga0495618_0000741_11359_12549 339
32 3300046533 Ga0495640_0005375 Ga0495640_0005375_7184_8374 339
33 3300046543 Ga0495645_0076077 Ga0495645_0076077_672_1862 339
34 3300046559 Ga0495667_0000654 Ga0495667_0000654_9065_10255 339
35 3300046642 Ga0495634_0004062 Ga0495634_0004062_4712_5902 339
36 3300046663 Ga0495635_0003108 Ga0495635_0003108_5576_6766 339
37 3300046675 Ga0495657_0010768 Ga0495657_0010768_1298_2488 339
38 3300046679 Ga0495623_0005708 Ga0495623_0005708_5522_6712 339
39 3300046680 Ga0495646_0001331 Ga0495646_0001331_7960_9150 339
40 3300046683 Ga0495658_0009649 Ga0495658_0009649_939_2129 339
41 3300046690 Ga0495624_0009016 Ga0495624_0009016_2741_3931 339
42 3300046809 Ga0495600_0027570 Ga0495600_0027570_1620_2810 339
43 3300047317 Ga0495604_0001231 Ga0495604_0001231_9495_10685 339
44 3300047319 Ga0495674_0002137 Ga0495674_0002137_11538_12728 339
45 3300047322 Ga0495680_0002906 Ga0495680_0002906_7018_8208 339
46 3300047444 Ga0495675_0017647 Ga0495675_0017647_404_1594 339
47 3300047471 Ga0495684_0002299 Ga0495684_0002299_5511_6701 339
48 3300048088 Ga0495602_0011794 Ga0495602_0011794_4614_5804 339
49 3300053077 Ga0495601_0014875 Ga0495601_0014875_2718_3908 339
50 3300053078 Ga0495612_0005438 Ga0495612_0005438_840_2030 339
51 3300053084 Ga0495595_0005927 Ga0495595_0005927_3556_4746 339
52 3300048090 Ga0495615_0007864 Ga0495615_0007864_689_1876 340
53 3300048925 Ga0496122_0000618 Ga0496122_0000618_53955_55151 340
54 3300048926 Ga0496123_0001275 Ga0496123_0001275_29364_30560 340
55 3300053136 Ga0500559_0003326 Ga0500559_0003326_4982_6178 340
56 3300027614 Ga0209970_1000507 Ga0209970_10005072 342
57 3300030745 Ga0316182_1166823 Ga0316182_11668232 342
58 3300042115 Ga0450911_000322 Ga0450911_000322_4025_5209 343
59 3300030733 Ga0314311_1073099 Ga0314311_10730997 344
60 3300030735 Ga0316178_1052160 Ga0316178_10521602 344
61 3300047443 Ga0495687_006653 Ga0495687_006653_247_1431 344
62 3300048924 Ga0496121_0004161 Ga0496121_0004161_3733_5043 344
63 3300049759 Ga0501262_000429 Ga0501262_000429_2615_3823 344
64 3300041486 Ga0451807_1918916 Ga0451807_1918916_587_1741 345
65 3300030731 Ga0316177_1014409 Ga0316177_10144092 346
66 3300030744 Ga0316181_1164487 Ga0316181_11644872 346
67 3300031548 Ga0307408_100228062 Ga0307408_1002280621 346
68 3300031901 Ga0307406_10000689 Ga0307406_1000068910 346
69 3300049705 Ga0501225_0004004 Ga0501225_0004004_467_1675 346
70 3300046530 Ga0495654_0003050 Ga0495654_0003050_5993_7180 347
71 3300048911 Ga0496108_0175913 Ga0496108_0175913_354_1544 347
72 3300048913 Ga0496110_0087967 Ga0496110_0087967_1376_2557 347
73 3300048917 Ga0496114_0128126 Ga0496114_0128126_781_1962 347
74 3300053108 Ga0500562_002948 Ga0500562_002948_1609_2787 348
75 3300025291 Ga0209675_1003777 Ga0209675_10037775 349
76 3300025292 Ga0209676_1003226 Ga0209676_10032267 349
77 3300025294 Ga0209025_1012535 Ga0209025_10125354 349
78 3300025298 Ga0209050_1002538 Ga0209050_10025385 349
79 3300046539 Ga0495621_0034949 Ga0495621_0034949_377_1558 349
80 3300048090 Ga0495615_0008656 Ga0495615_0008656_92_1273 349
81 3300048919 Ga0496116_0010215 Ga0496116_0010215_3161_4357 349
82 3300048924 Ga0496121_0013484 Ga0496121_0013484_7288_8484 349
83 3300009177 Ga0105248_10280463 Ga0105248_102804632 350
84 3300025923 Ga0207681_10057988 Ga0207681_100579883 350
85 3300045051 Ga0451576_0258790 Ga0451576_0258790_128_1306 350
86 3300048927 Ga0496124_0112734 Ga0496124_0112734_654_1850 350
87 3300005518 Ga0070699_100003076 Ga0070699_10000307610 351
