F445757

General Info

Members Datasets Scaffolds Average Seq Length
446 333 892 236

Family's Representative Sequence

Representative Sequence 3300033442|Ga0315911_1000004|Ga0315911_1000004454
Length 261
Sequence MSEVLLSVDGLAATYNHAIGAVSDVSLVVRPGEIVAVLGANGAGKSTTLQAVSALLPARRGQITAGCILFEGHDLAGISAAALVRAGIVPVLEGRHCFASLTVEENLFTGAIGRDATRAETADDLDRVYTLFPRLKERRRSLAGLTSGGEQQMTAIGRALMSRPRLLVLDEPSMGLAPLVVEGILRALKQLNAEQGLSILVAEQNSTVALRFADHAVVLENGRSVLAGAAAELRRRGDIKTLYLGGSSQVDPSRQPTQAVA

Samples

Sample ID Description Type Environment
1 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
120 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
140 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
165 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
187 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
228 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
229 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
230 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
231 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
232 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
237 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
263 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
277 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
281 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
282 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
283 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
284 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
285 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
286 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
289 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
290 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
291 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
294 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
303 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
304 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
305 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
306 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
307 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
308 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
309 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
310 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
311 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
312 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
313 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
314 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
315 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
316 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
317 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
318 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
319 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
320 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
321 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
322 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
323 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
324 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
325 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
326 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
327 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
328 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
329 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
330 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
331 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
332 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
333 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.6
Metatranscriptomes 0.22
Isolates 7.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.43
Nodule 5.16
Rhizoplane 3.59
Rhizosphere 68.16
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0315911_1000004 3300033442 Bacteria 472637
2 JGI24751J29686_10032029 3300002459 Bacteria 1090
3 JGI25160J50197_1000184 3300003354 Bacteria 53011
4 Ga0055526_1027115 3300003771 Bacteria 1780
5 Ga0065165_1001355 3300005262 Bacteria 27048
6 Ga0065715_10000497 3300005293 Bacteria 10881
7 Ga0070658_10305818 3300005327 Bacteria 1356
8 Ga0070658_10629910 3300005327 Bacteria 930
