F445761

General Info

Members Datasets Scaffolds Average Seq Length
446 276 892 480

Family's Representative Sequence

Representative Sequence 3300035725|Ga0373947_0022761|Ga0373947_0022761_1893_3347
Length 464
Sequence MMKLKDLLTVDALSDARFDMVEVRGITADSRTVKPGDLFVAIAGSKDDGLRFVAPAVAAGAAAVMAERVAQAPLPSHVAFVRVSDARRALALAASRFYPRQPETIAAVTGTSGKTSVAAFTRQIWAATGEAAASIGTIGLVAPGREVYGSLTTPDPVALHRSLDQLARAGVTHLAMEASSHGLDQRRLDGARIAAAAFTNISRDHLDYHPSLEAYLAAKLRLFELVQPRGAAVIDLTVGRKGEGIRLHDVAVEGFAQTLKVAYVGDTYSVRLPLPGAFQVENALVAAGLAIATGSAPQAVFDALSSLRGAKGRLDLAGEKDGAPIFVDYAHKPDALAKALDALRPYASGRLVVVFGCGGDRDAGKRPMMGEIASAKADRVIVTDDNPRSEEPAAIRAAILRASPGAIEIGDRREAIASAIADLRHGDVLLIAGKGHETGQIVGKQTLPFSDHDAVAAALGGNRA