88 3300006195 Ga0075366_10146294 Ga0075366_101462942 351
89 3300025910 Ga0207684_10002044 Ga0207684_1000204412 351
90 3300025910 Ga0207684_10003548 Ga0207684_100035483 351
91 3300027312 Ga0209371_1010344 Ga0209371_10103442 351
92 3300030500 Ga0268256_1010656 Ga0268256_10106562 351
93 3300030736 Ga0316180_1060727 Ga0316180_10607272 351
94 3300046460 Ga0495638_0172116 Ga0495638_0172116_20_1171 351
95 3300031548 Ga0307408_100004825 Ga0307408_1000048253 352
96 3300031731 Ga0307405_10001413 Ga0307405_100014134 352
97 3300031824 Ga0307413_10012313 Ga0307413_100123132 352
98 3300031852 Ga0307410_10012649 Ga0307410_100126492 352
99 3300031901 Ga0307406_10005939 Ga0307406_100059395 352
100 3300031911 Ga0307412_10004832 Ga0307412_100048324 352
101 3300031995 Ga0307409_100018299 Ga0307409_1000182994 352
102 3300032002 Ga0307416_100040546 Ga0307416_1000405464 352
103 3300032004 Ga0307414_10048259 Ga0307414_100482593 352
104 3300032005 Ga0307411_10022114 Ga0307411_100221142 352
105 3300032126 Ga0307415_100021137 Ga0307415_1000211373 352
106 3300005328 Ga0070676_10006449 Ga0070676_100064492 353
107 3300005339 Ga0070660_100005338 Ga0070660_1000053384 353
108 3300005354 Ga0070675_100146949 Ga0070675_1001469492 353
109 3300005355 Ga0070671_100011204 Ga0070671_1000112044 353
110 3300005364 Ga0070673_100023967 Ga0070673_1000239673 353
111 3300005366 Ga0070659_100003900 Ga0070659_1000039002 353
112 3300005455 Ga0070663_100005608 Ga0070663_1000056084 353
113 3300005457 Ga0070662_100000114 Ga0070662_1000001148 353
114 3300005539 Ga0068853_100013366 Ga0068853_1000133666 353
115 3300005563 Ga0068855_100000832 Ga0068855_10000083220 353
116 3300005564 Ga0070664_100000514 Ga0070664_10000051419 353
117 3300005614 Ga0068856_100000679 Ga0068856_10000067930 353
118 3300013102 Ga0157371_10000273 Ga0157371_1000027336 353
119 3300013105 Ga0157369_10027101 Ga0157369_100271014 353
120 3300013307 Ga0157372_10002025 Ga0157372_1000202510 353
121 3300025907 Ga0207645_10029835 Ga0207645_100298352 353
122 3300025919 Ga0207657_10000751 Ga0207657_1000075118 353
123 3300025921 Ga0207652_10078365 Ga0207652_100783653 353
124 3300025926 Ga0207659_10119529 Ga0207659_101195292 353
125 3300025931 Ga0207644_10011942 Ga0207644_100119424 353
126 3300025932 Ga0207690_10000861 Ga0207690_100008614 353
127 3300025933 Ga0207706_10000386 Ga0207706_1000038635 353
128 3300025945 Ga0207679_10003757 Ga0207679_100037574 353
129 3300025949 Ga0207667_10009687 Ga0207667_100096875 353
130 3300025960 Ga0207651_10047941 Ga0207651_100479413 353
131 3300026041 Ga0207639_10002272 Ga0207639_100022724 353
132 3300026078 Ga0207702_10012900 Ga0207702_100129002 353
133 3300005844 Ga0068862_100006430 Ga0068862_1000064303 354
134 3300013100 Ga0157373_10091852 Ga0157373_100918521 354
135 3300014326 Ga0157380_10046333 Ga0157380_100463334 354
136 3300017792 Ga0163161_10022160 Ga0163161_100221603 354
137 3300025938 Ga0207704_10031264 Ga0207704_100312643 354
138 3300025940 Ga0207691_10159540 Ga0207691_101595402 354
139 3300025945 Ga0207679_10072842 Ga0207679_100728422 354
140 3300025961 Ga0207712_10017156 Ga0207712_100171563 354
141 3300026041 Ga0207639_10093290 Ga0207639_100932902 354
142 3300026118 Ga0207675_100135936 Ga0207675_1001359362 354
143 3300027665 Ga0209983_1002261 Ga0209983_10022613 354
144 3300027876 Ga0209974_10010175 Ga0209974_100101753 354
145 3300028380 Ga0268265_10034016 Ga0268265_100340163 354
146 3300031548 Ga0307408_100075171 Ga0307408_1000751711 354
