F445757
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 446 | 333 | 892 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300033442|Ga0315911_1000004|Ga0315911_1000004454 |
| Length | 261 |
| Sequence | MSEVLLSVDGLAATYNHAIGAVSDVSLVVRPGEIVAVLGANGAGKSTTLQAVSALLPARRGQITAGCILFEGHDLAGISAAALVRAGIVPVLEGRHCFASLTVEENLFTGAIGRDATRAETADDLDRVYTLFPRLKERRRSLAGLTSGGEQQMTAIGRALMSRPRLLVLDEPSMGLAPLVVEGILRALKQLNAEQGLSILVAEQNSTVALRFADHAVVLENGRSVLAGAAAELRRRGDIKTLYLGGSSQVDPSRQPTQAVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 4 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 48 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 49 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 53 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 76 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 78 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 118 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 119 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 120 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 122 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 123 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 128 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 129 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 131 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 132 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 134 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 136 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 139 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 140 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 141 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 145 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 146 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 147 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 148 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 149 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 153 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 227 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 228 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 229 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 232 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 267 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 269 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 277 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 282 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 283 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 284 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 285 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 286 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 287 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 288 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 289 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 290 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 292 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 294 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 295 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 296 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 297 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 302 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 303 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 304 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 305 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 306 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 307 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 308 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 309 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 310 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 311 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 312 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 313 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 314 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 315 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 316 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 317 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 318 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 319 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 320 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 321 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 322 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 323 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 324 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 325 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 326 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 327 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 328 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 329 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 330 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 331 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 332 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 333 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.6 |
| Metatranscriptomes | 0.22 |
| Isolates | 7.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.43 |
| Nodule | 5.16 |
| Rhizoplane | 3.59 |
| Rhizosphere | 68.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 2 | JGI24751J29686_10032029 | 3300002459 | Bacteria | 1090 |
| 3 | JGI25160J50197_1000184 | 3300003354 | Bacteria | 53011 |
| 4 | Ga0055526_1027115 | 3300003771 | Bacteria | 1780 |
| 5 | Ga0065165_1001355 | 3300005262 | Bacteria | 27048 |
| 6 | Ga0065715_10000497 | 3300005293 | Bacteria | 10881 |
| 7 | Ga0070658_10305818 | 3300005327 | Bacteria | 1356 |
| 8 | Ga0070658_10629910 | 3300005327 | Bacteria | 930 |
| 9 | Ga0070683_100583644 | 3300005329 | Bacteria | 1069 |
| 10 | Ga0070690_100323744 | 3300005330 | Bacteria | 1111 |
| 11 | Ga0068869_100100923 | 3300005334 | Bacteria | 2182 |