Samples

Sample ID Description Type Environment
1 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
134 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
135 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
271 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
274 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
275 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
276 2643221651 Afipia sp. Root123D2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.22
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 9.19
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373947_0022761 3300035725 Bacteria 3638
2 ARcpr5oldR_c000275 3300000041 Bacteria 7733
3 ARSoilYngRDRAFT_c00425 3300000042 Bacteria 5380
4 ARSoilOldRDRAFT_c000230 3300000044 Bacteria 8490
5 Ga0065715_10000936 3300005293 Bacteria 8355
6 Ga0070658_10007359 3300005327 Bacteria 8892
7 Ga0070690_100035221 3300005330 Bacteria 3140
8 Ga0070666_10071532 3300005335 Bacteria 2361
9 Ga0070680_100018565 3300005336 Bacteria 5497
10 Ga0070680_100104828 3300005336 Bacteria 2350
11 Ga0070660_100123017 3300005339 Bacteria 2071
12 Ga0070689_100007878 3300005340 Bacteria 7471
13 Ga0070669_100002660 3300005353 Bacteria 12871
14 Ga0070669_100028015 3300005353 Bacteria 4056
15 Ga0070671_100183264 3300005355 Bacteria 1773
16 Ga0070674_100009929 3300005356 Bacteria 5730
17 Ga0070674_100122640 3300005356 Bacteria 1926
18 Ga0070688_100027338 3300005365 Bacteria 3398
19 Ga0070659_100008795 3300005366 Bacteria 7396
20 Ga0070709_10003433 3300005434 Bacteria 8502
21 Ga0070713_100010777 3300005436 Bacteria 6621
22 Ga0070713_100030652 3300005436 Bacteria 4273
23 Ga0070713_100058129 3300005436 Bacteria 3224
24 Ga0070710_10015551 3300005437 Bacteria 3854
25 Ga0070710_10055538 3300005437 Bacteria 2238
26 Ga0070701_10006407 3300005438 Bacteria 4950
27 Ga0070711_100014031 3300005439 Bacteria 5042
28 Ga0070711_100056639 3300005439 Bacteria 2712
29 Ga0070711_100073987 3300005439 Bacteria 2409
30 Ga0070663_100004879 3300005455 Bacteria 7915
31 Ga0070663_100006367 3300005455 Bacteria 7094
32 Ga0070678_100078198 3300005456 Bacteria 2498
33 Ga0070681_10018604 3300005458 Bacteria 6946
34 Ga0070681_10056334 3300005458 Bacteria 3912
35 Ga0070681_10064235 3300005458 Bacteria 3642
36 Ga0070681_10075599 3300005458 Bacteria 3328
37 Ga0070685_10059195 3300005466 Bacteria 2236
38 Ga0070679_100002812 3300005530 Bacteria 15817
39 Ga0070679_100079697 3300005530 Bacteria 3264
40 Ga0070672_100041773 3300005543 Bacteria 3528
41 Ga0070686_100017422 3300005544 Bacteria 4197
42 Ga0070696_100004376 3300005546 Bacteria 9412
43 Ga0070696_100056257 3300005546 Bacteria 2744
44 Ga0070693_100016394 3300005547 Bacteria 3834
45 Ga0070704_100000112 3300005549 Bacteria 28583
46 Ga0068855_100014698 3300005563 Bacteria 9431
47 Ga0068852_100030239 3300005616 Bacteria 4456
48 Ga0068859_100020100 3300005617 Bacteria 6704
49 Ga0068864_100060698 3300005618 Bacteria 3274
50 Ga0068866_10025274 3300005718 Bacteria 2790
51 Ga0068858_100055051 3300005842 Bacteria 3678
52 Ga0068858_100129537 3300005842 Bacteria 2365
53 Ga0068860_100013162 3300005843 Bacteria 8118
54 Ga0068860_100139862 3300005843 Bacteria 2326
55 Ga0068862_100017178 3300005844 Bacteria 6021
56 Ga0081455_10000110 3300005937 Bacteria 92459
57 Ga0081455_10004793 3300005937 Bacteria 15034
58 Ga0081455_10010421 3300005937 Bacteria 9438
59 Ga0081455_10015308 3300005937 Bacteria 7457
60 Ga0081538_10062057 3300005981 Bacteria 2134
61 Ga0081540_1000682 3300005983 Bacteria 31771
62 Ga0070717_10009867 3300006028 Bacteria 7190
63 Ga0070717_10068149 3300006028 Bacteria 2962
64 Ga0070716_100011365 3300006173 Bacteria 4482
65 Ga0070712_100098426 3300006175 Bacteria 2157
66 Ga0097621_100005187 3300006237 Bacteria 9155
67 Ga0075428_100008481 3300006844 Bacteria 11403
68 Ga0075428_100074602 3300006844 Bacteria 3705
69 Ga0075430_100000012 3300006846 Bacteria 94359
70 Ga0075431_100003622 3300006847 Bacteria 14964
71 Ga0075433_10014382 3300006852 Bacteria 6464
72 Ga0075433_10071734 3300006852 Bacteria 3044
73 Ga0075434_100000114 3300006871 Bacteria 46406
74 Ga0075434_100020042 3300006871 Bacteria 6479
75 Ga0075429_100002694 3300006880 Bacteria 14964
76 Ga0097620_100020100 3300006931 Bacteria 6704
77 Ga0075435_100063698 3300007076 Bacteria 2995
78 Ga0111539_10002232 3300009094 Bacteria 25871
79 Ga0111539_10004022 3300009094 Bacteria 19301
80 Ga0105245_10271270 3300009098 Bacteria 1655
81 Ga0105247_10037478 3300009101 Bacteria 2959
82 Ga0114129_10008877 3300009147 Bacteria 14335
83 Ga0114129_10010926 3300009147 Bacteria 12938
84 Ga0105243_10000776 3300009148 Bacteria 30593
85 Ga0105243_10035113 3300009148 Bacteria 3886
86 Ga0105241_10204331 3300009174 Bacteria 1652
87 Ga0105242_10016869 3300009176 Bacteria 5684
88 Ga0105248_10009030 3300009177 Bacteria 10965
89 Ga0105237_10193090 3300009545 Bacteria 2036
90 Ga0105238_10046225 3300009551 Bacteria 4394
91 Ga0105238_10052539 3300009551 Bacteria 4097
92 Ga0105249_10011509 3300009553 Bacteria 7773
93 Ga0105239_10035133 3300010375 Bacteria 5505
94 Ga0163162_10062322 3300013306 Bacteria 3769
95 Ga0163162_10096037 3300013306 Bacteria 3052
96 Ga0157375_10044736 3300013308 Bacteria 4304
97 Ga0163163_10003284 3300014325 Bacteria 13715
98 Ga0157379_10079189 3300014968 Bacteria 2943
99 Ga0157379_10126699 3300014968 Bacteria 2298