147 3300025298 Ga0209050_1011490 Ga0209050_10114902 355
148 3300003784 Ga0055534_1000904 Ga0055534_100090412 356
149 3300003784 Ga0055534_1001105 Ga0055534_10011052 356
150 3300005530 Ga0070679_100108404 Ga0070679_1001084042 356
151 3300025291 Ga0209675_1001705 Ga0209675_100170511 356
152 3300025304 Ga0209257_1011872 Ga0209257_10118723 356
153 3300025921 Ga0207652_10161059 Ga0207652_101610592 356
154 3300025949 Ga0207667_10022444 Ga0207667_100224447 356
155 3300037068 Ga0373925_0157331 Ga0373925_0157331_276_1466 357
156 3300049575 Ga0501039_0020589 Ga0501039_0020589_3668_4870 357
157 3300049576 Ga0501040_0025479 Ga0501040_0025479_1330_2532 357
158 3300049577 Ga0501041_0007764 Ga0501041_0007764_4068_5270 357
159 3300049578 Ga0501042_0016216 Ga0501042_0016216_528_1730 357
160 3300049580 Ga0501046_0063123 Ga0501046_0063123_645_1847 357
161 3300049587 Ga0501071_0089139 Ga0501071_0089139_689_1891 357
162 3300049588 Ga0501072_0034096 Ga0501072_0034096_2624_3826 357
163 3300049591 Ga0501075_0084581 Ga0501075_0084581_65_1267 357
164 3300049592 Ga0501076_0053398 Ga0501076_0053398_938_2140 357
165 3300049743 Ga0501081_0011654 Ga0501081_0011654_964_2166 357
166 3300049824 Ga0501045_0002422 Ga0501045_0002422_11387_12589 357
167 3300054114 Ga0501084_0045106 Ga0501084_0045106_1887_3089 357
168 3300060353 Ga0501082_0013050 Ga0501082_0013050_2303_3505 357
169 3300061734 Ga0530510_0002791 Ga0530510_0002791_10336_11538 357
170 3300003775 Ga0055524_1000158 Ga0055524_100015835 360
171 3300025299 Ga0209256_1000011 Ga0209256_1000011252 360
172 3300048917 Ga0496114_0007110 Ga0496114_0007110_797_1987 360
173 3300005543 Ga0070672_100053736 Ga0070672_1000537362 361
174 3300006038 Ga0075365_10051041 Ga0075365_100510412 361
175 3300031548 Ga0307408_100041232 Ga0307408_1000412321 361
176 3300033180 Ga0307510_10037495 Ga0307510_100374953 361
177 3300037068 Ga0373925_0275735 Ga0373925_0275735_199_1335 362
178 3300048905 Ga0496102_0064195 Ga0496102_0064195_1881_3062 362
179 3300048906 Ga0496103_0048741 Ga0496103_0048741_1190_2371 362
180 3300014968 Ga0157379_10283436 Ga0157379_102834361 363
181 3300025981 Ga0207640_10085914 Ga0207640_100859142 363
182 3300005364 Ga0070673_100101773 Ga0070673_1001017732 364
183 3300005366 Ga0070659_100139421 Ga0070659_1001394211 364
184 3300005456 Ga0070678_100204936 Ga0070678_1002049362 364
185 3300005543 Ga0070672_100104701 Ga0070672_1001047012 364
186 3300006946 Ga0079104_1000024 Ga0079104_1000024121 364
187 3300013308 Ga0157375_10104919 Ga0157375_101049192 364
188 3300025321 Ga0207656_10024353 Ga0207656_100243532 364
189 3300025940 Ga0207691_10025760 Ga0207691_100257602 364
190 3300026067 Ga0207678_10118830 Ga0207678_101188302 364
191 3300026095 Ga0207676_10076869 Ga0207676_100768692 364
192 3300027111 Ga0209281_1000104 Ga0209281_100010481 364
193 3300005356 Ga0070674_100057254 Ga0070674_1000572543 365
194 3300025937 Ga0207669_10055768 Ga0207669_100557683 365
195 3300046539 Ga0495621_0036317 Ga0495621_0036317_273_1478 365
196 3300048924 Ga0496121_0016988 Ga0496121_0016988_1197_2381 365
197 3300048925 Ga0496122_0144006 Ga0496122_0144006_257_1441 365
198 3300048927 Ga0496124_0000046 Ga0496124_0000046_257214_258398 365
199 3300006038 Ga0075365_10001468 Ga0075365_100014684 366
200 3300025960 Ga0207651_10012347 Ga0207651_100123474 366
201 3300050492 nmdc:mga0yw44_12493_c1 nmdc:mga0yw44_12493_c1_667_1863 366
202 3300005333 Ga0070677_10091672 Ga0070677_100916721 367
203 3300046615 Ga0495656_0000176 Ga0495656_0000176_16913_18100 367