| 12 | Ga0070680_100338414 | 3300005336 | Unclassified | 1278 |
| 13 | Ga0070660_100192178 | 3300005339 | Bacteria | 1654 |
| 14 | Ga0070689_100353547 | 3300005340 | Bacteria | 1233 |
| 15 | Ga0070687_100010290 | 3300005343 | Bacteria | 4040 |
| 16 | Ga0070687_100042854 | 3300005343 | Bacteria | 2296 |
| 17 | Ga0070675_100748797 | 3300005354 | Bacteria | 891 |
| 18 | Ga0070673_100411385 | 3300005364 | Bacteria | 1211 |
| 19 | Ga0070673_100672729 | 3300005364 | Bacteria | 949 |
| 20 | Ga0070703_10002141 | 3300005406 | Bacteria | 5747 |
| 21 | Ga0070701_10010549 | 3300005438 | Bacteria | 4089 |
| 22 | Ga0070700_100082103 | 3300005441 | Bacteria | 2084 |
| 23 | Ga0070708_100004618 | 3300005445 | Bacteria | 10845 |
| 24 | Ga0070678_100491308 | 3300005456 | Bacteria | 1082 |
| 25 | Ga0070662_100176938 | 3300005457 | Bacteria | 1679 |
| 26 | Ga0070681_10073034 | 3300005458 | Bacteria | 3392 |
| 27 | Ga0068867_100059588 | 3300005459 | Unclassified | 2830 |
| 28 | Ga0070706_100004294 | 3300005467 | Bacteria | 13804 |
| 29 | Ga0070707_100088093 | 3300005468 | Bacteria | 3003 |
| 30 | Ga0070698_100021194 | 3300005471 | Bacteria | 6810 |
| 31 | Ga0070679_100106690 | 3300005530 | Bacteria | 2787 |
| 32 | Ga0070684_100055449 | 3300005535 | Bacteria | 3455 |
| 33 | Ga0070686_100043647 | 3300005544 | Bacteria | 2814 |
| 34 | Ga0070695_100006755 | 3300005545 | Bacteria | 6790 |
| 35 | Ga0070695_100218130 | 3300005545 | Bacteria | 1373 |
| 36 | Ga0070696_100049527 | 3300005546 | Bacteria | 2918 |
| 37 | Ga0068855_100737003 | 3300005563 | Bacteria | 1052 |
| 38 | Ga0070664_100052295 | 3300005564 | Bacteria | 3459 |
| 39 | Ga0070664_100109527 | 3300005564 | Bacteria | 2409 |
| 40 | Ga0068857_100006321 | 3300005577 | Bacteria | 10143 |
| 41 | Ga0068857_100038046 | 3300005577 | Bacteria | 4261 |
| 42 | Ga0068854_100693887 | 3300005578 | Bacteria | 878 |
| 43 | Ga0068852_100422571 | 3300005616 | Bacteria | 1315 |
| 44 | Ga0068864_100029756 | 3300005618 | Bacteria | 4628 |
| 45 | Ga0068861_100164346 | 3300005719 | Bacteria | 1834 |
| 46 | Ga0068863_100006766 | 3300005841 | Bacteria | 11240 |
| 47 | Ga0068858_100397793 | 3300005842 | Bacteria | 1323 |
| 48 | Ga0068858_100502023 | 3300005842 | Bacteria | 1172 |
| 49 | Ga0068860_100094431 | 3300005843 | Bacteria | 2851 |
| 50 | Ga0068862_100396123 | 3300005844 | Bacteria | 1291 |
| 51 | Ga0081455_10000919 | 3300005937 | Bacteria | 37836 |
| 52 | Ga0081455_10278914 | 3300005937 | Bacteria | 1208 |
| 53 | Ga0081539_10014335 | 3300005985 | Bacteria | 5872 |
| 54 | Ga0081539_10035583 | 3300005985 | Bacteria | 2989 |
| 55 | Ga0070717_10257275 | 3300006028 | Bacteria | 1544 |
| 56 | Ga0075363_100117106 | 3300006048 | Bacteria | 1485 |
| 57 | Ga0075363_100222982 | 3300006048 | Bacteria | 1081 |
| 58 | Ga0075364_10005042 | 3300006051 | Bacteria | 7654 |
| 59 | Ga0075364_10005490 | 3300006051 | Bacteria | 7374 |
| 60 | Ga0075432_10061487 | 3300006058 | Bacteria | 1338 |
| 61 | Ga0070712_100009522 | 3300006175 | Bacteria | 6126 |
| 62 | Ga0075362_10000810 | 3300006177 | Bacteria | 9342 |
| 63 | Ga0075367_10026177 | 3300006178 | Bacteria | 3305 |
| 64 | Ga0075367_10058592 | 3300006178 | Bacteria | 2292 |
| 65 | Ga0075369_10064455 | 3300006186 | Bacteria | 1604 |
| 66 | Ga0075369_10070025 | 3300006186 | Bacteria | 1543 |
| 67 | Ga0097621_100000445 | 3300006237 | Bacteria | 28963 |
| 68 | Ga0068871_100001310 | 3300006358 | Bacteria | 16647 |
| 69 | Ga0075428_100000426 | 3300006844 | Bacteria | 41901 |
| 70 | Ga0075431_100000059 | 3300006847 | Bacteria | 61740 |
| 71 | Ga0075431_100318143 | 3300006847 | Bacteria | 1570 |
| 72 | Ga0075429_100007528 | 3300006880 | Bacteria | 9453 |
| 73 | Ga0105250_10062777 | 3300009092 | Bacteria | 1495 |
| 74 | Ga0105240_10181444 | 3300009093 | Bacteria | 2484 |
| 75 | Ga0111539_10002614 | 3300009094 | Bacteria | 23869 |
| 76 | Ga0105245_10465815 | 3300009098 | Bacteria | 1275 |
| 77 | Ga0105247_10008352 | 3300009101 | Bacteria | 6313 |
| 78 | Ga0114129_10001483 | 3300009147 | Bacteria | 31789 |
| 79 | Ga0105243_10048496 | 3300009148 | Bacteria | 3348 |
| 80 | Ga0105243_10085525 | 3300009148 | Bacteria | 2585 |
| 81 | Ga0105243_10134635 | 3300009148 | Bacteria | 2101 |
| 82 | Ga0105241_10077007 | 3300009174 | Bacteria | 2602 |
| 83 | Ga0105242_10095815 | 3300009176 | Bacteria | 2506 |
| 84 | Ga0105248_10056291 | 3300009177 | Bacteria | 4412 |
| 85 | Ga0105248_10896585 | 3300009177 | Bacteria | 1001 |
| 86 | Ga0105238_10699783 | 3300009551 | Bacteria | 1025 |
| 87 | Ga0157373_10195930 | 3300013100 | Bacteria | 1424 |
| 88 | Ga0157370_10012366 | 3300013104 | Bacteria | 8856 |
| 89 | Ga0157375_10146313 | 3300013308 | Bacteria | 2494 |
| 90 | Ga0157375_10592043 | 3300013308 | Bacteria | 1269 |
| 91 | Ga0157380_10042555 | 3300014326 | Bacteria | 3550 |
| 92 | Ga0157380_10111236 | 3300014326 | Bacteria | 2302 |
| 93 | Ga0157376_10126616 | 3300014969 | Bacteria | 2273 |
| 94 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 95 | Ga0163161_10089107 | 3300017792 | Bacteria | 2281 |
| 96 | Ga0213874_10018031 | 3300021377 | Bacteria | 1903 |
| 97 | Ga0209233_1005652 | 3300025261 | Bacteria | 4129 |
| 98 | Ga0209130_1012227 | 3300025284 | Bacteria | 2258 |
| 99 | Ga0209675_1007782 | 3300025291 | Bacteria | 4042 |
| 100 | Ga0209564_1009934 | 3300025295 | Bacteria | 4452 |
| 101 | Ga0209050_1008405 | 3300025298 | Bacteria | 5528 |
| 102 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 103 | Ga0207655_1003880 | 3300025728 | Bacteria | 10876 |
| 104 | Ga0207653_10000347 | 3300025885 | Bacteria | 23308 |
| 105 | Ga0207692_10208072 | 3300025898 | Bacteria | 1154 |
| 106 | Ga0207684_10060230 | 3300025910 | Bacteria | 3224 |
| 107 | Ga0207707_10043643 | 3300025912 | Bacteria | 3910 |
| 108 | Ga0207695_10200123 | 3300025913 | Bacteria | 1912 |
| 109 | Ga0207693_10001023 | 3300025915 | Bacteria | 25036 |
| 110 | Ga0207662_10015134 | 3300025918 | Bacteria | 4336 |