100 Ga0206356_11610232 3300020070 Bacteria 5477
101 Ga0209758_1000186 3300025297 Bacteria 138804
102 Ga0207692_10046183 3300025898 Bacteria 2183
103 Ga0207642_10010206 3300025899 Bacteria 3299
104 Ga0207688_10009456 3300025901 Bacteria 5306
105 Ga0207680_10016716 3300025903 Bacteria 3858
106 Ga0207685_10007295 3300025905 Bacteria 3072
107 Ga0207645_10071745 3300025907 Bacteria 2217
108 Ga0207707_10032375 3300025912 Bacteria 4576
109 Ga0207707_10045881 3300025912 Bacteria 3806
110 Ga0207707_10051867 3300025912 Bacteria 3572
111 Ga0207693_10111407 3300025915 Bacteria 2147
112 Ga0207663_10040565 3300025916 Bacteria 2831
113 Ga0207660_10040905 3300025917 Bacteria 3247
114 Ga0207660_10052925 3300025917 Bacteria 2892
115 Ga0207660_10117528 3300025917 Bacteria 2010
116 Ga0207662_10043225 3300025918 Bacteria 2657
117 Ga0207657_10019074 3300025919 Bacteria 6525
118 Ga0207657_10027458 3300025919 Bacteria 5213
119 Ga0207657_10036692 3300025919 Bacteria 4384
120 Ga0207657_10052142 3300025919 Bacteria 3552
121 Ga0207657_10178920 3300025919 Bacteria 1715
122 Ga0207652_10018935 3300025921 Bacteria 5652
123 Ga0207652_10095593 3300025921 Bacteria 2617
124 Ga0207681_10009769 3300025923 Bacteria 5869
125 Ga0207694_10010804 3300025924 Bacteria 6895
126 Ga0207659_10030391 3300025926 Bacteria 3691
127 Ga0207700_10001137 3300025928 Bacteria 15268
128 Ga0207664_10107597 3300025929 Bacteria 2314
129 Ga0207644_10004247 3300025931 Bacteria 9297
130 Ga0207644_10147456 3300025931 Bacteria 1818
131 Ga0207690_10015579 3300025932 Bacteria 4610
132 Ga0207706_10022393 3300025933 Bacteria 5671
133 Ga0207686_10030753 3300025934 Bacteria 3183
134 Ga0207709_10012167 3300025935 Bacteria 4742
135 Ga0207709_10047704 3300025935 Bacteria 2605
136 Ga0207670_10005142 3300025936 Bacteria 7150
137 Ga0207670_10008533 3300025936 Bacteria 5789
138 Ga0207669_10036729 3300025937 Bacteria 2803
139 Ga0207704_10152949 3300025938 Bacteria 1631
140 Ga0207665_10001484 3300025939 Bacteria 15767
141 Ga0207691_10032597 3300025940 Bacteria 4858
142 Ga0207711_10012807 3300025941 Bacteria 6966
143 Ga0207711_10047368 3300025941 Bacteria 3675
144 Ga0207689_10098792 3300025942 Bacteria 2398
145 Ga0207679_10021239 3300025945 Bacteria 4398
146 Ga0207667_10098982 3300025949 Bacteria 3008
147 Ga0207712_10129972 3300025961 Bacteria 1918
148 Ga0207668_10013577 3300025972 Bacteria 5022
149 Ga0207668_10085726 3300025972 Bacteria 2299
150 Ga0207703_10060685 3300026035 Bacteria 3093
151 Ga0207703_10098055 3300026035 Bacteria 2478
152 Ga0207703_10120985 3300026035 Bacteria 2247
153 Ga0207639_10027607 3300026041 Bacteria 4137
154 Ga0207678_10010202 3300026067 Bacteria 8246
155 Ga0207678_10049689 3300026067 Bacteria 3624
156 Ga0207708_10002480 3300026075 Bacteria 13573
157 Ga0207641_10219171 3300026088 Bacteria 1763
158 Ga0207676_10010777 3300026095 Bacteria 6520
159 Ga0207683_10013407 3300026121 Bacteria 6990
160 Ga0207683_10073400 3300026121 Bacteria 3027
161 Ga0209966_1001093 3300027695 Bacteria 4917
162 Ga0209998_10000950 3300027717 Bacteria 7356
163 Ga0207428_10000058 3300027907 Bacteria 158579
164 Ga0207428_10001276 3300027907 Bacteria 26949
165 Ga0268266_10024859 3300028379 Bacteria 5096
166 Ga0268266_10053175 3300028379 Bacteria 3479
167 Ga0268264_10030983 3300028381 Bacteria 4385
168 Ga0265338_10167986 3300028800 Bacteria 1686
169 Ga0265330_10021840 3300031235 Bacteria 2916
170 Ga0265332_10000980 3300031238 Bacteria 16889
171 Ga0265325_10000117 3300031241 Bacteria 54546
172 Ga0265340_10001826 3300031247 Bacteria 12172
173 Ga0265339_10001736 3300031249 Bacteria 16043
174 Ga0265331_10005400 3300031250 Bacteria 7727
175 Ga0265331_10026104 3300031250 Bacteria 2942
176 Ga0265313_10004180 3300031595 Bacteria 11207
177 Ga0265313_10005637 3300031595 Bacteria 9149
178 Ga0265314_10001245 3300031711 Bacteria 29069
179 Ga0265314_10011444 3300031711 Bacteria 7323
180 Ga0265314_10011978 3300031711 Bacteria 7112
181 Ga0265342_10000085 3300031712 Bacteria 100652
182 Ga0265342_10000211 3300031712 Bacteria 65440
183 Ga0265342_10077155 3300031712 Bacteria 1930
184 Ga0373930_0000325 3300034816 Bacteria 6198
185 Ga0373930_0002103 3300034816 Bacteria 3049
186 Ga0373948_0000050 3300034817 Bacteria 12553
187 Ga0373958_0000027 3300034819 Bacteria 15836
188 Ga0373959_0000255 3300034820 Bacteria 11614
189 Ga0373938_0000032 3300034957 Bacteria 17872
190 Ga0373928_0002986 3300035084 Bacteria 3255
191 Ga0373944_0001492 3300035089 Bacteria 5917
192 Ga0373952_0000189 3300035092 Bacteria 9680
193 Ga0373952_0005067 3300035092 Bacteria 2401
194 Ga0373932_0000180 3300035112 Bacteria 18517
195 Ga0373932_0001401 3300035112 Bacteria 6760
196 Ga0373936_0010372 3300035113 Bacteria 3514
197 Ga0373939_0001370 3300035114 Bacteria 5902
198 Ga0373945_0004350 3300035116 Bacteria 4498
199 Ga0373953_0003871 3300035117 Bacteria 4714
200 Ga0373953_0016117 3300035117 Bacteria 2723
201 Ga0373954_0015344 3300035118 Bacteria 3424
202 Ga0373957_0000405 3300035120 Bacteria 10932
203 Ga0373960_0004952 3300035121 Bacteria 3069
204 Ga0373943_0000072 3300035170 Bacteria 35413
205 Ga0373946_0002535 3300035171 Bacteria 6456
206 Ga0373946_0007219 3300035171 Bacteria 4056
207 Ga0373946_0010176 3300035171 Bacteria 3477
208 Ga0373946_0010542 3300035171 Bacteria 3422
209 Ga0373955_0001879 3300035172 Bacteria 9052
210 Ga0373955_0006104 3300035172 Bacteria 5472