9 Ga0070683_100583644 3300005329 Bacteria 1069
10 Ga0070690_100323744 3300005330 Bacteria 1111
11 Ga0068869_100100923 3300005334 Bacteria 2182
12 Ga0070680_100338414 3300005336 Unclassified 1278
13 Ga0070660_100192178 3300005339 Bacteria 1654
14 Ga0070689_100353547 3300005340 Bacteria 1233
15 Ga0070687_100010290 3300005343 Bacteria 4040
16 Ga0070687_100042854 3300005343 Bacteria 2296
17 Ga0070675_100748797 3300005354 Bacteria 891
18 Ga0070673_100411385 3300005364 Bacteria 1211
19 Ga0070673_100672729 3300005364 Bacteria 949
20 Ga0070703_10002141 3300005406 Bacteria 5747
21 Ga0070701_10010549 3300005438 Bacteria 4089
22 Ga0070700_100082103 3300005441 Bacteria 2084
23 Ga0070708_100004618 3300005445 Bacteria 10845
24 Ga0070678_100491308 3300005456 Bacteria 1082
25 Ga0070662_100176938 3300005457 Bacteria 1679
26 Ga0070681_10073034 3300005458 Bacteria 3392
27 Ga0068867_100059588 3300005459 Unclassified 2830
28 Ga0070706_100004294 3300005467 Bacteria 13804
29 Ga0070707_100088093 3300005468 Bacteria 3003
30 Ga0070698_100021194 3300005471 Bacteria 6810
31 Ga0070679_100106690 3300005530 Bacteria 2787
32 Ga0070684_100055449 3300005535 Bacteria 3455
33 Ga0070686_100043647 3300005544 Bacteria 2814
34 Ga0070695_100006755 3300005545 Bacteria 6790
35 Ga0070695_100218130 3300005545 Bacteria 1373
36 Ga0070696_100049527 3300005546 Bacteria 2918
37 Ga0068855_100737003 3300005563 Bacteria 1052
38 Ga0070664_100052295 3300005564 Bacteria 3459
39 Ga0070664_100109527 3300005564 Bacteria 2409
40 Ga0068857_100006321 3300005577 Bacteria 10143
41 Ga0068857_100038046 3300005577 Bacteria 4261
42 Ga0068854_100693887 3300005578 Bacteria 878
43 Ga0068852_100422571 3300005616 Bacteria 1315
44 Ga0068864_100029756 3300005618 Bacteria 4628
45 Ga0068861_100164346 3300005719 Bacteria 1834
46 Ga0068863_100006766 3300005841 Bacteria 11240
47 Ga0068858_100397793 3300005842 Bacteria 1323
48 Ga0068858_100502023 3300005842 Bacteria 1172
49 Ga0068860_100094431 3300005843 Bacteria 2851
50 Ga0068862_100396123 3300005844 Bacteria 1291
51 Ga0081455_10000919 3300005937 Bacteria 37836
52 Ga0081455_10278914 3300005937 Bacteria 1208
53 Ga0081539_10014335 3300005985 Bacteria 5872
54 Ga0081539_10035583 3300005985 Bacteria 2989
55 Ga0070717_10257275 3300006028 Bacteria 1544
56 Ga0075363_100117106 3300006048 Bacteria 1485
57 Ga0075363_100222982 3300006048 Bacteria 1081
58 Ga0075364_10005042 3300006051 Bacteria 7654
59 Ga0075364_10005490 3300006051 Bacteria 7374
60 Ga0075432_10061487 3300006058 Bacteria 1338
61 Ga0070712_100009522 3300006175 Bacteria 6126
62 Ga0075362_10000810 3300006177 Bacteria 9342
63 Ga0075367_10026177 3300006178 Bacteria 3305
64 Ga0075367_10058592 3300006178 Bacteria 2292
65 Ga0075369_10064455 3300006186 Bacteria 1604
66 Ga0075369_10070025 3300006186 Bacteria 1543
67 Ga0097621_100000445 3300006237 Bacteria 28963
68 Ga0068871_100001310 3300006358 Bacteria 16647
69 Ga0075428_100000426 3300006844 Bacteria 41901
70 Ga0075431_100000059 3300006847 Bacteria 61740
71 Ga0075431_100318143 3300006847 Bacteria 1570
72 Ga0075429_100007528 3300006880 Bacteria 9453
73 Ga0105250_10062777 3300009092 Bacteria 1495
74 Ga0105240_10181444 3300009093 Bacteria 2484
75 Ga0111539_10002614 3300009094 Bacteria 23869
76 Ga0105245_10465815 3300009098 Bacteria 1275
77 Ga0105247_10008352 3300009101 Bacteria 6313
78 Ga0114129_10001483 3300009147 Bacteria 31789
79 Ga0105243_10048496 3300009148 Bacteria 3348
80 Ga0105243_10085525 3300009148 Bacteria 2585
81 Ga0105243_10134635 3300009148 Bacteria 2101
82 Ga0105241_10077007 3300009174 Bacteria 2602
83 Ga0105242_10095815 3300009176 Bacteria 2506
84 Ga0105248_10056291 3300009177 Bacteria 4412
85 Ga0105248_10896585 3300009177 Bacteria 1001
86 Ga0105238_10699783 3300009551 Bacteria 1025
87 Ga0157373_10195930 3300013100 Bacteria 1424
88 Ga0157370_10012366 3300013104 Bacteria 8856
89 Ga0157375_10146313 3300013308 Bacteria 2494
90 Ga0157375_10592043 3300013308 Bacteria 1269
91 Ga0157380_10042555 3300014326 Bacteria 3550
92 Ga0157380_10111236 3300014326 Bacteria 2302
93 Ga0157376_10126616 3300014969 Bacteria 2273
94 Ga0183362_10001 3300015683 Bacteria 2046624
95 Ga0163161_10089107 3300017792 Bacteria 2281
96 Ga0213874_10018031 3300021377 Bacteria 1903