| 111 | Ga0207662_10046606 | 3300025918 | Bacteria | 2564 |
| 112 | Ga0207662_10087480 | 3300025918 | Bacteria | 1911 |
| 113 | Ga0207657_10150193 | 3300025919 | Bacteria | 1898 |
| 114 | Ga0207652_10062154 | 3300025921 | Bacteria | 3227 |
| 115 | Ga0207646_10137140 | 3300025922 | Bacteria | 2203 |
| 116 | Ga0207700_10531295 | 3300025928 | Bacteria | 1043 |
| 117 | Ga0207664_10234250 | 3300025929 | Bacteria | 1597 |
| 118 | Ga0207706_10017144 | 3300025933 | Bacteria | 6531 |
| 119 | Ga0207709_10024152 | 3300025935 | Bacteria | 3468 |
| 120 | Ga0207709_10541817 | 3300025935 | Bacteria | 914 |
| 121 | Ga0207670_10120153 | 3300025936 | Bacteria | 1908 |
| 122 | Ga0207691_10407264 | 3300025940 | Bacteria | 1160 |
| 123 | Ga0207711_10015828 | 3300025941 | Bacteria | 6256 |
| 124 | Ga0207711_10477125 | 3300025941 | Bacteria | 1162 |
| 125 | Ga0207689_10087541 | 3300025942 | Bacteria | 2559 |
| 126 | Ga0207679_10057291 | 3300025945 | Bacteria | 2881 |
| 127 | Ga0207679_10098746 | 3300025945 | Bacteria | 2278 |
| 128 | Ga0207651_10707821 | 3300025960 | Bacteria | 888 |
| 129 | Ga0207640_10112480 | 3300025981 | Bacteria | 1933 |
| 130 | Ga0207658_10396707 | 3300025986 | Bacteria | 1212 |
| 131 | Ga0207703_10385764 | 3300026035 | Bacteria | 1297 |
| 132 | Ga0207639_10279707 | 3300026041 | Bacteria | 1467 |
| 133 | Ga0207708_10062030 | 3300026075 | Bacteria | 2855 |
| 134 | Ga0207648_10063456 | 3300026089 | Bacteria | 3220 |
| 135 | Ga0207648_10136318 | 3300026089 | Unclassified | 2162 |
| 136 | Ga0207676_10062656 | 3300026095 | Bacteria | 2950 |
| 137 | Ga0207674_10006766 | 3300026116 | Bacteria | 13453 |
| 138 | Ga0207674_10221287 | 3300026116 | Bacteria | 1841 |
| 139 | Ga0207674_10239807 | 3300026116 | Bacteria | 1760 |
| 140 | Ga0207683_10606520 | 3300026121 | Bacteria | 1013 |
| 141 | Ga0207428_10009343 | 3300027907 | Bacteria | 8795 |
| 142 | Ga0207428_10096413 | 3300027907 | Bacteria | 2290 |
| 143 | Ga0268265_10341159 | 3300028380 | Bacteria | 1364 |
| 144 | Ga0265337_1002183 | 3300028556 | Bacteria | 9169 |
| 145 | Ga0307517_10000035 | 3300028786 | Bacteria | 172762 |
| 146 | Ga0307515_10092206 | 3300028794 | Bacteria | 3773 |
| 147 | Ga0316181_1037493 | 3300030744 | Bacteria | 1297 |
| 148 | Ga0265762_1003372 | 3300030760 | Bacteria | 2860 |
| 149 | Ga0265332_10052084 | 3300031238 | Bacteria | 1758 |
| 150 | Ga0265340_10015775 | 3300031247 | Bacteria | 3920 |
| 151 | Ga0265342_10183260 | 3300031712 | Bacteria | 1146 |
| 152 | Ga0307410_10559436 | 3300031852 | Bacteria | 949 |
| 153 | Ga0307407_10216783 | 3300031903 | Bacteria | 1292 |
| 154 | Ga0307416_101143540 | 3300032002 | Bacteria | 884 |
| 155 | Ga0373929_0019800 | 3300035085 | Bacteria | 1351 |
| 156 | Ga0373934_0023702 | 3300035086 | Bacteria | 2372 |
| 157 | Ga0373932_0024236 | 3300035112 | Bacteria | 1631 |
| 158 | Ga0373936_0057790 | 3300035113 | Bacteria | 1578 |
| 159 | Ga0373941_0018218 | 3300035115 | Bacteria | 1937 |
| 160 | Ga0373954_0007126 | 3300035118 | Bacteria | 4881 |
| 161 | Ga0373955_0006860 | 3300035172 | Bacteria | 5207 |
| 162 | Ga0373961_0040940 | 3300035241 | Bacteria | 1337 |
| 163 | Ga0373924_0004152 | 3300035410 | Bacteria | 5039 |
| 164 | Ga0373931_0004070 | 3300035691 | Bacteria | 6628 |
| 165 | Ga0373931_0011184 | 3300035691 | Bacteria | 4332 |
| 166 | Ga0373935_0023511 | 3300035692 | Bacteria | 3787 |
| 167 | Ga0373927_0022365 | 3300035695 | Bacteria | 4142 |
| 168 | Ga0373933_0002610 | 3300035724 | Bacteria | 10097 |
| 169 | Ga0373933_0495012 | 3300035724 | Bacteria | 801 |
| 170 | Ga0373947_0019484 | 3300035725 | Bacteria | 3912 |
| 171 | Ga0373937_0000403 | 3300036401 | Bacteria | 40423 |
| 172 | Ga0373925_0099271 | 3300037068 | Bacteria | 2236 |
| 173 | Ga0436365_1559602 | 3300039437 | Bacteria | 2213 |
| 174 | Ga0436360_0985056 | 3300039438 | Bacteria | 2485 |
| 175 | Ga0436363_0388188 | 3300039450 | Bacteria | 2490 |
| 176 | Ga0436362_0480253 | 3300039453 | Bacteria | 1332 |
| 177 | Ga0439435_0019353 | 3300042436 | Bacteria | 1744 |
| 178 | Ga0466965_0039658 | 3300044683 | Bacteria | 2316 |
| 179 | Ga0466966_0040659 | 3300044684 | Bacteria | 2992 |
| 180 | Ga0466957_0069541 | 3300044842 | Bacteria | 2175 |
| 181 | Ga0466959_0001589 | 3300045049 | Bacteria | 14001 |
| 182 | Ga0466959_0404122 | 3300045049 | Bacteria | 928 |
| 183 | Ga0451576_0015893 | 3300045051 | Bacteria | 8321 |
| 184 | Ga0495592_0017240 | 3300046454 | Bacteria | 5485 |
| 185 | Ga0495603_0008270 | 3300046455 | Bacteria | 6288 |
| 186 | Ga0495590_0002032 | 3300046457 | Bacteria | 8498 |
| 187 | Ga0495590_0022188 | 3300046457 | Bacteria | 2245 |
| 188 | Ga0495629_0000119 | 3300046459 | Bacteria | 69922 |
| 189 | Ga0495629_0000687 | 3300046459 | Bacteria | 27397 |
| 190 | Ga0495638_0000558 | 3300046460 | Bacteria | 42376 |
| 191 | Ga0495638_0002784 | 3300046460 | Bacteria | 14041 |
| 192 | Ga0495638_0013995 | 3300046460 | Bacteria | 5439 |
| 193 | Ga0495638_0061936 | 3300046460 | Bacteria | 2310 |
| 194 | Ga0495651_0000185 | 3300046462 | Bacteria | 46374 |
| 195 | Ga0495653_0000105 | 3300046463 | Bacteria | 69642 |
| 196 | Ga0495653_0000831 | 3300046463 | Bacteria | 23809 |
| 197 | Ga0495650_0010109 | 3300046471 | Bacteria | 5297 |
| 198 | Ga0495580_0025976 | 3300046472 | Bacteria | 4273 |
| 199 | Ga0495582_0061341 | 3300046473 | Bacteria | 2076 |
| 200 | Ga0495605_0003091 | 3300046474 | Bacteria | 10041 |
| 201 | Ga0495605_0010868 | 3300046474 | Bacteria | 5084 |
| 202 | Ga0495605_0077974 | 3300046474 | Bacteria | 1553 |
| 203 | Ga0495607_0004389 | 3300046501 | Bacteria | 10395 |
| 204 | Ga0495583_0012502 | 3300046506 | Bacteria | 4796 |
| 205 | Ga0495583_0055061 | 3300046506 | Bacteria | 1798 |
| 206 | Ga0495606_0033922 | 3300046507 | Bacteria | 3512 |
| 207 | Ga0495606_0109565 | 3300046507 | Bacteria | 1667 |
| 208 | Ga0495608_0000598 | 3300046511 | Bacteria | 24822 |
| 209 | Ga0495610_0003810 | 3300046512 | Bacteria | 11500 |
| 210 | Ga0495610_0005191 | 3300046512 | Bacteria | 9327 |