211 Ga0373955_0049619 3300035172 Bacteria 2279
212 Ga0373942_0000457 3300035207 Bacteria 11506
213 Ga0373961_0004765 3300035241 Bacteria 3263
214 Ga0373962_0000113 3300035242 Bacteria 16882
215 Ga0373962_0008500 3300035242 Bacteria 2528
216 Ga0373931_0001559 3300035691 Bacteria 9897
217 Ga0373931_0002076 3300035691 Bacteria 8818
218 Ga0373931_0010617 3300035691 Bacteria 4428
219 Ga0373935_0008210 3300035692 Bacteria 6255
220 Ga0373935_0013034 3300035692 Bacteria 5012
221 Ga0373935_0120126 3300035692 Bacteria 1755
222 Ga0373927_0000537 3300035695 Bacteria 28811
223 Ga0373927_0016328 3300035695 Bacteria 4899
224 Ga0373927_0016691 3300035695 Bacteria 4843
225 Ga0373927_0023450 3300035695 Bacteria 4042
226 Ga0373927_0051494 3300035695 Bacteria 2662
227 Ga0373933_0012360 3300035724 Bacteria 4715
228 Ga0373947_0000498 3300035725 Bacteria 22745
229 Ga0373947_0002038 3300035725 Bacteria 12332
230 Ga0373947_0090597 3300035725 Bacteria 1906
231 Ga0373937_0007270 3300036401 Bacteria 9586
232 Ga0373937_0007331 3300036401 Bacteria 9549
233 Ga0373937_0011223 3300036401 Bacteria 7853
234 Ga0373937_0011903 3300036401 Bacteria 7635
235 Ga0373925_0002114 3300037068 Bacteria 16302
236 Ga0373925_0041159 3300037068 Bacteria 3424
237 Ga0436365_0157727 3300039437 Bacteria 6201
238 Ga0451577_0098312 3300042876 Bacteria 2614
239 Ga0466966_0042467 3300044684 Bacteria 2918
240 Ga0466963_0002034 3300044694 Bacteria 11127
241 Ga0466963_0041132 3300044694 Bacteria 3030
242 Ga0466957_0002346 3300044842 Bacteria 10150
243 Ga0466967_0040893 3300045976 Bacteria 3993
244 Ga0495592_0017573 3300046454 Bacteria 5436
245 Ga0495592_0061181 3300046454 Bacteria 2767
246 Ga0495592_0094958 3300046454 Bacteria 2134
247 Ga0495603_0028057 3300046455 Bacteria 3395
248 Ga0495629_0017433 3300046459 Bacteria 5146
249 Ga0495629_0025193 3300046459 Bacteria 4231
250 Ga0495629_0073329 3300046459 Bacteria 2390
251 Ga0495651_0001053 3300046462 Bacteria 21347
252 Ga0495651_0092134 3300046462 Bacteria 2271
253 Ga0495653_0006680 3300046463 Bacteria 9465
254 Ga0495653_0010641 3300046463 Bacteria 7529
255 Ga0495653_0087135 3300046463 Bacteria 2294
256 Ga0495580_0011739 3300046472 Bacteria 6764
257 Ga0495582_0004130 3300046473 Bacteria 8164
258 Ga0495605_0054470 3300046474 Bacteria 1937
259 Ga0495662_0004104 3300046476 Bacteria 7337
260 Ga0495662_0021509 3300046476 Bacteria 3116
261 Ga0495662_0045532 3300046476 Bacteria 2118
262 Ga0495664_0045854 3300046477 Bacteria 2593
263 Ga0495664_0058542 3300046477 Bacteria 2292
264 Ga0495585_0006823 3300046492 Bacteria 7045
265 Ga0495594_0005412 3300046499 Bacteria 6560
266 Ga0495607_0011704 3300046501 Bacteria 5823
267 Ga0495618_0031810 3300046514 Bacteria 3303
268 Ga0495628_0003193 3300046516 Bacteria 14701
269 Ga0495628_0128495 3300046516 Bacteria 1940
270 Ga0495630_0011085 3300046517 Bacteria 6520
271 Ga0495630_0031641 3300046517 Bacteria 3940
272 Ga0495630_0100270 3300046517 Bacteria 2191
273 Ga0495644_0001788 3300046523 Bacteria 8677
274 Ga0495666_0010498 3300046526 Bacteria 4618
275 Ga0495666_0016505 3300046526 Bacteria 3679
276 Ga0495652_0011311 3300046529 Bacteria 8074
277 Ga0495665_0009878 3300046531 Bacteria 5166
278 Ga0495640_0021472 3300046533 Bacteria 4736
279 Ga0495640_0030336 3300046533 Bacteria 3872
280 Ga0495640_0055253 3300046533 Bacteria 2716
281 Ga0495586_0019879 3300046535 Bacteria 3577
282 Ga0495587_0009540 3300046536 Bacteria 6215
283 Ga0495587_0011128 3300046536 Bacteria 5706
284 Ga0495645_0012340 3300046543 Bacteria 6019
285 Ga0495667_0006350 3300046559 Bacteria 8018
286 Ga0495667_0012497 3300046559 Bacteria 5758
287 Ga0495667_0016682 3300046559 Bacteria 4958
288 Ga0495656_0002448 3300046615 Bacteria 6173
289 Ga0495656_0005269 3300046615 Bacteria 4455
290 Ga0495611_0005074 3300046648 Bacteria 5645
291 Ga0495611_0063327 3300046648 Bacteria 1683
292 Ga0495635_0008349 3300046663 Bacteria 7231
293 Ga0495635_0031978 3300046663 Bacteria 3651
294 Ga0495659_0001284 3300046664 Bacteria 8638
295 Ga0495657_0005789 3300046675 Bacteria 9736
296 Ga0495599_0015134 3300046678 Bacteria 4783
297 Ga0495623_0003197 3300046679 Bacteria 10822
298 Ga0495647_0010978 3300046681 Bacteria 3096
299 Ga0495658_0000402 3300046683 Bacteria 24205
300 Ga0495658_0044775 3300046683 Bacteria 2480
301 Ga0495613_0005168 3300046689 Bacteria 9799
302 Ga0495613_0010574 3300046689 Bacteria 6845
303 Ga0495613_0050567 3300046689 Bacteria 3064
304 Ga0495624_0000871 3300046690 Bacteria 23947
305 Ga0495624_0018792 3300046690 Bacteria 4619
306 Ga0495670_0003526 3300046691 Bacteria 7681
307 Ga0495600_0015907 3300046809 Bacteria 4766
308 Ga0495600_0031969 3300046809 Bacteria 3412
309 Ga0495600_0050669 3300046809 Bacteria 2709
310 Ga0495604_0010634 3300047317 Bacteria 7298
311 Ga0495674_0050907 3300047319 Bacteria 3653
312 Ga0495674_0058193 3300047319 Bacteria 3380
313 Ga0495676_0023195 3300047321 Bacteria 5389
314 Ga0495680_0012468 3300047322 Bacteria 7481
315 Ga0495680_0015715 3300047322 Bacteria 6518
316 Ga0495675_0026197 3300047444 Bacteria 3718
317 Ga0495684_0012611 3300047471 Bacteria 6520
318 Ga0495684_0019578 3300047471 Bacteria 5214
319 Ga0495684_0062765 3300047471 Bacteria 2826
320 Ga0495593_0018683 3300047673 Bacteria 3893
321 Ga0495602_0006790 3300048088 Bacteria 12014
322 Ga0495602_0063074 3300048088 Bacteria 3213
323 Ga0496100_0008631 3300048903 Bacteria 5690
324 Ga0496100_0020561 3300048903 Bacteria 3959