97 Ga0209233_1005652 3300025261 Bacteria 4129
98 Ga0209130_1012227 3300025284 Bacteria 2258
99 Ga0209675_1007782 3300025291 Bacteria 4042
100 Ga0209564_1009934 3300025295 Bacteria 4452
101 Ga0209050_1008405 3300025298 Bacteria 5528
102 Ga0207426_1000004 3300025302 Bacteria 1047900
103 Ga0207655_1003880 3300025728 Bacteria 10876
104 Ga0207653_10000347 3300025885 Bacteria 23308
105 Ga0207692_10208072 3300025898 Bacteria 1154
106 Ga0207684_10060230 3300025910 Bacteria 3224
107 Ga0207707_10043643 3300025912 Bacteria 3910
108 Ga0207695_10200123 3300025913 Bacteria 1912
109 Ga0207693_10001023 3300025915 Bacteria 25036
110 Ga0207662_10015134 3300025918 Bacteria 4336
111 Ga0207662_10046606 3300025918 Bacteria 2564
112 Ga0207662_10087480 3300025918 Bacteria 1911
113 Ga0207657_10150193 3300025919 Bacteria 1898
114 Ga0207652_10062154 3300025921 Bacteria 3227
115 Ga0207646_10137140 3300025922 Bacteria 2203
116 Ga0207700_10531295 3300025928 Bacteria 1043
117 Ga0207664_10234250 3300025929 Bacteria 1597
118 Ga0207706_10017144 3300025933 Bacteria 6531
119 Ga0207709_10024152 3300025935 Bacteria 3468
120 Ga0207709_10541817 3300025935 Bacteria 914
121 Ga0207670_10120153 3300025936 Bacteria 1908
122 Ga0207691_10407264 3300025940 Bacteria 1160
123 Ga0207711_10015828 3300025941 Bacteria 6256
124 Ga0207711_10477125 3300025941 Bacteria 1162
125 Ga0207689_10087541 3300025942 Bacteria 2559
126 Ga0207679_10057291 3300025945 Bacteria 2881
127 Ga0207679_10098746 3300025945 Bacteria 2278
128 Ga0207651_10707821 3300025960 Bacteria 888
129 Ga0207640_10112480 3300025981 Bacteria 1933
130 Ga0207658_10396707 3300025986 Bacteria 1212
131 Ga0207703_10385764 3300026035 Bacteria 1297
132 Ga0207639_10279707 3300026041 Bacteria 1467
133 Ga0207708_10062030 3300026075 Bacteria 2855
134 Ga0207648_10063456 3300026089 Bacteria 3220
135 Ga0207648_10136318 3300026089 Unclassified 2162
136 Ga0207676_10062656 3300026095 Bacteria 2950
137 Ga0207674_10006766 3300026116 Bacteria 13453
138 Ga0207674_10221287 3300026116 Bacteria 1841
139 Ga0207674_10239807 3300026116 Bacteria 1760
140 Ga0207683_10606520 3300026121 Bacteria 1013
141 Ga0207428_10009343 3300027907 Bacteria 8795
142 Ga0207428_10096413 3300027907 Bacteria 2290
143 Ga0268265_10341159 3300028380 Bacteria 1364
144 Ga0265337_1002183 3300028556 Bacteria 9169
145 Ga0307517_10000035 3300028786 Bacteria 172762
146 Ga0307515_10092206 3300028794 Bacteria 3773
147 Ga0316181_1037493 3300030744 Bacteria 1297
148 Ga0265762_1003372 3300030760 Bacteria 2860
149 Ga0265332_10052084 3300031238 Bacteria 1758
150 Ga0265340_10015775 3300031247 Bacteria 3920
151 Ga0265342_10183260 3300031712 Bacteria 1146
152 Ga0307410_10559436 3300031852 Bacteria 949
153 Ga0307407_10216783 3300031903 Bacteria 1292
154 Ga0307416_101143540 3300032002 Bacteria 884
155 Ga0373929_0019800 3300035085 Bacteria 1351
156 Ga0373934_0023702 3300035086 Bacteria 2372
157 Ga0373932_0024236 3300035112 Bacteria 1631
158 Ga0373936_0057790 3300035113 Bacteria 1578
159 Ga0373941_0018218 3300035115 Bacteria 1937
160 Ga0373954_0007126 3300035118 Bacteria 4881
161 Ga0373955_0006860 3300035172 Bacteria 5207
162 Ga0373961_0040940 3300035241 Bacteria 1337
163 Ga0373924_0004152 3300035410 Bacteria 5039
164 Ga0373931_0004070 3300035691 Bacteria 6628
165 Ga0373931_0011184 3300035691 Bacteria 4332
166 Ga0373935_0023511 3300035692 Bacteria 3787
167 Ga0373927_0022365 3300035695 Bacteria 4142
168 Ga0373933_0002610 3300035724 Bacteria 10097
169 Ga0373933_0495012 3300035724 Bacteria 801
170 Ga0373947_0019484 3300035725 Bacteria 3912
171 Ga0373937_0000403 3300036401 Bacteria 40423
172 Ga0373925_0099271 3300037068 Bacteria 2236
173 Ga0436365_1559602 3300039437 Bacteria 2213
174 Ga0436360_0985056 3300039438 Bacteria 2485
175 Ga0436363_0388188 3300039450 Bacteria 2490
176 Ga0436362_0480253 3300039453 Bacteria 1332
177 Ga0439435_0019353 3300042436 Bacteria 1744
178 Ga0466965_0039658 3300044683 Bacteria 2316
179 Ga0466966_0040659 3300044684 Bacteria 2992
180 Ga0466957_0069541 3300044842 Bacteria 2175
181 Ga0466959_0001589 3300045049 Bacteria 14001
182 Ga0466959_0404122 3300045049 Bacteria 928
183 Ga0451576_0015893 3300045051 Bacteria 8321
184 Ga0495592_0017240 3300046454 Bacteria 5485