| 211 | Ga0495616_0005685 | 3300046513 | Bacteria | 7639 |
| 212 | Ga0495616_0008108 | 3300046513 | Bacteria | 6254 |
| 213 | Ga0495616_0008326 | 3300046513 | Bacteria | 6151 |
| 214 | Ga0495620_0008148 | 3300046515 | Bacteria | 5640 |
| 215 | Ga0495620_0034480 | 3300046515 | Bacteria | 2286 |
| 216 | Ga0495628_0012799 | 3300046516 | Bacteria | 7065 |
| 217 | Ga0495628_0032327 | 3300046516 | Bacteria | 4224 |
| 218 | Ga0495630_0002805 | 3300046517 | Bacteria | 12087 |
| 219 | Ga0495630_0024003 | 3300046517 | Bacteria | 4509 |
| 220 | Ga0495631_0003347 | 3300046518 | Bacteria | 8791 |
| 221 | Ga0495637_0086374 | 3300046520 | Bacteria | 1244 |
| 222 | Ga0495648_0037818 | 3300046524 | Bacteria | 3096 |
| 223 | Ga0495648_0229186 | 3300046524 | Bacteria | 910 |
| 224 | Ga0495666_0024032 | 3300046526 | Bacteria | 3014 |
| 225 | Ga0495652_0001337 | 3300046529 | Bacteria | 27446 |
| 226 | Ga0495654_0004228 | 3300046530 | Bacteria | 8583 |
| 227 | Ga0495654_0007875 | 3300046530 | Bacteria | 5925 |
| 228 | Ga0495665_0022743 | 3300046531 | Bacteria | 3367 |
| 229 | Ga0495640_0046814 | 3300046533 | Bacteria | 2995 |
| 230 | Ga0495587_0003497 | 3300046536 | Bacteria | 10458 |
| 231 | Ga0495609_0020394 | 3300046538 | Bacteria | 3063 |
| 232 | Ga0495622_0007226 | 3300046557 | Bacteria | 5155 |
| 233 | Ga0495667_0002126 | 3300046559 | Bacteria | 13187 |
| 234 | Ga0495634_0001253 | 3300046642 | Bacteria | 23332 |
| 235 | Ga0495611_0009097 | 3300046648 | Bacteria | 4199 |
| 236 | Ga0495625_0013426 | 3300046660 | Bacteria | 6583 |
| 237 | Ga0495625_0041326 | 3300046660 | Bacteria | 3357 |
| 238 | Ga0495625_0362531 | 3300046660 | Bacteria | 913 |
| 239 | Ga0495588_0121771 | 3300046674 | Bacteria | 1375 |
| 240 | Ga0495588_0203171 | 3300046674 | Bacteria | 1047 |
| 241 | Ga0495657_0009967 | 3300046675 | Bacteria | 7168 |
| 242 | Ga0495599_0001430 | 3300046678 | Bacteria | 13677 |
| 243 | Ga0495623_0002363 | 3300046679 | Bacteria | 12552 |
| 244 | Ga0495646_0001973 | 3300046680 | Bacteria | 12375 |
| 245 | Ga0495646_0012891 | 3300046680 | Bacteria | 5315 |
| 246 | Ga0495669_0031681 | 3300046684 | Bacteria | 2322 |
| 247 | Ga0495613_0072504 | 3300046689 | Bacteria | 2510 |
| 248 | Ga0495613_0143302 | 3300046689 | Bacteria | 1706 |
| 249 | Ga0495624_0107517 | 3300046690 | Bacteria | 1716 |
| 250 | Ga0495649_0098741 | 3300046694 | Bacteria | 1553 |
| 251 | Ga0495589_0019487 | 3300046794 | Bacteria | 3477 |
| 252 | Ga0495589_0020644 | 3300046794 | Bacteria | 3369 |
| 253 | Ga0495600_0000663 | 3300046809 | Bacteria | 17927 |
| 254 | Ga0495660_0126627 | 3300046810 | Bacteria | 1286 |
| 255 | Ga0495604_0000478 | 3300047317 | Bacteria | 35243 |
| 256 | Ga0495674_0005391 | 3300047319 | Bacteria | 12279 |
| 257 | Ga0495674_0047204 | 3300047319 | Bacteria | 3819 |
| 258 | Ga0495676_0082146 | 3300047321 | Bacteria | 2439 |
| 259 | Ga0495676_0186038 | 3300047321 | Bacteria | 1452 |
| 260 | Ga0495680_0000640 | 3300047322 | Bacteria | 39222 |
| 261 | Ga0495683_0034087 | 3300047323 | Bacteria | 2589 |
| 262 | Ga0495683_0048843 | 3300047323 | Bacteria | 2120 |
| 263 | Ga0495687_017631 | 3300047443 | Bacteria | 3554 |
| 264 | Ga0495675_0003306 | 3300047444 | Bacteria | 9693 |
| 265 | Ga0495677_0011179 | 3300047445 | Bacteria | 3286 |
| 266 | Ga0495679_000036 | 3300047446 | Bacteria | 161473 |
| 267 | Ga0495673_0005195 | 3300047469 | Bacteria | 7922 |
| 268 | Ga0495686_0006696 | 3300047472 | Bacteria | 8767 |
| 269 | Ga0495593_0012854 | 3300047673 | Bacteria | 4782 |
| 270 | Ga0495602_0028131 | 3300048088 | Bacteria | 5385 |
| 271 | Ga0495614_0049840 | 3300048089 | Bacteria | 1795 |
| 272 | Ga0495626_0023838 | 3300048091 | Bacteria | 3007 |
| 273 | Ga0495626_0042998 | 3300048091 | Bacteria | 2121 |
| 274 | Ga0496100_0000086 | 3300048903 | Bacteria | 53043 |
| 275 | Ga0496101_0000044 | 3300048904 | Bacteria | 161295 |
| 276 | Ga0496101_0000224 | 3300048904 | Bacteria | 42435 |
| 277 | Ga0496102_0010285 | 3300048905 | Bacteria | 8044 |
| 278 | Ga0496102_0241086 | 3300048905 | Bacteria | 1705 |
| 279 | Ga0496103_0001893 | 3300048906 | Bacteria | 13609 |
| 280 | Ga0496104_0321329 | 3300048907 | Bacteria | 1461 |
| 281 | Ga0496105_0003748 | 3300048908 | Bacteria | 11325 |
| 282 | Ga0496106_0078646 | 3300048909 | Bacteria | 2531 |
| 283 | Ga0496107_0138143 | 3300048910 | Bacteria | 1801 |
| 284 | Ga0496109_0434765 | 3300048912 | Bacteria | 1240 |
| 285 | Ga0496109_0503906 | 3300048912 | Bacteria | 1143 |
| 286 | Ga0496112_0056945 | 3300048915 | Bacteria | 3848 |
| 287 | Ga0496113_0002020 | 3300048916 | Bacteria | 11646 |
| 288 | Ga0496113_0537949 | 3300048916 | Bacteria | 937 |
| 289 | Ga0496116_0003806 | 3300048919 | Bacteria | 14746 |
| 290 | Ga0496116_0047388 | 3300048919 | Bacteria | 2893 |
| 291 | Ga0496116_0047641 | 3300048919 | Bacteria | 2884 |
| 292 | Ga0496116_0064446 | 3300048919 | Bacteria | 2355 |
| 293 | Ga0496116_0093811 | 3300048919 | Bacteria | 1816 |
| 294 | Ga0496117_0000098 | 3300048920 | Bacteria | 196331 |
| 295 | Ga0496117_0002577 | 3300048920 | Bacteria | 22566 |
| 296 | Ga0496117_0017448 | 3300048920 | Bacteria | 5993 |
| 297 | Ga0496117_0026156 | 3300048920 | Bacteria | 4571 |
| 298 | Ga0496117_0086948 | 3300048920 | Bacteria | 2028 |
| 299 | Ga0496117_0114277 | 3300048920 | Bacteria | 1674 |
| 300 | Ga0496118_0000728 | 3300048921 | Bacteria | 53140 |
| 301 | Ga0496118_0007352 | 3300048921 | Bacteria | 11712 |
| 302 | Ga0496118_0025602 | 3300048921 | Bacteria | 5051 |
| 303 | Ga0496119_0105287 | 3300048922 | Bacteria | 1576 |
| 304 | Ga0496119_0116542 | 3300048922 | Bacteria | 1474 |
| 305 | Ga0496121_0000643 | 3300048924 | Bacteria | 65217 |
| 306 | Ga0496121_0004299 | 3300048924 | Bacteria | 19303 |
| 307 | Ga0496121_0013301 | 3300048924 | Bacteria | 8859 |
| 308 | Ga0496121_0021173 | 3300048924 | Bacteria | 6385 |
| 309 | Ga0496121_0023049 | 3300048924 | Bacteria | 6014 |