204 3300005440 Ga0070705_100034293 Ga0070705_1000342932 368
205 3300005518 Ga0070699_100079418 Ga0070699_1000794183 368
206 3300005536 Ga0070697_100016288 Ga0070697_1000162883 368
207 3300005545 Ga0070695_100011344 Ga0070695_1000113443 368
208 3300005546 Ga0070696_100018308 Ga0070696_1000183085 368
209 3300013105 Ga0157369_10453631 Ga0157369_104536311 368
210 3300025939 Ga0207665_10165952 Ga0207665_101659522 368
211 3300003771 Ga0055526_1006883 Ga0055526_10068836 370
212 3300003771 Ga0055526_1006931 Ga0055526_10069311 370
213 3300003781 Ga0055536_1000677 Ga0055536_100067716 370
214 3300003784 Ga0055534_1000985 Ga0055534_10009858 370
215 3300003791 Ga0055530_10003217 Ga0055530_100032173 370
216 3300003792 Ga0055540_1000035 Ga0055540_1000035144 370
217 3300003794 Ga0055531_10011903 Ga0055531_100119032 370
218 3300025263 Ga0209565_1000426 Ga0209565_100042624 370
219 3300025291 Ga0209675_1000174 Ga0209675_100017427 370
220 3300025291 Ga0209675_1000426 Ga0209675_10004267 370
221 3300025292 Ga0209676_1001413 Ga0209676_100141317 370
222 3300025294 Ga0209025_1001481 Ga0209025_10014817 370
223 3300025294 Ga0209025_1001800 Ga0209025_10018002 370
224 3300025295 Ga0209564_1000145 Ga0209564_100014524 370
225 3300025295 Ga0209564_1001261 Ga0209564_10012617 370
226 3300025295 Ga0209564_1004730 Ga0209564_10047307 370
227 3300025297 Ga0209758_1015363 Ga0209758_10153633 370
228 3300025298 Ga0209050_1000995 Ga0209050_100099531 370
229 3300025299 Ga0209256_1003493 Ga0209256_10034937 370
230 3300025303 Ga0209051_1000016 Ga0209051_100001683 370
231 3300025304 Ga0209257_1000102 Ga0209257_1000102210 370
232 3300035398 Ga0316574_0002857 Ga0316574_0002857_3051_4232 370
233 3300048919 Ga0496116_0041832 Ga0496116_0041832_1023_2216 370
234 3300048924 Ga0496121_0085333 Ga0496121_0085333_1124_2317 370
235 3300005353 Ga0070669_100069692 Ga0070669_1000696923 371
236 3300005354 Ga0070675_100006788 Ga0070675_1000067883 371
237 3300005355 Ga0070671_100024730 Ga0070671_1000247301 371
238 3300005367 Ga0070667_100125127 Ga0070667_1001251272 371
239 3300005459 Ga0068867_100115405 Ga0068867_1001154052 371
240 3300005543 Ga0070672_100055826 Ga0070672_1000558263 371
241 3300006881 Ga0068865_100033065 Ga0068865_1000330653 371
242 3300025893 Ga0207682_10001414 Ga0207682_1000141410 371
243 3300025925 Ga0207650_10006132 Ga0207650_100061322 371
244 3300025926 Ga0207659_10180678 Ga0207659_101806782 371
245 3300025933 Ga0207706_10224636 Ga0207706_102246362 371
246 3300025941 Ga0207711_10130440 Ga0207711_101304402 371
247 3300031090 Ga0265760_10031859 Ga0265760_100318591 371
248 iso_pu_bacteria 2508501128 2509152683 371
249 3300006948 Ga0099826_10000113 Ga0099826_100001137 372
250 3300025291 Ga0209675_1005891 Ga0209675_10058913 372
251 3300035695 Ga0373927_0057904 Ga0373927_0057904_298_1503 372
252 3300046454 Ga0495592_0103981 Ga0495592_0103981_196_1401 372
253 3300048907 Ga0496104_0068141 Ga0496104_0068141_1206_2414 372
254 3300053077 Ga0495601_0048126 Ga0495601_0048126_1194_2399 372
255 3300053085 Ga0495619_0049364 Ga0495619_0049364_684_1889 372
256 iso_pu_bacteria 2574179768 2574432084 372
257 iso_pu_bacteria 2599185292 2599904323 372
258 iso_pu_bacteria 2643221569 2643863731 372
259 iso_pu_bacteria 2643221594 2643982934 372
260 iso_pu_bacteria 2643221621 2644123225 372
261 iso_pu_bacteria 2808606395 2809033524 372
262 iso_pu_bacteria 2857537821 2857537976 372
263 iso_pu_bacteria 2941479691 2941484217 372