185 Ga0495603_0008270 3300046455 Bacteria 6288
186 Ga0495590_0002032 3300046457 Bacteria 8498
187 Ga0495590_0022188 3300046457 Bacteria 2245
188 Ga0495629_0000119 3300046459 Bacteria 69922
189 Ga0495629_0000687 3300046459 Bacteria 27397
190 Ga0495638_0000558 3300046460 Bacteria 42376
191 Ga0495638_0002784 3300046460 Bacteria 14041
192 Ga0495638_0013995 3300046460 Bacteria 5439
193 Ga0495638_0061936 3300046460 Bacteria 2310
194 Ga0495651_0000185 3300046462 Bacteria 46374
195 Ga0495653_0000105 3300046463 Bacteria 69642
196 Ga0495653_0000831 3300046463 Bacteria 23809
197 Ga0495650_0010109 3300046471 Bacteria 5297
198 Ga0495580_0025976 3300046472 Bacteria 4273
199 Ga0495582_0061341 3300046473 Bacteria 2076
200 Ga0495605_0003091 3300046474 Bacteria 10041
201 Ga0495605_0010868 3300046474 Bacteria 5084
202 Ga0495605_0077974 3300046474 Bacteria 1553
203 Ga0495607_0004389 3300046501 Bacteria 10395
204 Ga0495583_0012502 3300046506 Bacteria 4796
205 Ga0495583_0055061 3300046506 Bacteria 1798
206 Ga0495606_0033922 3300046507 Bacteria 3512
207 Ga0495606_0109565 3300046507 Bacteria 1667
208 Ga0495608_0000598 3300046511 Bacteria 24822
209 Ga0495610_0003810 3300046512 Bacteria 11500
210 Ga0495610_0005191 3300046512 Bacteria 9327
211 Ga0495616_0005685 3300046513 Bacteria 7639
212 Ga0495616_0008108 3300046513 Bacteria 6254
213 Ga0495616_0008326 3300046513 Bacteria 6151
214 Ga0495620_0008148 3300046515 Bacteria 5640
215 Ga0495620_0034480 3300046515 Bacteria 2286
216 Ga0495628_0012799 3300046516 Bacteria 7065
217 Ga0495628_0032327 3300046516 Bacteria 4224
218 Ga0495630_0002805 3300046517 Bacteria 12087
219 Ga0495630_0024003 3300046517 Bacteria 4509
220 Ga0495631_0003347 3300046518 Bacteria 8791
221 Ga0495637_0086374 3300046520 Bacteria 1244
222 Ga0495648_0037818 3300046524 Bacteria 3096
223 Ga0495648_0229186 3300046524 Bacteria 910
224 Ga0495666_0024032 3300046526 Bacteria 3014
225 Ga0495652_0001337 3300046529 Bacteria 27446
226 Ga0495654_0004228 3300046530 Bacteria 8583
227 Ga0495654_0007875 3300046530 Bacteria 5925
228 Ga0495665_0022743 3300046531 Bacteria 3367
229 Ga0495640_0046814 3300046533 Bacteria 2995
230 Ga0495587_0003497 3300046536 Bacteria 10458
231 Ga0495609_0020394 3300046538 Bacteria 3063
232 Ga0495622_0007226 3300046557 Bacteria 5155
233 Ga0495667_0002126 3300046559 Bacteria 13187
234 Ga0495634_0001253 3300046642 Bacteria 23332
235 Ga0495611_0009097 3300046648 Bacteria 4199
236 Ga0495625_0013426 3300046660 Bacteria 6583
237 Ga0495625_0041326 3300046660 Bacteria 3357
238 Ga0495625_0362531 3300046660 Bacteria 913
239 Ga0495588_0121771 3300046674 Bacteria 1375
240 Ga0495588_0203171 3300046674 Bacteria 1047
241 Ga0495657_0009967 3300046675 Bacteria 7168
242 Ga0495599_0001430 3300046678 Bacteria 13677
243 Ga0495623_0002363 3300046679 Bacteria 12552
244 Ga0495646_0001973 3300046680 Bacteria 12375
245 Ga0495646_0012891 3300046680 Bacteria 5315
246 Ga0495669_0031681 3300046684 Bacteria 2322
247 Ga0495613_0072504 3300046689 Bacteria 2510
248 Ga0495613_0143302 3300046689 Bacteria 1706
249 Ga0495624_0107517 3300046690 Bacteria 1716
250 Ga0495649_0098741 3300046694 Bacteria 1553
251 Ga0495589_0019487 3300046794 Bacteria 3477
252 Ga0495589_0020644 3300046794 Bacteria 3369
253 Ga0495600_0000663 3300046809 Bacteria 17927
254 Ga0495660_0126627 3300046810 Bacteria 1286
255 Ga0495604_0000478 3300047317 Bacteria 35243
256 Ga0495674_0005391 3300047319 Bacteria 12279
257 Ga0495674_0047204 3300047319 Bacteria 3819
258 Ga0495676_0082146 3300047321 Bacteria 2439
259 Ga0495676_0186038 3300047321 Bacteria 1452
260 Ga0495680_0000640 3300047322 Bacteria 39222
261 Ga0495683_0034087 3300047323 Bacteria 2589
262 Ga0495683_0048843 3300047323 Bacteria 2120
263 Ga0495687_017631 3300047443 Bacteria 3554
264 Ga0495675_0003306 3300047444 Bacteria 9693
265 Ga0495677_0011179 3300047445 Bacteria 3286
266 Ga0495679_000036 3300047446 Bacteria 161473
267 Ga0495673_0005195 3300047469 Bacteria 7922
268 Ga0495686_0006696 3300047472 Bacteria 8767
269 Ga0495593_0012854 3300047673 Bacteria 4782
270 Ga0495602_0028131 3300048088 Bacteria 5385
271 Ga0495614_0049840 3300048089 Bacteria 1795
272 Ga0495626_0023838 3300048091 Bacteria 3007
273 Ga0495626_0042998 3300048091 Bacteria 2121