| 310 | Ga0496121_0026019 | 3300048924 | Bacteria | 5532 |
| 311 | Ga0496121_0131176 | 3300048924 | Bacteria | 1875 |
| 312 | Ga0496122_0021785 | 3300048925 | Bacteria | 5720 |
| 313 | Ga0496122_0095067 | 3300048925 | Bacteria | 2015 |
| 314 | Ga0496122_0130652 | 3300048925 | Bacteria | 1596 |
| 315 | Ga0496122_0131798 | 3300048925 | Bacteria | 1586 |
| 316 | Ga0496123_0002639 | 3300048926 | Bacteria | 21715 |
| 317 | Ga0496123_0041512 | 3300048926 | Bacteria | 3188 |
| 318 | Ga0496123_0114290 | 3300048926 | Bacteria | 1535 |
| 319 | Ga0496124_0459077 | 3300048927 | Bacteria | 866 |
| 320 | Ga0496125_0001227 | 3300048928 | Bacteria | 38397 |
| 321 | Ga0496125_0056455 | 3300048928 | Bacteria | 3188 |
| 322 | Ga0496125_0074948 | 3300048928 | Bacteria | 2621 |
| 323 | Ga0496125_0187036 | 3300048928 | Bacteria | 1372 |
| 324 | Ga0496126_0027842 | 3300048929 | Bacteria | 5391 |
| 325 | Ga0496126_0107852 | 3300048929 | Bacteria | 2429 |
| 326 | Ga0496126_0218149 | 3300048929 | Bacteria | 1604 |
| 327 | Ga0496126_0308227 | 3300048929 | Bacteria | 1304 |
| 328 | Ga0496126_0564602 | 3300048929 | Bacteria | 901 |
| 329 | Ga0495678_017335 | 3300049459 | Bacteria | 3267 |
| 330 | Ga0495682_0011728 | 3300049460 | Bacteria | 3368 |
| 331 | Ga0495682_0024899 | 3300049460 | Bacteria | 2228 |
| 332 | Ga0501031_0256804 | 3300049568 | Bacteria | 1136 |
| 333 | Ga0501032_0007033 | 3300049569 | Bacteria | 8252 |
| 334 | Ga0501033_0010149 | 3300049570 | Bacteria | 7229 |
| 335 | Ga0501034_0075155 | 3300049571 | Bacteria | 3386 |
| 336 | Ga0501036_0004663 | 3300049572 | Bacteria | 11075 |
| 337 | Ga0501036_0914929 | 3300049572 | Bacteria | 720 |
| 338 | Ga0501037_0005193 | 3300049573 | Bacteria | 9470 |
| 339 | Ga0501038_0010330 | 3300049574 | Bacteria | 8539 |
| 340 | Ga0501038_0363660 | 3300049574 | Bacteria | 1125 |
| 341 | Ga0501039_0068875 | 3300049575 | Bacteria | 2747 |
| 342 | Ga0501042_0164376 | 3300049578 | Bacteria | 1601 |
| 343 | Ga0501043_0010483 | 3300049579 | Bacteria | 7258 |
| 344 | Ga0501046_0013654 | 3300049580 | Bacteria | 6869 |
| 345 | Ga0501046_0334927 | 3300049580 | Bacteria | 1101 |
| 346 | Ga0501047_0092567 | 3300049581 | Bacteria | 2901 |
| 347 | Ga0501047_0152425 | 3300049581 | Bacteria | 2187 |
| 348 | Ga0501048_0033786 | 3300049582 | Bacteria | 3693 |
| 349 | Ga0501048_0220992 | 3300049582 | Bacteria | 1344 |
| 350 | Ga0501067_0070124 | 3300049583 | Bacteria | 1941 |
| 351 | Ga0501068_0049668 | 3300049584 | Bacteria | 2534 |
| 352 | Ga0501069_0009548 | 3300049585 | Bacteria | 5122 |
| 353 | Ga0501070_0019709 | 3300049586 | Bacteria | 5656 |
| 354 | Ga0501071_0299975 | 3300049587 | Bacteria | 1218 |
| 355 | Ga0501073_0011504 | 3300049589 | Bacteria | 6470 |
| 356 | Ga0501074_0035277 | 3300049590 | Bacteria | 3623 |
| 357 | Ga0501076_0196732 | 3300049592 | Bacteria | 1646 |
| 358 | Ga0501077_0198064 | 3300049593 | Bacteria | 1276 |
| 359 | Ga0501079_0426866 | 3300049741 | Bacteria | 1041 |
| 360 | Ga0501080_0008356 | 3300049742 | Bacteria | 9373 |
| 361 | Ga0501083_0001455 | 3300049744 | Bacteria | 16165 |
| 362 | Ga0501083_0024844 | 3300049744 | Bacteria | 4150 |
| 363 | Ga0501083_0035426 | 3300049744 | Bacteria | 3409 |
| 364 | Ga0501262_000165 | 3300049759 | Bacteria | 8174 |
| 365 | Ga0501035_0026098 | 3300049822 | Bacteria | 5350 |
| 366 | Ga0501044_0024850 | 3300049823 | Bacteria | 6354 |
| 367 | Ga0501044_0428882 | 3300049823 | Bacteria | 1231 |
| 368 | nmdc:mga00v17_27032_c1 | 3300050491 | Bacteria | 3347 |
| 369 | nmdc:mga00v17_42903_c1 | 3300050491 | Bacteria | 2722 |
| 370 | nmdc:mga0yw44_353828_c1 | 3300050492 | Bacteria | 989 |
| 371 | nmdc:mga0k408_6128_c1 | 3300050493 | Bacteria | 6411 |
| 372 | nmdc:mga06z11_78451_c1 | 3300050494 | Bacteria | 1765 |
| 373 | nmdc:mga05p37_285_c1 | 3300050507 | Bacteria | 52916 |
| 374 | nmdc:mga09592_9564_c1 | 3300050508 | Bacteria | 7877 |
| 375 | nmdc:mga06r32_118_c1 | 3300050510 | Bacteria | 56778 |
| 376 | nmdc:mga06r32_254298_c1 | 3300050510 | Bacteria | 1744 |
| 377 | nmdc:mga08y16_293295_c1 | 3300050511 | Bacteria | 1677 |
| 378 | nmdc:mga08y16_303_c1 | 3300050511 | Bacteria | 44322 |
| 379 | nmdc:mga0sz30_9739_c1 | 3300050516 | Bacteria | 3664 |
| 380 | Ga0495601_0001131 | 3300053077 | Bacteria | 14620 |
| 381 | Ga0500635_0036175 | 3300053080 | Bacteria | 1626 |
| 382 | Ga0495595_0000142 | 3300053084 | Bacteria | 29571 |
| 383 | Ga0495619_0003389 | 3300053085 | Bacteria | 10299 |
| 384 | Ga0495619_0053191 | 3300053085 | Bacteria | 2677 |
| 385 | Ga0500643_002411 | 3300053087 | Bacteria | 9688 |
| 386 | Ga0500643_029605 | 3300053087 | Bacteria | 1683 |
| 387 | Ga0500644_0023243 | 3300053088 | Bacteria | 1880 |
| 388 | Ga0500644_0181436 | 3300053088 | Bacteria | 862 |
| 389 | Ga0500651_0077910 | 3300053093 | Bacteria | 2056 |
| 390 | Ga0500566_0154254 | 3300053094 | Bacteria | 1204 |
| 391 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 392 | Ga0500556_0011257 | 3300053104 | Bacteria | 2646 |
| 393 | Ga0500562_041104 | 3300053108 | Bacteria | 1229 |
| 394 | Ga0500592_003029 | 3300053116 | Bacteria | 2686 |
| 395 | Ga0500594_0002223 | 3300053118 | Bacteria | 4203 |
| 396 | Ga0500595_003700 | 3300053119 | Bacteria | 7055 |
| 397 | Ga0500626_030117 | 3300053128 | Bacteria | 2449 |
| 398 | Ga0500652_000921 | 3300053131 | Bacteria | 9694 |
| 399 | Ga0500658_0000058 | 3300053134 | Bacteria | 55299 |
| 400 | Ga0500559_0004819 | 3300053136 | Bacteria | 6305 |
| 401 | Ga0500568_0001594 | 3300053139 | Bacteria | 14345 |
| 402 | Ga0500568_0001943 | 3300053139 | Bacteria | 12668 |
| 403 | Ga0500577_0169598 | 3300053142 | Bacteria | 933 |
| 404 | Ga0500604_0000208 | 3300053151 | Bacteria | 16819 |
| 405 | Ga0500616_0000114 | 3300053153 | Bacteria | 148574 |
| 406 | Ga0500616_0027644 | 3300053153 | Bacteria | 3130 |
| 407 | Ga0500616_0070155 | 3300053153 | Bacteria | 1790 |
| 408 | Ga0500622_0005705 | 3300053156 | Bacteria | 7400 |
| 409 | Ga0500627_0130911 | 3300053158 | Bacteria | 1133 |