325 Ga0496101_0018569 3300048904 Bacteria 4730
326 Ga0496101_0030417 3300048904 Bacteria 3785
327 Ga0496101_0049978 3300048904 Bacteria 3008
328 Ga0496102_0115597 3300048905 Bacteria 2503
329 Ga0496102_0116300 3300048905 Bacteria 2495
330 Ga0496103_0010744 3300048906 Bacteria 5416
331 Ga0496104_0000159 3300048907 Bacteria 61494
332 Ga0496104_0000774 3300048907 Bacteria 27343
333 Ga0496104_0004571 3300048907 Bacteria 12058
334 Ga0496104_0010717 3300048907 Bacteria 8198
335 Ga0496104_0038598 3300048907 Bacteria 4469
336 Ga0496104_0058612 3300048907 Bacteria 3645
337 Ga0496104_0126452 3300048907 Bacteria 2454
338 Ga0496105_0000410 3300048908 Bacteria 28167
339 Ga0496105_0009322 3300048908 Bacteria 7672
340 Ga0496106_0008875 3300048909 Bacteria 7429
341 Ga0496106_0051981 3300048909 Bacteria 3090
342 Ga0496106_0070517 3300048909 Bacteria 2669
343 Ga0496106_0080379 3300048909 Bacteria 2503
344 Ga0496106_0109635 3300048909 Bacteria 2148
345 Ga0496107_0011642 3300048910 Bacteria 6129
346 Ga0496107_0015798 3300048910 Bacteria 5296
347 Ga0496107_0022991 3300048910 Bacteria 4407
348 Ga0496107_0177104 3300048910 Bacteria 1583
349 Ga0496108_0010111 3300048911 Bacteria 7655
350 Ga0496109_0004165 3300048912 Bacteria 12074
351 Ga0496109_0036302 3300048912 Bacteria 4448
352 Ga0496109_0180877 3300048912 Bacteria 1980
353 Ga0496109_0217109 3300048912 Bacteria 1798
354 Ga0496110_0037110 3300048913 Bacteria 4234
355 Ga0496110_0047425 3300048913 Bacteria 3762
356 Ga0496111_0009040 3300048914 Bacteria 6631
357 Ga0496111_0042749 3300048914 Bacteria 3254
358 Ga0496111_0089757 3300048914 Bacteria 2251
359 Ga0496111_0104487 3300048914 Bacteria 2084
360 Ga0496112_0002096 3300048915 Bacteria 15835
361 Ga0496113_0003761 3300048916 Bacteria 9157
362 Ga0496115_0023409 3300048918 Bacteria 4794
363 Ga0496115_0081755 3300048918 Bacteria 2631
364 Ga0496119_0000903 3300048922 Bacteria 38694
365 Ga0496122_0018176 3300048925 Bacteria 6511
366 Ga0496123_0004815 3300048926 Bacteria 13924
367 Ga0501031_0020134 3300049568 Bacteria 4349
368 Ga0501032_0012719 3300049569 Bacteria 6001
369 Ga0501033_0028675 3300049570 Bacteria 4182
370 Ga0501034_0020469 3300049571 Bacteria 6755
371 Ga0501034_0236145 3300049571 Bacteria 1776
372 Ga0501036_0035393 3300049572 Bacteria 4226
373 Ga0501036_0112972 3300049572 Bacteria 2295
374 Ga0501038_0026918 3300049574 Bacteria 5119
375 Ga0501038_0070340 3300049574 Bacteria 2971
376 Ga0501046_0022915 3300049580 Bacteria 5141
377 Ga0501046_0123003 3300049580 Bacteria 1973
378 Ga0501047_0023583 3300049581 Bacteria 5905
379 Ga0501047_0024226 3300049581 Bacteria 5827
380 Ga0501048_0001363 3300049582 Bacteria 18507
381 Ga0501067_0013654 3300049583 Bacteria 4497
382 Ga0501068_0013525 3300049584 Bacteria 4645
383 Ga0501069_0008298 3300049585 Bacteria 5454
384 Ga0501070_0127736 3300049586 Bacteria 2100
385 Ga0501071_0017639 3300049587 Bacteria 4928
386 Ga0501072_0011594 3300049588 Bacteria 6735
387 Ga0501073_0045675 3300049589 Bacteria 3084
388 Ga0501074_0016391 3300049590 Bacteria 5381
389 Ga0501075_0022314 3300049591 Bacteria 4623
390 Ga0501076_0019960 3300049592 Bacteria 5127
391 Ga0501077_0023246 3300049593 Bacteria 3930
392 Ga0501079_0033674 3300049741 Bacteria 3942
393 Ga0501080_0020575 3300049742 Bacteria 6110
394 Ga0501083_0079217 3300049744 Bacteria 2179
395 Ga0501083_0107424 3300049744 Bacteria 1836
396 Ga0501035_0141903 3300049822 Bacteria 2088
397 Ga0501044_0000286 3300049823 Bacteria 64389
398 Ga0501044_0042361 3300049823 Bacteria 4735
399 Ga0501044_0094436 3300049823 Bacteria 3015
400 Ga0501045_0014022 3300049824 Bacteria 5672
401 nmdc:mga03n38_59349_c1 3300050490 Bacteria 1736
402 nmdc:mga06z11_7215_c1 3300050494 Bacteria 4563
403 nmdc:mga07m45_2368_c2 3300050496 Bacteria 5954
404 nmdc:mga05p37_17666_c1 3300050507 Bacteria 8607
405 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
406 nmdc:mga09592_813_c1 3300050508 Bacteria 24096
407 nmdc:mga0qj67_1453_c1 3300050509 Bacteria 16598
408 nmdc:mga06r32_211215_c1 3300050510 Bacteria 1928
409 nmdc:mga06r32_4634_c1 3300050510 Bacteria 12334
410 nmdc:mga06r32_73836_c1 3300050510 Bacteria 3305
411 nmdc:mga08y16_1715_c1 3300050511 Bacteria 22248
412 nmdc:mga08y16_9096_c1 3300050511 Bacteria 10430
413 nmdc:mga0n895_1392_c1 3300050512 Bacteria 18016
414 nmdc:mga0n895_159068_c1 3300050512 Bacteria 2290
415 nmdc:mga0n895_206194_c1 3300050512 Bacteria 1996
416 nmdc:mga0n895_6890_c1 3300050512 Bacteria 9707
417 nmdc:mga0rr50_30151_c1 3300050513 Bacteria 3837
418 nmdc:mga0a205_47963_c1 3300050515 Bacteria 4122
419 nmdc:mga0a205_687_c1 3300050515 Bacteria 27032
420 Ga0495601_0001967 3300053077 Bacteria 11488
421 Ga0495601_0003627 3300053077 Bacteria 8873
422 Ga0495601_0005819 3300053077 Bacteria 7188
423 Ga0495612_0000616 3300053078 Bacteria 14330
424 Ga0495612_0003945 3300053078 Bacteria 6160
425 Ga0495595_0001470 3300053084 Bacteria 9200
426 Ga0495595_0001579 3300053084 Bacteria 8900
427 Ga0495595_0004664 3300053084 Bacteria 5515
428 Ga0495619_0000151 3300053085 Bacteria 51364
429 Ga0495619_0000419 3300053085 Bacteria 28779
430 Ga0495619_0000487 3300053085 Bacteria 26605
431 Ga0495619_0003995 3300053085 Bacteria 9454
432 Ga0495619_0012078 3300053085 Bacteria 5440
433 Ga0500644_0000314 3300053088 Bacteria 25311
434 Ga0500651_0014797 3300053093 Bacteria 4778