274 Ga0496100_0000086 3300048903 Bacteria 53043
275 Ga0496101_0000044 3300048904 Bacteria 161295
276 Ga0496101_0000224 3300048904 Bacteria 42435
277 Ga0496102_0010285 3300048905 Bacteria 8044
278 Ga0496102_0241086 3300048905 Bacteria 1705
279 Ga0496103_0001893 3300048906 Bacteria 13609
280 Ga0496104_0321329 3300048907 Bacteria 1461
281 Ga0496105_0003748 3300048908 Bacteria 11325
282 Ga0496106_0078646 3300048909 Bacteria 2531
283 Ga0496107_0138143 3300048910 Bacteria 1801
284 Ga0496109_0434765 3300048912 Bacteria 1240
285 Ga0496109_0503906 3300048912 Bacteria 1143
286 Ga0496112_0056945 3300048915 Bacteria 3848
287 Ga0496113_0002020 3300048916 Bacteria 11646
288 Ga0496113_0537949 3300048916 Bacteria 937
289 Ga0496116_0003806 3300048919 Bacteria 14746
290 Ga0496116_0047388 3300048919 Bacteria 2893
291 Ga0496116_0047641 3300048919 Bacteria 2884
292 Ga0496116_0064446 3300048919 Bacteria 2355
293 Ga0496116_0093811 3300048919 Bacteria 1816
294 Ga0496117_0000098 3300048920 Bacteria 196331
295 Ga0496117_0002577 3300048920 Bacteria 22566
296 Ga0496117_0017448 3300048920 Bacteria 5993
297 Ga0496117_0026156 3300048920 Bacteria 4571
298 Ga0496117_0086948 3300048920 Bacteria 2028
299 Ga0496117_0114277 3300048920 Bacteria 1674
300 Ga0496118_0000728 3300048921 Bacteria 53140
301 Ga0496118_0007352 3300048921 Bacteria 11712
302 Ga0496118_0025602 3300048921 Bacteria 5051
303 Ga0496119_0105287 3300048922 Bacteria 1576
304 Ga0496119_0116542 3300048922 Bacteria 1474
305 Ga0496121_0000643 3300048924 Bacteria 65217
306 Ga0496121_0004299 3300048924 Bacteria 19303
307 Ga0496121_0013301 3300048924 Bacteria 8859
308 Ga0496121_0021173 3300048924 Bacteria 6385
309 Ga0496121_0023049 3300048924 Bacteria 6014
310 Ga0496121_0026019 3300048924 Bacteria 5532
311 Ga0496121_0131176 3300048924 Bacteria 1875
312 Ga0496122_0021785 3300048925 Bacteria 5720
313 Ga0496122_0095067 3300048925 Bacteria 2015
314 Ga0496122_0130652 3300048925 Bacteria 1596
315 Ga0496122_0131798 3300048925 Bacteria 1586
316 Ga0496123_0002639 3300048926 Bacteria 21715
317 Ga0496123_0041512 3300048926 Bacteria 3188
318 Ga0496123_0114290 3300048926 Bacteria 1535
319 Ga0496124_0459077 3300048927 Bacteria 866
320 Ga0496125_0001227 3300048928 Bacteria 38397
321 Ga0496125_0056455 3300048928 Bacteria 3188
322 Ga0496125_0074948 3300048928 Bacteria 2621
323 Ga0496125_0187036 3300048928 Bacteria 1372
324 Ga0496126_0027842 3300048929 Bacteria 5391
325 Ga0496126_0107852 3300048929 Bacteria 2429
326 Ga0496126_0218149 3300048929 Bacteria 1604
327 Ga0496126_0308227 3300048929 Bacteria 1304
328 Ga0496126_0564602 3300048929 Bacteria 901
329 Ga0495678_017335 3300049459 Bacteria 3267
330 Ga0495682_0011728 3300049460 Bacteria 3368
331 Ga0495682_0024899 3300049460 Bacteria 2228
332 Ga0501031_0256804 3300049568 Bacteria 1136
333 Ga0501032_0007033 3300049569 Bacteria 8252
334 Ga0501033_0010149 3300049570 Bacteria 7229
335 Ga0501034_0075155 3300049571 Bacteria 3386
336 Ga0501036_0004663 3300049572 Bacteria 11075
337 Ga0501036_0914929 3300049572 Bacteria 720
338 Ga0501037_0005193 3300049573 Bacteria 9470
339 Ga0501038_0010330 3300049574 Bacteria 8539
340 Ga0501038_0363660 3300049574 Bacteria 1125
341 Ga0501039_0068875 3300049575 Bacteria 2747
342 Ga0501042_0164376 3300049578 Bacteria 1601
343 Ga0501043_0010483 3300049579 Bacteria 7258
344 Ga0501046_0013654 3300049580 Bacteria 6869
345 Ga0501046_0334927 3300049580 Bacteria 1101
346 Ga0501047_0092567 3300049581 Bacteria 2901
347 Ga0501047_0152425 3300049581 Bacteria 2187
348 Ga0501048_0033786 3300049582 Bacteria 3693
349 Ga0501048_0220992 3300049582 Bacteria 1344
350 Ga0501067_0070124 3300049583 Bacteria 1941
351 Ga0501068_0049668 3300049584 Bacteria 2534
352 Ga0501069_0009548 3300049585 Bacteria 5122
353 Ga0501070_0019709 3300049586 Bacteria 5656
354 Ga0501071_0299975 3300049587 Bacteria 1218
355 Ga0501073_0011504 3300049589 Bacteria 6470
356 Ga0501074_0035277 3300049590 Bacteria 3623
357 Ga0501076_0196732 3300049592 Bacteria 1646
358 Ga0501077_0198064 3300049593 Bacteria 1276
359 Ga0501079_0426866 3300049741 Bacteria 1041
360 Ga0501080_0008356 3300049742 Bacteria 9373
361 Ga0501083_0001455 3300049744 Bacteria 16165
362 Ga0501083_0024844 3300049744 Bacteria 4150