| 410 | Ga0500636_0052503 | 3300053177 | Bacteria | 2394 |
| 411 | Ga0501084_0006355 | 3300054114 | Bacteria | 9707 |
| 412 | Ga0501082_0022242 | 3300060353 | Bacteria | 5464 |
| 413 | Ga0501082_0338226 | 3300060353 | Bacteria | 1312 |
| 414 | Ga0466962_0229822 | 3300061719 | Bacteria | 909 |
| 415 | 2513862159 | 2513237137 | Bacteria | 9558895 |
| 416 | 2514047669 | 2513237166 | Bacteria | 10373764 |
| 417 | 2517895311 | 2517572143 | Bacteria | 9484767 |
| 418 | 2563061075 | 2562617112 | Bacteria | 10918404 |
| 419 | 2603857608 | 2602042107 | Bacteria | 6226103 |
| 420 | 2643754847 | 2643221547 | Bacteria | 4740017 |
| 421 | 2713476034 | 2711768613 | Bacteria | 11048459 |
| 422 | 2793069283 | 2791355197 | Bacteria | 8420563 |
| 423 | 2848863605 | 2848858292 | Bacteria | 7391279 |
| 424 | 2888378903 | 2888378607 | Bacteria | 9652610 |
| 425 | 2903750429 | 2903748898 | Bacteria | 9972761 |
| 426 | 2904698644 | 2904690495 | Bacteria | 9412302 |
| 427 | 2906403977 | 2906401398 | Bacteria | 6693206 |
| 428 | 2906663540 | 2906660503 | Bacteria | 8595048 |
| 429 | 2908745504 | 2908739725 | Bacteria | 8628932 |
| 430 | 2908761976 | 2908756301 | Bacteria | 8864324 |
| 431 | 2919076605 | 2919073203 | Bacteria | 6531949 |
| 432 | 2935613705 | 2935608549 | Bacteria | 8203142 |
| 433 | 2935643346 | 2935638405 | Bacteria | 10015038 |
| 434 | 2935713141 | 2935703347 | Bacteria | 10242284 |
| 435 | 2935832869 | 2935827899 | Bacteria | 10038562 |
| 436 | 2935873365 | 2935864058 | Bacteria | 9784707 |
| 437 | 2935879207 | 2935873716 | Bacteria | 9632195 |
| 438 | 2935996852 | 2935992306 | Bacteria | 9802711 |
| 439 | 3001890525 | 3001889506 | Bacteria | 2975194 |
| 440 | 3005477031 | 3005474847 | Bacteria | 9259049 |
| 441 | 8019578836 | 8019576017 | Bacteria | 10049540 |
| 442 | 8019596907 | 8019586578 | Bacteria | 10212056 |
| 443 | 8019604808 | 8019597564 | Bacteria | 10041141 |
| 444 | 8019613722 | 8019608314 | Bacteria | 10042931 |
| 445 | 8024490714 | 8024486573 | Bacteria | 6540512 |
| 446 | 8054009065 | 8054002106 | Bacteria | 7987183 |
| 447 | Ga0315911_1000004 | |||
| 448 | JGI24751J29686_10032029 | |||
| 449 | JGI25160J50197_1000184 | |||
| 450 | Ga0055526_1027115 | |||
| 451 | Ga0065165_1001355 | |||
| 452 | Ga0065715_10000497 | |||
| 453 | Ga0070658_10305818 | |||
| 454 | Ga0070658_10629910 | |||
| 455 | Ga0070683_100583644 | |||
| 456 | Ga0070690_100323744 | |||
| 457 | Ga0068869_100100923 | |||
| 458 | Ga0070680_100338414 | |||
| 459 | Ga0070660_100192178 | |||
| 460 | Ga0070689_100353547 | |||
| 461 | Ga0070687_100010290 | |||
| 462 | Ga0070687_100042854 | |||
| 463 | Ga0070675_100748797 | |||
| 464 | Ga0070673_100411385 | |||
| 465 | Ga0070673_100672729 | |||
| 466 | Ga0070703_10002141 | |||
| 467 | Ga0070701_10010549 | |||
| 468 | Ga0070700_100082103 | |||
| 469 | Ga0070708_100004618 | |||
| 470 | Ga0070678_100491308 | |||
| 471 | Ga0070662_100176938 | |||
| 472 | Ga0070681_10073034 | |||
| 473 | Ga0068867_100059588 | |||
| 474 | Ga0070706_100004294 | |||
| 475 | Ga0070707_100088093 | |||
| 476 | Ga0070698_100021194 | |||
| 477 | Ga0070679_100106690 | |||
| 478 | Ga0070684_100055449 | |||
| 479 | Ga0070686_100043647 | |||
| 480 | Ga0070695_100006755 | |||
| 481 | Ga0070695_100218130 | |||
| 482 | Ga0070696_100049527 | |||
| 483 | Ga0068855_100737003 | |||
| 484 | Ga0070664_100052295 | |||
| 485 | Ga0070664_100109527 | |||
| 486 | Ga0068857_100006321 | |||
| 487 | Ga0068857_100038046 | |||
| 488 | Ga0068854_100693887 | |||
| 489 | Ga0068852_100422571 | |||
| 490 | Ga0068864_100029756 | |||
| 491 | Ga0068861_100164346 | |||
| 492 | Ga0068863_100006766 | |||
| 493 | Ga0068858_100397793 | |||
| 494 | Ga0068858_100502023 | |||
| 495 | Ga0068860_100094431 | |||
| 496 | Ga0068862_100396123 | |||
| 497 | Ga0081455_10000919 | |||
| 498 | Ga0081455_10278914 | |||
| 499 | Ga0081539_10014335 | |||
| 500 | Ga0081539_10035583 | |||
| 501 | Ga0070717_10257275 | |||
| 502 | Ga0075363_100117106 | |||
| 503 | Ga0075363_100222982 | |||
| 504 | Ga0075364_10005042 | |||
| 505 | Ga0075364_10005490 | |||
| 506 | Ga0075432_10061487 | |||
| 507 | Ga0070712_100009522 | |||
| 508 | Ga0075362_10000810 | |||
| 509 | Ga0075367_10026177 | |||
| 510 | Ga0075367_10058592 | |||
| 511 | Ga0075369_10064455 | |||
| 512 | Ga0075369_10070025 | |||
| 513 | Ga0097621_100000445 | |||
| 514 | Ga0068871_100001310 | |||
| 515 | Ga0075428_100000426 | |||
| 516 | Ga0075431_100000059 | |||
| 517 | Ga0075431_100318143 | |||
| 518 | Ga0075429_100007528 | |||
| 519 | Ga0105250_10062777 | |||
| 520 | Ga0105240_10181444 | |||
| 521 | Ga0111539_10002614 | |||
| 522 | Ga0105245_10465815 | |||
| 523 | Ga0105247_10008352 | |||
| 524 | Ga0114129_10001483 | |||
| 525 | Ga0105243_10048496 | |||
| 526 | Ga0105243_10085525 | |||
| 527 | Ga0105243_10134635 | |||
| 528 | Ga0105241_10077007 | |||
| 529 | Ga0105242_10095815 | |||
| 530 | Ga0105248_10056291 | |||
| 531 | Ga0105248_10896585 | |||
| 532 | Ga0105238_10699783 | |||
| 533 | Ga0157373_10195930 | |||
| 534 | Ga0157370_10012366 | |||
| 535 | Ga0157375_10146313 | |||
| 536 | Ga0157375_10592043 | |||
| 537 | Ga0157380_10042555 | |||
| 538 | Ga0157380_10111236 | |||
| 539 | Ga0157376_10126616 | |||
| 540 | Ga0183362_10001 | |||
| 541 | Ga0163161_10089107 | |||
| 542 | Ga0213874_10018031 | |||
| 543 | Ga0209233_1005652 | |||
| 544 | Ga0209130_1012227 | |||
| 545 | Ga0209675_1007782 | |||
| 546 | Ga0209564_1009934 | |||
| 547 | Ga0209050_1008405 | |||
| 548 | Ga0207426_1000004 | |||
| 549 | Ga0207655_1003880 | |||
| 550 | Ga0207653_10000347 | |||
| 551 | Ga0207692_10208072 | |||
| 552 | Ga0207684_10060230 | |||
| 553 | Ga0207707_10043643 | |||
| 554 | Ga0207695_10200123 | |||
| 555 | Ga0207693_10001023 | |||
| 556 | Ga0207662_10015134 | |||
| 557 | Ga0207662_10046606 | |||
| 558 | Ga0207662_10087480 | |||
| 559 | Ga0207657_10150193 | |||
| 560 | Ga0207652_10062154 | |||
| 561 | Ga0207646_10137140 | |||