264 3300005471 Ga0070698_100004336 Ga0070698_1000043364 373
265 3300005518 Ga0070699_100008557 Ga0070699_1000085572 373
266 3300005536 Ga0070697_100236743 Ga0070697_1002367431 373
267 3300006871 Ga0075434_100036572 Ga0075434_1000365723 373
268 3300009147 Ga0114129_10058647 Ga0114129_100586473 373
269 3300025906 Ga0207699_10096866 Ga0207699_100968662 373
270 3300025939 Ga0207665_10003961 Ga0207665_100039616 373
271 3300050512 nmdc:mga0n895_8462_c1 nmdc:mga0n895_8462_c1_6156_7346 373
272 3300050514 nmdc:mga08x19_7794_c1 nmdc:mga08x19_7794_c1_4371_5561 373
273 iso_pu_bacteria 2643221609 2644057885 373
274 iso_pu_bacteria 2643221611 2644072921 373
275 iso_pu_bacteria 2738543012 2739242161 373
276 iso_pu_bacteria 2816332133 2816470222 373
277 iso_pu_bacteria 2855730933 2855732899 373
278 iso_pu_bacteria 2855767633 2855771651 373
279 iso_pu_bacteria 2857542790 2857546545 373
280 iso_pu_bacteria 2881412998 2881413796 373
281 iso_pu_bacteria 2929520902 2929526697 373
282 3300005468 Ga0070707_100095896 Ga0070707_1000958962 374
283 3300046660 Ga0495625_0002799 Ga0495625_0002799_9743_10936 374
284 3300048925 Ga0496122_0001626 Ga0496122_0001626_9741_10928 374
285 3300048926 Ga0496123_0001319 Ga0496123_0001319_9761_10948 374
286 iso_pu_bacteria 2511231026 2511384283 374
287 iso_pu_bacteria 2521172590 2521559702 374
288 iso_pu_bacteria 2765235838 2765570960 374
289 iso_pu_bacteria 2808606386 2808984867 374
290 iso_pu_bacteria 2808606415 2809128273 374
291 iso_pu_bacteria 2808606419 2809147894 374
292 iso_pu_bacteria 2818991449 2819616075 374
293 iso_pu_bacteria 2839094727 2839099349 374
294 iso_pu_bacteria 2842718218 2842720437 374
295 iso_pu_bacteria 2852618963 2852620694 374
296 iso_pu_bacteria 2884811622 2884815356 374
297 iso_pu_bacteria 2884836552 2884841088 374
298 iso_pu_bacteria 2884852848 2884855963 374
299 iso_pu_bacteria 2896154374 2896157112 374
300 iso_pu_bacteria 2904439833 2904443339 374
301 iso_pu_bacteria 2904530477 2904533048 374
302 iso_pu_bacteria 2904584206 2904585603 374
303 iso_pu_bacteria 2904589729 2904593952 374
304 iso_pu_bacteria 2904601388 2904603895 374
305 iso_pu_bacteria 2919046199 2919047604 374
306 iso_pu_bacteria 2919079590 2919081867 374
307 iso_pu_bacteria 2974320154 2974321382 374
308 3300009094 Ga0111539_10101724 Ga0111539_101017241 375
309 3300021388 Ga0213875_10000045 Ga0213875_1000004547 375
310 3300025905 Ga0207685_10028511 Ga0207685_100285112 375
311 3300036401 Ga0373937_0088349 Ga0373937_0088349_1488_2669 375
312 3300037853 Ga0436364_0195675 Ga0436364_0195675_616_1818 375
313 3300046535 Ga0495586_0003565 Ga0495586_0003565_5636_6817 375
314 3300046683 Ga0495658_0141609 Ga0495658_0141609_218_1399 375
315 iso_pu_bacteria 2881101125 2881103912 375
316 iso_pu_bacteria 2919704043 2919708644 375
317 3300005331 Ga0070670_100135094 Ga0070670_1001350942 376
318 3300005335 Ga0070666_10030465 Ga0070666_100304652 376
319 3300005354 Ga0070675_100015987 Ga0070675_1000159873 376
320 3300005459 Ga0068867_100112621 Ga0068867_1001126211 376
321 3300005543 Ga0070672_100013802 Ga0070672_1000138025 376
322 3300005543 Ga0070672_100027953 Ga0070672_1000279534 376
323 3300005543 Ga0070672_100042182 Ga0070672_1000421821 376
324 3300005548 Ga0070665_100001724 Ga0070665_1000017243 376
325 3300005548 Ga0070665_100050322 Ga0070665_1000503222 376
326 3300005616 Ga0068852_100184890 Ga0068852_1001848902 376
327 3300005841 Ga0068863_100007527 Ga0068863_1000075275 376
328 3300005841 Ga0068863_100213756 Ga0068863_1002137561 376