363 Ga0501083_0035426 3300049744 Bacteria 3409
364 Ga0501262_000165 3300049759 Bacteria 8174
365 Ga0501035_0026098 3300049822 Bacteria 5350
366 Ga0501044_0024850 3300049823 Bacteria 6354
367 Ga0501044_0428882 3300049823 Bacteria 1231
368 nmdc:mga00v17_27032_c1 3300050491 Bacteria 3347
369 nmdc:mga00v17_42903_c1 3300050491 Bacteria 2722
370 nmdc:mga0yw44_353828_c1 3300050492 Bacteria 989
371 nmdc:mga0k408_6128_c1 3300050493 Bacteria 6411
372 nmdc:mga06z11_78451_c1 3300050494 Bacteria 1765
373 nmdc:mga05p37_285_c1 3300050507 Bacteria 52916
374 nmdc:mga09592_9564_c1 3300050508 Bacteria 7877
375 nmdc:mga06r32_118_c1 3300050510 Bacteria 56778
376 nmdc:mga06r32_254298_c1 3300050510 Bacteria 1744
377 nmdc:mga08y16_293295_c1 3300050511 Bacteria 1677
378 nmdc:mga08y16_303_c1 3300050511 Bacteria 44322
379 nmdc:mga0sz30_9739_c1 3300050516 Bacteria 3664
380 Ga0495601_0001131 3300053077 Bacteria 14620
381 Ga0500635_0036175 3300053080 Bacteria 1626
382 Ga0495595_0000142 3300053084 Bacteria 29571
383 Ga0495619_0003389 3300053085 Bacteria 10299
384 Ga0495619_0053191 3300053085 Bacteria 2677
385 Ga0500643_002411 3300053087 Bacteria 9688
386 Ga0500643_029605 3300053087 Bacteria 1683
387 Ga0500644_0023243 3300053088 Bacteria 1880
388 Ga0500644_0181436 3300053088 Bacteria 862
389 Ga0500651_0077910 3300053093 Bacteria 2056
390 Ga0500566_0154254 3300053094 Bacteria 1204
391 Ga0500556_0000003 3300053104 Bacteria 679379
392 Ga0500556_0011257 3300053104 Bacteria 2646
393 Ga0500562_041104 3300053108 Bacteria 1229
394 Ga0500592_003029 3300053116 Bacteria 2686
395 Ga0500594_0002223 3300053118 Bacteria 4203
396 Ga0500595_003700 3300053119 Bacteria 7055
397 Ga0500626_030117 3300053128 Bacteria 2449
398 Ga0500652_000921 3300053131 Bacteria 9694
399 Ga0500658_0000058 3300053134 Bacteria 55299
400 Ga0500559_0004819 3300053136 Bacteria 6305
401 Ga0500568_0001594 3300053139 Bacteria 14345
402 Ga0500568_0001943 3300053139 Bacteria 12668
403 Ga0500577_0169598 3300053142 Bacteria 933
404 Ga0500604_0000208 3300053151 Bacteria 16819
405 Ga0500616_0000114 3300053153 Bacteria 148574
406 Ga0500616_0027644 3300053153 Bacteria 3130
407 Ga0500616_0070155 3300053153 Bacteria 1790
408 Ga0500622_0005705 3300053156 Bacteria 7400
409 Ga0500627_0130911 3300053158 Bacteria 1133
410 Ga0500636_0052503 3300053177 Bacteria 2394
411 Ga0501084_0006355 3300054114 Bacteria 9707
412 Ga0501082_0022242 3300060353 Bacteria 5464
413 Ga0501082_0338226 3300060353 Bacteria 1312
414 Ga0466962_0229822 3300061719 Bacteria 909
415 2513862159 2513237137 Bacteria 9558895
416 2514047669 2513237166 Bacteria 10373764
417 2517895311 2517572143 Bacteria 9484767
418 2563061075 2562617112 Bacteria 10918404
419 2603857608 2602042107 Bacteria 6226103
420 2643754847 2643221547 Bacteria 4740017
421 2713476034 2711768613 Bacteria 11048459
422 2793069283 2791355197 Bacteria 8420563
423 2848863605 2848858292 Bacteria 7391279
424 2888378903 2888378607 Bacteria 9652610
425 2903750429 2903748898 Bacteria 9972761
426 2904698644 2904690495 Bacteria 9412302
427 2906403977 2906401398 Bacteria 6693206
428 2906663540 2906660503 Bacteria 8595048
429 2908745504 2908739725 Bacteria 8628932
430 2908761976 2908756301 Bacteria 8864324
431 2919076605 2919073203 Bacteria 6531949
432 2935613705 2935608549 Bacteria 8203142
433 2935643346 2935638405 Bacteria 10015038
434 2935713141 2935703347 Bacteria 10242284
435 2935832869 2935827899 Bacteria 10038562
436 2935873365 2935864058 Bacteria 9784707
437 2935879207 2935873716 Bacteria 9632195
438 2935996852 2935992306 Bacteria 9802711
439 3001890525 3001889506 Bacteria 2975194
440 3005477031 3005474847 Bacteria 9259049
441 8019578836 8019576017 Bacteria 10049540
442 8019596907 8019586578 Bacteria 10212056
443 8019604808 8019597564 Bacteria 10041141
444 8019613722 8019608314 Bacteria 10042931
445 8024490714 8024486573 Bacteria 6540512
446 8054009065 8054002106 Bacteria 7987183
447 Ga0315911_1000004
448 JGI24751J29686_10032029
449 JGI25160J50197_1000184
450 Ga0055526_1027115
451 Ga0065165_1001355
452 Ga0065715_10000497
453 Ga0070658_10305818
454 Ga0070658_10629910
455 Ga0070683_100583644
456 Ga0070690_100323744
457 Ga0068869_100100923
458 Ga0070680_100338414
459 Ga0070660_100192178