| 562 | Ga0207700_10531295 | |||
| 563 | Ga0207664_10234250 | |||
| 564 | Ga0207706_10017144 | |||
| 565 | Ga0207709_10024152 | |||
| 566 | Ga0207709_10541817 | |||
| 567 | Ga0207670_10120153 | |||
| 568 | Ga0207691_10407264 | |||
| 569 | Ga0207711_10015828 | |||
| 570 | Ga0207711_10477125 | |||
| 571 | Ga0207689_10087541 | |||
| 572 | Ga0207679_10057291 | |||
| 573 | Ga0207679_10098746 | |||
| 574 | Ga0207651_10707821 | |||
| 575 | Ga0207640_10112480 | |||
| 576 | Ga0207658_10396707 | |||
| 577 | Ga0207703_10385764 | |||
| 578 | Ga0207639_10279707 | |||
| 579 | Ga0207708_10062030 | |||
| 580 | Ga0207648_10063456 | |||
| 581 | Ga0207648_10136318 | |||
| 582 | Ga0207676_10062656 | |||
| 583 | Ga0207674_10006766 | |||
| 584 | Ga0207674_10221287 | |||
| 585 | Ga0207674_10239807 | |||
| 586 | Ga0207683_10606520 | |||
| 587 | Ga0207428_10009343 | |||
| 588 | Ga0207428_10096413 | |||
| 589 | Ga0268265_10341159 | |||
| 590 | Ga0265337_1002183 | |||
| 591 | Ga0307517_10000035 | |||
| 592 | Ga0307515_10092206 | |||
| 593 | Ga0316181_1037493 | |||
| 594 | Ga0265762_1003372 | |||
| 595 | Ga0265332_10052084 | |||
| 596 | Ga0265340_10015775 | |||
| 597 | Ga0265342_10183260 | |||
| 598 | Ga0307410_10559436 | |||
| 599 | Ga0307407_10216783 | |||
| 600 | Ga0307416_101143540 | |||
| 601 | Ga0373929_0019800 | |||
| 602 | Ga0373934_0023702 | |||
| 603 | Ga0373932_0024236 | |||
| 604 | Ga0373936_0057790 | |||
| 605 | Ga0373941_0018218 | |||
| 606 | Ga0373954_0007126 | |||
| 607 | Ga0373955_0006860 | |||
| 608 | Ga0373961_0040940 | |||
| 609 | Ga0373924_0004152 | |||
| 610 | Ga0373931_0004070 | |||
| 611 | Ga0373931_0011184 | |||
| 612 | Ga0373935_0023511 | |||
| 613 | Ga0373927_0022365 | |||
| 614 | Ga0373933_0002610 | |||
| 615 | Ga0373933_0495012 | |||
| 616 | Ga0373947_0019484 | |||
| 617 | Ga0373937_0000403 | |||
| 618 | Ga0373925_0099271 | |||
| 619 | Ga0436365_1559602 | |||
| 620 | Ga0436360_0985056 | |||
| 621 | Ga0436363_0388188 | |||
| 622 | Ga0436362_0480253 | |||
| 623 | Ga0439435_0019353 | |||
| 624 | Ga0466965_0039658 | |||
| 625 | Ga0466966_0040659 | |||
| 626 | Ga0466957_0069541 | |||
| 627 | Ga0466959_0001589 | |||
| 628 | Ga0466959_0404122 | |||
| 629 | Ga0451576_0015893 | |||
| 630 | Ga0495592_0017240 | |||
| 631 | Ga0495603_0008270 | |||
| 632 | Ga0495590_0002032 | |||
| 633 | Ga0495590_0022188 | |||
| 634 | Ga0495629_0000119 | |||
| 635 | Ga0495629_0000687 | |||
| 636 | Ga0495638_0000558 | |||
| 637 | Ga0495638_0002784 | |||
| 638 | Ga0495638_0013995 | |||
| 639 | Ga0495638_0061936 | |||
| 640 | Ga0495651_0000185 | |||
| 641 | Ga0495653_0000105 | |||
| 642 | Ga0495653_0000831 | |||
| 643 | Ga0495650_0010109 | |||
| 644 | Ga0495580_0025976 | |||
| 645 | Ga0495582_0061341 | |||
| 646 | Ga0495605_0003091 | |||
| 647 | Ga0495605_0010868 | |||
| 648 | Ga0495605_0077974 | |||
| 649 | Ga0495607_0004389 | |||
| 650 | Ga0495583_0012502 | |||
| 651 | Ga0495583_0055061 | |||
| 652 | Ga0495606_0033922 | |||
| 653 | Ga0495606_0109565 | |||
| 654 | Ga0495608_0000598 | |||
| 655 | Ga0495610_0003810 | |||
| 656 | Ga0495610_0005191 | |||
| 657 | Ga0495616_0005685 | |||
| 658 | Ga0495616_0008108 | |||
| 659 | Ga0495616_0008326 | |||
| 660 | Ga0495620_0008148 | |||
| 661 | Ga0495620_0034480 | |||
| 662 | Ga0495628_0012799 | |||
| 663 | Ga0495628_0032327 | |||
| 664 | Ga0495630_0002805 | |||
| 665 | Ga0495630_0024003 | |||
| 666 | Ga0495631_0003347 | |||
| 667 | Ga0495637_0086374 | |||
| 668 | Ga0495648_0037818 | |||
| 669 | Ga0495648_0229186 | |||
| 670 | Ga0495666_0024032 | |||
| 671 | Ga0495652_0001337 | |||
| 672 | Ga0495654_0004228 | |||
| 673 | Ga0495654_0007875 | |||
| 674 | Ga0495665_0022743 | |||
| 675 | Ga0495640_0046814 | |||
| 676 | Ga0495587_0003497 | |||
| 677 | Ga0495609_0020394 | |||
| 678 | Ga0495622_0007226 | |||
| 679 | Ga0495667_0002126 | |||
| 680 | Ga0495634_0001253 | |||
| 681 | Ga0495611_0009097 | |||
| 682 | Ga0495625_0013426 | |||
| 683 | Ga0495625_0041326 | |||
| 684 | Ga0495625_0362531 | |||
| 685 | Ga0495588_0121771 | |||
| 686 | Ga0495588_0203171 | |||
| 687 | Ga0495657_0009967 | |||
| 688 | Ga0495599_0001430 | |||
| 689 | Ga0495623_0002363 | |||
| 690 | Ga0495646_0001973 | |||
| 691 | Ga0495646_0012891 | |||
| 692 | Ga0495669_0031681 | |||
| 693 | Ga0495613_0072504 | |||
| 694 | Ga0495613_0143302 | |||
| 695 | Ga0495624_0107517 | |||
| 696 | Ga0495649_0098741 | |||
| 697 | Ga0495589_0019487 | |||
| 698 | Ga0495589_0020644 | |||
| 699 | Ga0495600_0000663 | |||
| 700 | Ga0495660_0126627 | |||
| 701 | Ga0495604_0000478 | |||
| 702 | Ga0495674_0005391 | |||
| 703 | Ga0495674_0047204 | |||
| 704 | Ga0495676_0082146 | |||
| 705 | Ga0495676_0186038 | |||
| 706 | Ga0495680_0000640 | |||
| 707 | Ga0495683_0034087 | |||
| 708 | Ga0495683_0048843 | |||
| 709 | Ga0495687_017631 | |||
| 710 | Ga0495675_0003306 | |||
| 711 | Ga0495677_0011179 | |||
| 712 | Ga0495679_000036 | |||
| 713 | Ga0495673_0005195 | |||
| 714 | Ga0495686_0006696 | |||
| 715 | Ga0495593_0012854 | |||
| 716 | Ga0495602_0028131 | |||
| 717 | Ga0495614_0049840 | |||
| 718 | Ga0495626_0023838 | |||
| 719 | Ga0495626_0042998 | |||
| 720 | Ga0496100_0000086 | |||
| 721 | Ga0496101_0000044 | |||
| 722 | Ga0496101_0000224 | |||
| 723 | Ga0496102_0010285 | |||
| 724 | Ga0496102_0241086 | |||
| 725 | Ga0496103_0001893 | |||
| 726 | Ga0496104_0321329 | |||
| 727 | Ga0496105_0003748 | |||
| 728 | Ga0496106_0078646 | |||
| 729 | Ga0496107_0138143 | |||
| 730 | Ga0496109_0434765 | |||
| 731 | Ga0496109_0503906 | |||
| 732 | Ga0496112_0056945 | |||
| 733 | Ga0496113_0002020 | |||
| 734 | Ga0496113_0537949 | |||
| 735 | Ga0496116_0003806 | |||
| 736 | Ga0496116_0047388 | |||
| 737 | Ga0496116_0047641 | |||
| 738 | Ga0496116_0064446 | |||
| 739 | Ga0496116_0093811 | |||
| 740 | Ga0496117_0000098 | |||
| 741 | Ga0496117_0002577 | |||
| 742 | Ga0496117_0017448 | |||
| 743 | Ga0496117_0026156 | |||
| 744 | Ga0496117_0086948 | |||
| 745 | Ga0496117_0114277 | |||