435 Ga0500595_000024 3300053119 Bacteria 144160
436 Ga0500595_026024 3300053119 Bacteria 2021
437 Ga0500616_0000001 3300053153 Bacteria 1986011
438 Ga0500616_0000166 3300053153 Bacteria 110141
439 Ga0500616_0042813 3300053153 Bacteria 2423
440 Ga0500645_000122 3300053730 Bacteria 61591
441 Ga0500645_004491 3300053730 Bacteria 5340
442 Ga0501082_0000156 3300060353 Bacteria 57873
443 Ga0501082_0127626 3300060353 Bacteria 2206
444 Ga0466962_0072989 3300061719 Bacteria 1639
445 2643755162 2643221547 Bacteria 4740017
446 2644287341 2643221651 Bacteria 4798932
447 Ga0373947_0022761
448 ARcpr5oldR_c000275
449 ARSoilYngRDRAFT_c00425
450 ARSoilOldRDRAFT_c000230
451 Ga0065715_10000936
452 Ga0070658_10007359
453 Ga0070690_100035221
454 Ga0070666_10071532
455 Ga0070680_100018565
456 Ga0070680_100104828
457 Ga0070660_100123017
458 Ga0070689_100007878
459 Ga0070669_100002660
460 Ga0070669_100028015
461 Ga0070671_100183264
462 Ga0070674_100009929
463 Ga0070674_100122640
464 Ga0070688_100027338
465 Ga0070659_100008795
466 Ga0070709_10003433
467 Ga0070713_100010777
468 Ga0070713_100030652
469 Ga0070713_100058129
470 Ga0070710_10015551
471 Ga0070710_10055538
472 Ga0070701_10006407
473 Ga0070711_100014031
474 Ga0070711_100056639
475 Ga0070711_100073987
476 Ga0070663_100004879
477 Ga0070663_100006367
478 Ga0070678_100078198
479 Ga0070681_10018604
480 Ga0070681_10056334
481 Ga0070681_10064235
482 Ga0070681_10075599
483 Ga0070685_10059195
484 Ga0070679_100002812
485 Ga0070679_100079697
486 Ga0070672_100041773
487 Ga0070686_100017422
488 Ga0070696_100004376
489 Ga0070696_100056257
490 Ga0070693_100016394
491 Ga0070704_100000112
492 Ga0068855_100014698
493 Ga0068852_100030239
494 Ga0068859_100020100
495 Ga0068864_100060698
496 Ga0068866_10025274
497 Ga0068858_100055051
498 Ga0068858_100129537
499 Ga0068860_100013162
500 Ga0068860_100139862
501 Ga0068862_100017178
502 Ga0081455_10000110
503 Ga0081455_10004793
504 Ga0081455_10010421
505 Ga0081455_10015308
506 Ga0081538_10062057
507 Ga0081540_1000682
508 Ga0070717_10009867
509 Ga0070717_10068149
510 Ga0070716_100011365
511 Ga0070712_100098426
512 Ga0097621_100005187
513 Ga0075428_100008481
514 Ga0075428_100074602
515 Ga0075430_100000012
516 Ga0075431_100003622
517 Ga0075433_10014382
518 Ga0075433_10071734
519 Ga0075434_100000114
520 Ga0075434_100020042
521 Ga0075429_100002694
522 Ga0097620_100020100
523 Ga0075435_100063698
524 Ga0111539_10002232
525 Ga0111539_10004022
526 Ga0105245_10271270
527 Ga0105247_10037478
528 Ga0114129_10008877
529 Ga0114129_10010926
530 Ga0105243_10000776
531 Ga0105243_10035113
532 Ga0105241_10204331
533 Ga0105242_10016869
534 Ga0105248_10009030
535 Ga0105237_10193090
536 Ga0105238_10046225
537 Ga0105238_10052539
538 Ga0105249_10011509
539 Ga0105239_10035133
540 Ga0163162_10062322
541 Ga0163162_10096037
542 Ga0157375_10044736
543 Ga0163163_10003284
544 Ga0157379_10079189
545 Ga0157379_10126699
546 Ga0206356_11610232
547 Ga0209758_1000186
548 Ga0207692_10046183
549 Ga0207642_10010206
550 Ga0207688_10009456
551 Ga0207680_10016716
552 Ga0207685_10007295
553 Ga0207645_10071745
554 Ga0207707_10032375
555 Ga0207707_10045881
556 Ga0207707_10051867
557 Ga0207693_10111407
558 Ga0207663_10040565
559 Ga0207660_10040905
560 Ga0207660_10052925
561 Ga0207660_10117528
562 Ga0207662_10043225
563 Ga0207657_10019074
564 Ga0207657_10027458
565 Ga0207657_10036692
566 Ga0207657_10052142
567 Ga0207657_10178920
568 Ga0207652_10018935
569 Ga0207652_10095593
570 Ga0207681_10009769
571 Ga0207694_10010804
572 Ga0207659_10030391
573 Ga0207700_10001137
574 Ga0207664_10107597
575 Ga0207644_10004247
576 Ga0207644_10147456
577 Ga0207690_10015579
578 Ga0207706_10022393
579 Ga0207686_10030753
580 Ga0207709_10012167
581 Ga0207709_10047704
582 Ga0207670_10005142
583 Ga0207670_10008533
584 Ga0207669_10036729
585 Ga0207704_10152949
586 Ga0207665_10001484
587 Ga0207691_10032597
588 Ga0207711_10012807
589 Ga0207711_10047368
590 Ga0207689_10098792
591 Ga0207679_10021239
592 Ga0207667_10098982
593 Ga0207712_10129972
594 Ga0207668_10013577
595 Ga0207668_10085726
596 Ga0207703_10060685
597 Ga0207703_10098055
598 Ga0207703_10120985
599 Ga0207639_10027607
600 Ga0207678_10010202
601 Ga0207678_10049689
602 Ga0207708_10002480
603 Ga0207641_10219171
604 Ga0207676_10010777
605 Ga0207683_10013407
606 Ga0207683_10073400
607 Ga0209966_1001093
608 Ga0209998_10000950
609 Ga0207428_10000058
610 Ga0207428_10001276
611 Ga0268266_10024859
612 Ga0268266_10053175
613 Ga0268264_10030983
614 Ga0265338_10167986
615 Ga0265330_10021840
616 Ga0265332_10000980
617 Ga0265325_10000117
618 Ga0265340_10001826
619 Ga0265339_10001736
620 Ga0265331_10005400
621 Ga0265331_10026104
622 Ga0265313_10004180
623 Ga0265313_10005637
624 Ga0265314_10001245
625 Ga0265314_10011444
626 Ga0265314_10011978
627 Ga0265342_10000085
628 Ga0265342_10000211
629 Ga0265342_10077155
630 Ga0373930_0000325
631 Ga0373930_0002103
632 Ga0373948_0000050
633 Ga0373958_0000027
634 Ga0373959_0000255
635 Ga0373938_0000032
636 Ga0373928_0002986
637 Ga0373944_0001492
638 Ga0373952_0000189
639 Ga0373952_0005067
640 Ga0373932_0000180
641 Ga0373932_0001401
642 Ga0373936_0010372
643 Ga0373939_0001370
644 Ga0373945_0004350
645 Ga0373953_0003871
646 Ga0373953_0016117
647 Ga0373954_0015344
648 Ga0373957_0000405
649 Ga0373960_0004952
650 Ga0373943_0000072
651 Ga0373946_0002535
652 Ga0373946_0007219
653 Ga0373946_0010176