460 Ga0070689_100353547
461 Ga0070687_100010290
462 Ga0070687_100042854
463 Ga0070675_100748797
464 Ga0070673_100411385
465 Ga0070673_100672729
466 Ga0070703_10002141
467 Ga0070701_10010549
468 Ga0070700_100082103
469 Ga0070708_100004618
470 Ga0070678_100491308
471 Ga0070662_100176938
472 Ga0070681_10073034
473 Ga0068867_100059588
474 Ga0070706_100004294
475 Ga0070707_100088093
476 Ga0070698_100021194
477 Ga0070679_100106690
478 Ga0070684_100055449
479 Ga0070686_100043647
480 Ga0070695_100006755
481 Ga0070695_100218130
482 Ga0070696_100049527
483 Ga0068855_100737003
484 Ga0070664_100052295
485 Ga0070664_100109527
486 Ga0068857_100006321
487 Ga0068857_100038046
488 Ga0068854_100693887
489 Ga0068852_100422571
490 Ga0068864_100029756
491 Ga0068861_100164346
492 Ga0068863_100006766
493 Ga0068858_100397793
494 Ga0068858_100502023
495 Ga0068860_100094431
496 Ga0068862_100396123
497 Ga0081455_10000919
498 Ga0081455_10278914
499 Ga0081539_10014335
500 Ga0081539_10035583
501 Ga0070717_10257275
502 Ga0075363_100117106
503 Ga0075363_100222982
504 Ga0075364_10005042
505 Ga0075364_10005490
506 Ga0075432_10061487
507 Ga0070712_100009522
508 Ga0075362_10000810
509 Ga0075367_10026177
510 Ga0075367_10058592
511 Ga0075369_10064455
512 Ga0075369_10070025
513 Ga0097621_100000445
514 Ga0068871_100001310
515 Ga0075428_100000426
516 Ga0075431_100000059
517 Ga0075431_100318143
518 Ga0075429_100007528
519 Ga0105250_10062777
520 Ga0105240_10181444
521 Ga0111539_10002614
522 Ga0105245_10465815
523 Ga0105247_10008352
524 Ga0114129_10001483
525 Ga0105243_10048496
526 Ga0105243_10085525
527 Ga0105243_10134635
528 Ga0105241_10077007
529 Ga0105242_10095815
530 Ga0105248_10056291
531 Ga0105248_10896585
532 Ga0105238_10699783
533 Ga0157373_10195930
534 Ga0157370_10012366
535 Ga0157375_10146313
536 Ga0157375_10592043
537 Ga0157380_10042555
538 Ga0157380_10111236
539 Ga0157376_10126616
540 Ga0183362_10001
541 Ga0163161_10089107
542 Ga0213874_10018031
543 Ga0209233_1005652
544 Ga0209130_1012227
545 Ga0209675_1007782
546 Ga0209564_1009934
547 Ga0209050_1008405
548 Ga0207426_1000004
549 Ga0207655_1003880
550 Ga0207653_10000347
551 Ga0207692_10208072
552 Ga0207684_10060230
553 Ga0207707_10043643
554 Ga0207695_10200123
555 Ga0207693_10001023
556 Ga0207662_10015134
557 Ga0207662_10046606
558 Ga0207662_10087480
559 Ga0207657_10150193
560 Ga0207652_10062154
561 Ga0207646_10137140
562 Ga0207700_10531295
563 Ga0207664_10234250
564 Ga0207706_10017144
565 Ga0207709_10024152
566 Ga0207709_10541817
567 Ga0207670_10120153
568 Ga0207691_10407264
569 Ga0207711_10015828
570 Ga0207711_10477125
571 Ga0207689_10087541
572 Ga0207679_10057291
573 Ga0207679_10098746
574 Ga0207651_10707821
575 Ga0207640_10112480
576 Ga0207658_10396707
577 Ga0207703_10385764
578 Ga0207639_10279707
579 Ga0207708_10062030
580 Ga0207648_10063456
581 Ga0207648_10136318
582 Ga0207676_10062656
583 Ga0207674_10006766
584 Ga0207674_10221287
585 Ga0207674_10239807
586 Ga0207683_10606520
587 Ga0207428_10009343
588 Ga0207428_10096413
589 Ga0268265_10341159
590 Ga0265337_1002183
591 Ga0307517_10000035
592 Ga0307515_10092206
593 Ga0316181_1037493
594 Ga0265762_1003372
595 Ga0265332_10052084
596 Ga0265340_10015775
597 Ga0265342_10183260
598 Ga0307410_10559436
599 Ga0307407_10216783
600 Ga0307416_101143540
601 Ga0373929_0019800
602 Ga0373934_0023702
603 Ga0373932_0024236
604 Ga0373936_0057790
605 Ga0373941_0018218
606 Ga0373954_0007126
607 Ga0373955_0006860
608 Ga0373961_0040940
609 Ga0373924_0004152
610 Ga0373931_0004070
611 Ga0373931_0011184
612 Ga0373935_0023511
613 Ga0373927_0022365
614 Ga0373933_0002610
615 Ga0373933_0495012
616 Ga0373947_0019484
617 Ga0373937_0000403
618 Ga0373925_0099271
619 Ga0436365_1559602
620 Ga0436360_0985056
621 Ga0436363_0388188
622 Ga0436362_0480253
623 Ga0439435_0019353
624 Ga0466965_0039658
625 Ga0466966_0040659
626 Ga0466957_0069541
627 Ga0466959_0001589
628 Ga0466959_0404122
629 Ga0451576_0015893
630 Ga0495592_0017240
631 Ga0495603_0008270
632 Ga0495590_0002032
633 Ga0495590_0022188
634 Ga0495629_0000119
635 Ga0495629_0000687
636 Ga0495638_0000558
637 Ga0495638_0002784
638 Ga0495638_0013995
639 Ga0495638_0061936
640 Ga0495651_0000185
641 Ga0495653_0000105
642 Ga0495653_0000831