| 746 | Ga0496118_0000728 | |||
| 747 | Ga0496118_0007352 | |||
| 748 | Ga0496118_0025602 | |||
| 749 | Ga0496119_0105287 | |||
| 750 | Ga0496119_0116542 | |||
| 751 | Ga0496121_0000643 | |||
| 752 | Ga0496121_0004299 | |||
| 753 | Ga0496121_0013301 | |||
| 754 | Ga0496121_0021173 | |||
| 755 | Ga0496121_0023049 | |||
| 756 | Ga0496121_0026019 | |||
| 757 | Ga0496121_0131176 | |||
| 758 | Ga0496122_0021785 | |||
| 759 | Ga0496122_0095067 | |||
| 760 | Ga0496122_0130652 | |||
| 761 | Ga0496122_0131798 | |||
| 762 | Ga0496123_0002639 | |||
| 763 | Ga0496123_0041512 | |||
| 764 | Ga0496123_0114290 | |||
| 765 | Ga0496124_0459077 | |||
| 766 | Ga0496125_0001227 | |||
| 767 | Ga0496125_0056455 | |||
| 768 | Ga0496125_0074948 | |||
| 769 | Ga0496125_0187036 | |||
| 770 | Ga0496126_0027842 | |||
| 771 | Ga0496126_0107852 | |||
| 772 | Ga0496126_0218149 | |||
| 773 | Ga0496126_0308227 | |||
| 774 | Ga0496126_0564602 | |||
| 775 | Ga0495678_017335 | |||
| 776 | Ga0495682_0011728 | |||
| 777 | Ga0495682_0024899 | |||
| 778 | Ga0501031_0256804 | |||
| 779 | Ga0501032_0007033 | |||
| 780 | Ga0501033_0010149 | |||
| 781 | Ga0501034_0075155 | |||
| 782 | Ga0501036_0004663 | |||
| 783 | Ga0501036_0914929 | |||
| 784 | Ga0501037_0005193 | |||
| 785 | Ga0501038_0010330 | |||
| 786 | Ga0501038_0363660 | |||
| 787 | Ga0501039_0068875 | |||
| 788 | Ga0501042_0164376 | |||
| 789 | Ga0501043_0010483 | |||
| 790 | Ga0501046_0013654 | |||
| 791 | Ga0501046_0334927 | |||
| 792 | Ga0501047_0092567 | |||
| 793 | Ga0501047_0152425 | |||
| 794 | Ga0501048_0033786 | |||
| 795 | Ga0501048_0220992 | |||
| 796 | Ga0501067_0070124 | |||
| 797 | Ga0501068_0049668 | |||
| 798 | Ga0501069_0009548 | |||
| 799 | Ga0501070_0019709 | |||
| 800 | Ga0501071_0299975 | |||
| 801 | Ga0501073_0011504 | |||
| 802 | Ga0501074_0035277 | |||
| 803 | Ga0501076_0196732 | |||
| 804 | Ga0501077_0198064 | |||
| 805 | Ga0501079_0426866 | |||
| 806 | Ga0501080_0008356 | |||
| 807 | Ga0501083_0001455 | |||
| 808 | Ga0501083_0024844 | |||
| 809 | Ga0501083_0035426 | |||
| 810 | Ga0501262_000165 | |||
| 811 | Ga0501035_0026098 | |||
| 812 | Ga0501044_0024850 | |||
| 813 | Ga0501044_0428882 | |||
| 814 | nmdc:mga00v17_27032_c1 | |||
| 815 | nmdc:mga00v17_42903_c1 | |||
| 816 | nmdc:mga0yw44_353828_c1 | |||
| 817 | nmdc:mga0k408_6128_c1 | |||
| 818 | nmdc:mga06z11_78451_c1 | |||
| 819 | nmdc:mga05p37_285_c1 | |||
| 820 | nmdc:mga09592_9564_c1 | |||
| 821 | nmdc:mga06r32_118_c1 | |||
| 822 | nmdc:mga06r32_254298_c1 | |||
| 823 | nmdc:mga08y16_293295_c1 | |||
| 824 | nmdc:mga08y16_303_c1 | |||
| 825 | nmdc:mga0sz30_9739_c1 | |||
| 826 | Ga0495601_0001131 | |||
| 827 | Ga0500635_0036175 | |||
| 828 | Ga0495595_0000142 | |||
| 829 | Ga0495619_0003389 | |||
| 830 | Ga0495619_0053191 | |||
| 831 | Ga0500643_002411 | |||
| 832 | Ga0500643_029605 | |||
| 833 | Ga0500644_0023243 | |||
| 834 | Ga0500644_0181436 | |||
| 835 | Ga0500651_0077910 | |||
| 836 | Ga0500566_0154254 | |||
| 837 | Ga0500556_0000003 | |||
| 838 | Ga0500556_0011257 | |||
| 839 | Ga0500562_041104 | |||
| 840 | Ga0500592_003029 | |||
| 841 | Ga0500594_0002223 | |||
| 842 | Ga0500595_003700 | |||
| 843 | Ga0500626_030117 | |||
| 844 | Ga0500652_000921 | |||
| 845 | Ga0500658_0000058 | |||
| 846 | Ga0500559_0004819 | |||
| 847 | Ga0500568_0001594 | |||
| 848 | Ga0500568_0001943 | |||
| 849 | Ga0500577_0169598 | |||
| 850 | Ga0500604_0000208 | |||
| 851 | Ga0500616_0000114 | |||
| 852 | Ga0500616_0027644 | |||
| 853 | Ga0500616_0070155 | |||
| 854 | Ga0500622_0005705 | |||
| 855 | Ga0500627_0130911 | |||
| 856 | Ga0500636_0052503 | |||
| 857 | Ga0501084_0006355 | |||
| 858 | Ga0501082_0022242 | |||
| 859 | Ga0501082_0338226 | |||
| 860 | Ga0466962_0229822 | |||
| 861 | 2513862159 | |||
| 862 | 2514047669 | |||
| 863 | 2517895311 | |||
| 864 | 2563061075 | |||
| 865 | 2603857608 | |||
| 866 | 2643754847 | |||
| 867 | 2713476034 | |||
| 868 | 2793069283 | |||
| 869 | 2848863605 | |||
| 870 | 2888378903 | |||
| 871 | 2903750429 | |||
| 872 | 2904698644 | |||
| 873 | 2906403977 | |||
| 874 | 2906663540 | |||
| 875 | 2908745504 | |||
| 876 | 2908761976 | |||
| 877 | 2919076605 | |||
| 878 | 2935613705 | |||
| 879 | 2935643346 | |||
| 880 | 2935713141 | |||
| 881 | 2935832869 | |||
| 882 | 2935873365 | |||
| 883 | 2935879207 | |||
| 884 | 2935996852 | |||
| 885 | 3001890525 | |||
| 886 | 3005477031 | |||
| 887 | 8019578836 | |||
| 888 | 8019596907 | |||
| 889 | 8019604808 | |||
| 890 | 8019613722 | |||
| 891 | 8024490714 | |||
| 892 | 8054009065 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9681 | 2 | 231 |
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.9559 | 2 | 231 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.9518 | 2 | 221 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9337 | 2 | 221 |
| 2awn-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9337 | 2 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9874 | 1 | 229 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9664 | 1 | 229 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9599 | 1 | 230 | 3.40.50.300 |
| 1ji0A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9528 | 2 | 231 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9524 | 2 | 216 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A854GVC9-F1-model_v4 | deleted | 0.9915 | 1 | 227 |
|
| AF-A0A496QUQ5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9879 | 2 | 231 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A6G6K803-F1-model_v4 | ABC transporter ATP-binding protein | 0.9869 | 1 | 229 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A1S1RJF5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9865 | 2 | 229 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A238D136-F1-model_v4 | Leucine/isoleucine/valine transporter subunit ATP-binding component of ABC superfamily | 0.9863 | 1 | 228 |
GO:0005524
GO:0005886 GO:0015658 GO:0015807 GO:0016887 |