654 Ga0373946_0010542
655 Ga0373955_0001879
656 Ga0373955_0006104
657 Ga0373955_0049619
658 Ga0373942_0000457
659 Ga0373961_0004765
660 Ga0373962_0000113
661 Ga0373962_0008500
662 Ga0373931_0001559
663 Ga0373931_0002076
664 Ga0373931_0010617
665 Ga0373935_0008210
666 Ga0373935_0013034
667 Ga0373935_0120126
668 Ga0373927_0000537
669 Ga0373927_0016328
670 Ga0373927_0016691
671 Ga0373927_0023450
672 Ga0373927_0051494
673 Ga0373933_0012360
674 Ga0373947_0000498
675 Ga0373947_0002038
676 Ga0373947_0090597
677 Ga0373937_0007270
678 Ga0373937_0007331
679 Ga0373937_0011223
680 Ga0373937_0011903
681 Ga0373925_0002114
682 Ga0373925_0041159
683 Ga0436365_0157727
684 Ga0451577_0098312
685 Ga0466966_0042467
686 Ga0466963_0002034
687 Ga0466963_0041132
688 Ga0466957_0002346
689 Ga0466967_0040893
690 Ga0495592_0017573
691 Ga0495592_0061181
692 Ga0495592_0094958
693 Ga0495603_0028057
694 Ga0495629_0017433
695 Ga0495629_0025193
696 Ga0495629_0073329
697 Ga0495651_0001053
698 Ga0495651_0092134
699 Ga0495653_0006680
700 Ga0495653_0010641
701 Ga0495653_0087135
702 Ga0495580_0011739
703 Ga0495582_0004130
704 Ga0495605_0054470
705 Ga0495662_0004104
706 Ga0495662_0021509
707 Ga0495662_0045532
708 Ga0495664_0045854
709 Ga0495664_0058542
710 Ga0495585_0006823
711 Ga0495594_0005412
712 Ga0495607_0011704
713 Ga0495618_0031810
714 Ga0495628_0003193
715 Ga0495628_0128495
716 Ga0495630_0011085
717 Ga0495630_0031641
718 Ga0495630_0100270
719 Ga0495644_0001788
720 Ga0495666_0010498
721 Ga0495666_0016505
722 Ga0495652_0011311
723 Ga0495665_0009878
724 Ga0495640_0021472
725 Ga0495640_0030336
726 Ga0495640_0055253
727 Ga0495586_0019879
728 Ga0495587_0009540
729 Ga0495587_0011128
730 Ga0495645_0012340
731 Ga0495667_0006350
732 Ga0495667_0012497
733 Ga0495667_0016682
734 Ga0495656_0002448
735 Ga0495656_0005269
736 Ga0495611_0005074
737 Ga0495611_0063327
738 Ga0495635_0008349
739 Ga0495635_0031978
740 Ga0495659_0001284
741 Ga0495657_0005789
742 Ga0495599_0015134
743 Ga0495623_0003197
744 Ga0495647_0010978
745 Ga0495658_0000402
746 Ga0495658_0044775
747 Ga0495613_0005168
748 Ga0495613_0010574
749 Ga0495613_0050567
750 Ga0495624_0000871
751 Ga0495624_0018792
752 Ga0495670_0003526
753 Ga0495600_0015907
754 Ga0495600_0031969
755 Ga0495600_0050669
756 Ga0495604_0010634
757 Ga0495674_0050907
758 Ga0495674_0058193
759 Ga0495676_0023195
760 Ga0495680_0012468
761 Ga0495680_0015715
762 Ga0495675_0026197
763 Ga0495684_0012611
764 Ga0495684_0019578
765 Ga0495684_0062765
766 Ga0495593_0018683
767 Ga0495602_0006790
768 Ga0495602_0063074
769 Ga0496100_0008631
770 Ga0496100_0020561
771 Ga0496101_0018569
772 Ga0496101_0030417
773 Ga0496101_0049978
774 Ga0496102_0115597
775 Ga0496102_0116300
776 Ga0496103_0010744
777 Ga0496104_0000159
778 Ga0496104_0000774
779 Ga0496104_0004571
780 Ga0496104_0010717
781 Ga0496104_0038598
782 Ga0496104_0058612
783 Ga0496104_0126452
784 Ga0496105_0000410
785 Ga0496105_0009322
786 Ga0496106_0008875
787 Ga0496106_0051981
788 Ga0496106_0070517
789 Ga0496106_0080379
790 Ga0496106_0109635
791 Ga0496107_0011642
792 Ga0496107_0015798
793 Ga0496107_0022991
794 Ga0496107_0177104
795 Ga0496108_0010111
796 Ga0496109_0004165
797 Ga0496109_0036302
798 Ga0496109_0180877
799 Ga0496109_0217109
800 Ga0496110_0037110
801 Ga0496110_0047425
802 Ga0496111_0009040
803 Ga0496111_0042749
804 Ga0496111_0089757
805 Ga0496111_0104487
806 Ga0496112_0002096
807 Ga0496113_0003761
808 Ga0496115_0023409
809 Ga0496115_0081755
810 Ga0496119_0000903
811 Ga0496122_0018176
812 Ga0496123_0004815
813 Ga0501031_0020134
814 Ga0501032_0012719
815 Ga0501033_0028675
816 Ga0501034_0020469
817 Ga0501034_0236145
818 Ga0501036_0035393
819 Ga0501036_0112972
820 Ga0501038_0026918
821 Ga0501038_0070340
822 Ga0501046_0022915
823 Ga0501046_0123003
824 Ga0501047_0023583
825 Ga0501047_0024226
826 Ga0501048_0001363
827 Ga0501067_0013654
828 Ga0501068_0013525
829 Ga0501069_0008298
830 Ga0501070_0127736
831 Ga0501071_0017639
832 Ga0501072_0011594
833 Ga0501073_0045675
834 Ga0501074_0016391
835 Ga0501075_0022314
836 Ga0501076_0019960
837 Ga0501077_0023246
838 Ga0501079_0033674
839 Ga0501080_0020575
840 Ga0501083_0079217
841 Ga0501083_0107424
842 Ga0501035_0141903
843 Ga0501044_0000286
844 Ga0501044_0042361
845 Ga0501044_0094436
846 Ga0501045_0014022
847 nmdc:mga03n38_59349_c1
848 nmdc:mga06z11_7215_c1
849 nmdc:mga07m45_2368_c2
850 nmdc:mga05p37_17666_c1
851 nmdc:mga05p37_35_c1
852 nmdc:mga09592_813_c1
853 nmdc:mga0qj67_1453_c1
854 nmdc:mga06r32_211215_c1
855 nmdc:mga06r32_4634_c1
856 nmdc:mga06r32_73836_c1
857 nmdc:mga08y16_1715_c1
858 nmdc:mga08y16_9096_c1
859 nmdc:mga0n895_1392_c1
860 nmdc:mga0n895_159068_c1
861 nmdc:mga0n895_206194_c1
862 nmdc:mga0n895_6890_c1
863 nmdc:mga0rr50_30151_c1
864 nmdc:mga0a205_47963_c1
865 nmdc:mga0a205_687_c1
866 Ga0495601_0001967
867 Ga0495601_0003627
868 Ga0495601_0005819
869 Ga0495612_0000616
870 Ga0495612_0003945
871 Ga0495595_0001470
872 Ga0495595_0001579
873 Ga0495595_0004664
874 Ga0495619_0000151
875 Ga0495619_0000419
876 Ga0495619_0000487
877 Ga0495619_0003995
878 Ga0495619_0012078
879 Ga0500644_0000314
880 Ga0500651_0014797
881 Ga0500595_000024
882 Ga0500595_026024
883 Ga0500616_0000001
884 Ga0500616_0000166
885 Ga0500616_0042813
886 Ga0500645_000122
887 Ga0500645_004491
888 Ga0501082_0000156
889 Ga0501082_0127626
890 Ga0466962_0072989
891 2643755162
892 2644287341