329 3300006237 Ga0097621_100024442 Ga0097621_1000244424 376
330 3300006358 Ga0068871_100015571 Ga0068871_1000155712 376
331 3300009094 Ga0111539_10165546 Ga0111539_101655462 376
332 3300009177 Ga0105248_10017581 Ga0105248_100175813 376
333 3300014969 Ga0157376_10002703 Ga0157376_100027034 376
334 3300025903 Ga0207680_10143542 Ga0207680_101435421 376
335 3300025903 Ga0207680_10246582 Ga0207680_102465821 376
336 3300025923 Ga0207681_10049443 Ga0207681_100494432 376
337 3300025926 Ga0207659_10009868 Ga0207659_100098683 376
338 3300025931 Ga0207644_10010435 Ga0207644_100104353 376
339 3300025937 Ga0207669_10081515 Ga0207669_100815153 376
340 3300025940 Ga0207691_10021182 Ga0207691_100211824 376
341 3300025940 Ga0207691_10025603 Ga0207691_100256032 376
342 3300025941 Ga0207711_10027259 Ga0207711_100272593 376
343 3300026088 Ga0207641_10001998 Ga0207641_100019989 376
344 3300026088 Ga0207641_10184377 Ga0207641_101843772 376
345 3300026089 Ga0207648_10063998 Ga0207648_100639983 376
346 3300026095 Ga0207676_10251720 Ga0207676_102517201 376
347 3300026118 Ga0207675_100054172 Ga0207675_1000541723 376
348 3300026118 Ga0207675_100096651 Ga0207675_1000966511 376
349 3300026142 Ga0207698_10246277 Ga0207698_102462771 376
350 3300027360 Ga0209969_1009871 Ga0209969_10098711 376
351 3300027471 Ga0209995_1001845 Ga0209995_10018453 376
352 3300027526 Ga0209968_1003707 Ga0209968_10037073 376
353 3300027695 Ga0209966_1001408 Ga0209966_10014083 376
354 3300027876 Ga0209974_10001561 Ga0209974_100015615 376
355 3300028379 Ga0268266_10049171 Ga0268266_100491714 376
356 3300031911 Ga0307412_10000106 Ga0307412_1000010640 376
357 3300048905 Ga0496102_0372928 Ga0496102_0372928_127_1329 376
358 3300048908 Ga0496105_0139402 Ga0496105_0139402_657_1847 376
359 3300048923 Ga0496120_0003586 Ga0496120_0003586_12081_13271 376
360 3300048924 Ga0496121_0000165 Ga0496121_0000165_118688_119878 376
361 3300048925 Ga0496122_0000936 Ga0496122_0000936_4556_5746 376
362 3300048926 Ga0496123_0001075 Ga0496123_0001075_4617_5807 376
363 3300048927 Ga0496124_0055511 Ga0496124_0055511_248_1438 376
364 3300048927 Ga0496124_0084004 Ga0496124_0084004_179_1369 376
365 3300048928 Ga0496125_0000121 Ga0496125_0000121_129155_130345 376
366 3300053178 Ga0500637_0118115 Ga0500637_0118115_328_1521 376
367 iso_pu_bacteria 2738541277 2738719510 376
368 iso_pu_bacteria 2738543013 2739248112 376
369 iso_pu_bacteria 2738543019 2739283668 376
370 3300003187 JGI25151J46595_10013441 JGI25151J46595_100134412 377
371 3300005330 Ga0070690_100001379 Ga0070690_1000013795 377
372 3300005338 Ga0068868_100000620 Ga0068868_10000062017 377
373 3300005354 Ga0070675_100000657 Ga0070675_10000065719 377
374 3300005355 Ga0070671_100003866 Ga0070671_1000038662 377
375 3300005364 Ga0070673_100090814 Ga0070673_1000908142 377
376 3300005563 Ga0068855_100047077 Ga0068855_1000470774 377
377 3300005617 Ga0068859_100141282 Ga0068859_1001412822 377
378 3300005618 Ga0068864_100000413 Ga0068864_10000041323 377
379 3300005841 Ga0068863_100001085 Ga0068863_1000010858 377
380 3300005842 Ga0068858_100003733 Ga0068858_1000037336 377
381 3300005843 Ga0068860_100195910 Ga0068860_1001959102 377
382 3300006237 Ga0097621_100056910 Ga0097621_1000569103 377
383 3300006931 Ga0097620_100141285 Ga0097620_1001412852 377
384 3300009093 Ga0105240_10030486 Ga0105240_100304863 377
385 3300009177 Ga0105248_10068130 Ga0105248_100681302 377
386 3300009545 Ga0105237_10021166 Ga0105237_100211665 377