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

312

435

0.96

PF01225

Mur_ligase

Mur ligase family, catalytic domain

22

98

0.94

PF08245

Mur_ligase_M

Mur ligase middle domain

108

290

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c12-assembly1.cif.gz_A x-ray crystal structure of staphylococcus aureus mure with udp-murnac- ala-glu-lys and adp 0.9144 17 480
2xja-assembly1.cif.gz_A structure of mure from m.tuberculosis with dipeptide and adp 0.8982 14 478
2xja-assembly3.cif.gz_C structure of mure from m.tuberculosis with dipeptide and adp 0.8954 1 478
1e8c-assembly1.cif.gz_A structure of mure the udp-n-acetylmuramyl tripeptide synthetase from e. coli 0.8929 1 478
2xja-assembly3.cif.gz_C structure of mure from m.tuberculosis with dipeptide and adp 0.8867 1 478
ID Description Score Start End Superfamily
af_I1KPB4_561_737_3.90.190.20 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9633 343 478 3.90.190.20
2wtzA03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9403 330 478 3.90.190.20
4bubB03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9377 340 478 3.90.190.20
1e8cB03 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Mur ligase, C-terminal domain 0.9358 335 469 3.90.190.20
4c13A02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9318 101 332 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A349J3T9-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9812 337 478 GO:0009058
GO:0016881
AF-A0A0A0CWN4-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9768 84 347 GO:0005524
GO:0009058
GO:0016881
AF-A0A356U4P0-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9764 357 478 GO:0009058
GO:0016881
AF-A0A6G3UZX6-F1-model_v4 deleted 0.9737 328 472
AF-A0A3S1Q2K8-F1-model_v4 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9722 107 261 GO:0005524
GO:0009058
GO:0016881

Map