387 3300009551 Ga0105238_10000006 Ga0105238_10000006238 377
388 3300010375 Ga0105239_10002999 Ga0105239_1000299910 377
389 3300013297 Ga0157378_10026912 Ga0157378_100269122 377
390 3300013308 Ga0157375_10033534 Ga0157375_100335342 377
391 3300014968 Ga0157379_10003077 Ga0157379_1000307710 377
392 3300015261 Ga0182006_1001498 Ga0182006_10014984 377
393 3300025284 Ga0209130_1012022 Ga0209130_10120221 377
394 3300025294 Ga0209025_1000019 Ga0209025_1000019187 377
395 3300025907 Ga0207645_10076706 Ga0207645_100767062 377
396 3300025913 Ga0207695_10002139 Ga0207695_1000213914 377
397 3300025914 Ga0207671_10009496 Ga0207671_100094963 377
398 3300025924 Ga0207694_10000110 Ga0207694_1000011047 377
399 3300025926 Ga0207659_10034922 Ga0207659_100349221 377
400 3300025931 Ga0207644_10023170 Ga0207644_100231702 377
401 3300025933 Ga0207706_10041990 Ga0207706_100419903 377
402 3300025941 Ga0207711_10018500 Ga0207711_100185004 377
403 3300025949 Ga0207667_10016670 Ga0207667_100166707 377
404 3300025960 Ga0207651_10040198 Ga0207651_100401983 377
405 3300025986 Ga0207658_10094268 Ga0207658_100942682 377
406 3300026035 Ga0207703_10018295 Ga0207703_100182956 377
407 3300026088 Ga0207641_10001191 Ga0207641_1000119112 377
408 3300026095 Ga0207676_10000453 Ga0207676_1000045324 377
409 3300026121 Ga0207683_10063706 Ga0207683_100637062 377
410 3300036401 Ga0373937_0151730 Ga0373937_0151730_806_2014 377
411 3300046501 Ga0495607_0000468 Ga0495607_0000468_4514_5722 377
412 3300048921 Ga0496118_0009498 Ga0496118_0009498_4004_5269 377
413 3300050492 nmdc:mga0yw44_109886_c1 nmdc:mga0yw44_109886_c1_428_1612 377
414 iso_pu_bacteria 2842677519 2842681310 377
415 iso_pu_bacteria 2842733646 2842738841 377
416 iso_pu_bacteria 2904479285 2904481437 377
417 iso_pu_bacteria 2919462493 2919464647 377
418 iso_pu_bacteria 2954767861 2954770245 377
419 3300002737 JGI25162J39368_1004586 JGI25162J39368_10045863 378
420 3300003751 Ga0055538_1000141 Ga0055538_100014116 378
421 3300003752 Ga0055539_1000192 Ga0055539_100019216 378
422 3300003756 Ga0055533_1000192 Ga0055533_100019216 378
423 3300003759 Ga0055525_1000260 Ga0055525_100026034 378
424 3300003841 Ga0055541_1000127 Ga0055541_100012716 378
425 3300005563 Ga0068855_100119379 Ga0068855_1001193792 378
426 3300009093 Ga0105240_10002050 Ga0105240_100020506 378
427 3300009093 Ga0105240_10006656 Ga0105240_1000665613 378
428 3300015261 Ga0182006_1037449 Ga0182006_10374492 378
429 3300021361 Ga0213872_10018675 Ga0213872_100186751 378
430 3300025224 Ga0209784_100009 Ga0209784_100009530 378
431 3300025225 Ga0209566_100007 Ga0209566_100007530 378
432 3300025226 Ga0209674_100018 Ga0209674_100018530 378
433 3300025230 Ga0209563_100020 Ga0209563_100020530 378
434 3300025233 Ga0209437_100117 Ga0209437_100117132 378
435 3300025253 Ga0209677_100010 Ga0209677_100010530 378
436 3300025913 Ga0207695_10004925 Ga0207695_100049253 378
437 3300025913 Ga0207695_10163480 Ga0207695_101634802 378
438 3300025949 Ga0207667_10006563 Ga0207667_100065639 378
439 3300026078 Ga0207702_10023862 Ga0207702_100238623 378
440 3300026142 Ga0207698_10026389 Ga0207698_100263893 378
441 3300039447 Ga0436361_0168918 Ga0436361_0168918_122_1405 378
442 3300048919 Ga0496116_0015566 Ga0496116_0015566_2726_3913 378
443 3300048924 Ga0496121_0003822 Ga0496121_0003822_12263_13450 378
444 3300048928 Ga0496125_0002327 Ga0496125_0002327_2449_3633 378
445 3300053125 Ga0500618_000716 Ga0500618_000716_9667_10854 378
446 3300053125 Ga0500618_000823 Ga0500618_000823_7893_9089 378

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

63

404

0.9

PF13433

Peripla_BP_5

Periplasmic binding protein domain

64

392

0.78

PF01094

ANF_receptor

Receptor family ligand binding region

83

407

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8792 15 374
4mlc-assembly1.cif.gz_A abc transporter substrate-binding protein fromdesulfitobacterium hafniense 0.8786 14 374
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8745 15 374
4mlc-assembly1.cif.gz_A abc transporter substrate-binding protein fromdesulfitobacterium hafniense 0.8738 14 374
4q6w-assembly1.cif.gz_A crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid 0.8736 16 375
ID Description Score Start End Superfamily
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9219 56 137 3.40.50.2300
af_Q69L07_59_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9198 56 132 3.40.50.2300
af_A0A0R0GSR6_1_159_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9014 14 112 3.40.50.2300
af_P55205_42_169_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9009 13 111 3.40.50.2300
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9009 16 354 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V7FVW6-F1-model_v4 Ethanolamine utilization protein EutN 0.958 99 374
AF-A0A847ZN37-F1-model_v4 deleted 0.9542 16 148
AF-A0A661RT29-F1-model_v4 Leucine-binding protein domain-containing protein 0.9481 15 151
AF-A0A6B3IFG0-F1-model_v4 ABC transporter substrate-binding protein 0.9479 14 115
AF-A0A2V6S585-F1-model_v4 ABC transporter substrate-binding protein 0.9464 14 116 GO:0006865

Feature Viewer

pLDDT pTM Quality
91.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map