643 Ga0495650_0010109
644 Ga0495580_0025976
645 Ga0495582_0061341
646 Ga0495605_0003091
647 Ga0495605_0010868
648 Ga0495605_0077974
649 Ga0495607_0004389
650 Ga0495583_0012502
651 Ga0495583_0055061
652 Ga0495606_0033922
653 Ga0495606_0109565
654 Ga0495608_0000598
655 Ga0495610_0003810
656 Ga0495610_0005191
657 Ga0495616_0005685
658 Ga0495616_0008108
659 Ga0495616_0008326
660 Ga0495620_0008148
661 Ga0495620_0034480
662 Ga0495628_0012799
663 Ga0495628_0032327
664 Ga0495630_0002805
665 Ga0495630_0024003
666 Ga0495631_0003347
667 Ga0495637_0086374
668 Ga0495648_0037818
669 Ga0495648_0229186
670 Ga0495666_0024032
671 Ga0495652_0001337
672 Ga0495654_0004228
673 Ga0495654_0007875
674 Ga0495665_0022743
675 Ga0495640_0046814
676 Ga0495587_0003497
677 Ga0495609_0020394
678 Ga0495622_0007226
679 Ga0495667_0002126
680 Ga0495634_0001253
681 Ga0495611_0009097
682 Ga0495625_0013426
683 Ga0495625_0041326
684 Ga0495625_0362531
685 Ga0495588_0121771
686 Ga0495588_0203171
687 Ga0495657_0009967
688 Ga0495599_0001430
689 Ga0495623_0002363
690 Ga0495646_0001973
691 Ga0495646_0012891
692 Ga0495669_0031681
693 Ga0495613_0072504
694 Ga0495613_0143302
695 Ga0495624_0107517
696 Ga0495649_0098741
697 Ga0495589_0019487
698 Ga0495589_0020644
699 Ga0495600_0000663
700 Ga0495660_0126627
701 Ga0495604_0000478
702 Ga0495674_0005391
703 Ga0495674_0047204
704 Ga0495676_0082146
705 Ga0495676_0186038
706 Ga0495680_0000640
707 Ga0495683_0034087
708 Ga0495683_0048843
709 Ga0495687_017631
710 Ga0495675_0003306
711 Ga0495677_0011179
712 Ga0495679_000036
713 Ga0495673_0005195
714 Ga0495686_0006696
715 Ga0495593_0012854
716 Ga0495602_0028131
717 Ga0495614_0049840
718 Ga0495626_0023838
719 Ga0495626_0042998
720 Ga0496100_0000086
721 Ga0496101_0000044
722 Ga0496101_0000224
723 Ga0496102_0010285
724 Ga0496102_0241086
725 Ga0496103_0001893
726 Ga0496104_0321329
727 Ga0496105_0003748
728 Ga0496106_0078646
729 Ga0496107_0138143
730 Ga0496109_0434765
731 Ga0496109_0503906
732 Ga0496112_0056945
733 Ga0496113_0002020
734 Ga0496113_0537949
735 Ga0496116_0003806
736 Ga0496116_0047388
737 Ga0496116_0047641
738 Ga0496116_0064446
739 Ga0496116_0093811
740 Ga0496117_0000098
741 Ga0496117_0002577
742 Ga0496117_0017448
743 Ga0496117_0026156
744 Ga0496117_0086948
745 Ga0496117_0114277
746 Ga0496118_0000728
747 Ga0496118_0007352
748 Ga0496118_0025602
749 Ga0496119_0105287
750 Ga0496119_0116542
751 Ga0496121_0000643
752 Ga0496121_0004299
753 Ga0496121_0013301
754 Ga0496121_0021173
755 Ga0496121_0023049
756 Ga0496121_0026019
757 Ga0496121_0131176
758 Ga0496122_0021785
759 Ga0496122_0095067
760 Ga0496122_0130652
761 Ga0496122_0131798
762 Ga0496123_0002639
763 Ga0496123_0041512
764 Ga0496123_0114290
765 Ga0496124_0459077
766 Ga0496125_0001227
767 Ga0496125_0056455
768 Ga0496125_0074948
769 Ga0496125_0187036
770 Ga0496126_0027842
771 Ga0496126_0107852
772 Ga0496126_0218149
773 Ga0496126_0308227
774 Ga0496126_0564602
775 Ga0495678_017335
776 Ga0495682_0011728
777 Ga0495682_0024899
778 Ga0501031_0256804
779 Ga0501032_0007033
780 Ga0501033_0010149
781 Ga0501034_0075155
782 Ga0501036_0004663
783 Ga0501036_0914929
784 Ga0501037_0005193
785 Ga0501038_0010330
786 Ga0501038_0363660
787 Ga0501039_0068875
788 Ga0501042_0164376
789 Ga0501043_0010483
790 Ga0501046_0013654
791 Ga0501046_0334927
792 Ga0501047_0092567
793 Ga0501047_0152425
794 Ga0501048_0033786
795 Ga0501048_0220992
796 Ga0501067_0070124
797 Ga0501068_0049668
798 Ga0501069_0009548
799 Ga0501070_0019709
800 Ga0501071_0299975
801 Ga0501073_0011504
802 Ga0501074_0035277
803 Ga0501076_0196732
804 Ga0501077_0198064
805 Ga0501079_0426866
806 Ga0501080_0008356
807 Ga0501083_0001455
808 Ga0501083_0024844
809 Ga0501083_0035426
810 Ga0501262_000165
811 Ga0501035_0026098
812 Ga0501044_0024850
813 Ga0501044_0428882
814 nmdc:mga00v17_27032_c1
815 nmdc:mga00v17_42903_c1
816 nmdc:mga0yw44_353828_c1
817 nmdc:mga0k408_6128_c1
818 nmdc:mga06z11_78451_c1
819 nmdc:mga05p37_285_c1
820 nmdc:mga09592_9564_c1
821 nmdc:mga06r32_118_c1
822 nmdc:mga06r32_254298_c1
823 nmdc:mga08y16_293295_c1
824 nmdc:mga08y16_303_c1
825 nmdc:mga0sz30_9739_c1
826 Ga0495601_0001131
827 Ga0500635_0036175
828 Ga0495595_0000142
829 Ga0495619_0003389
830 Ga0495619_0053191
831 Ga0500643_002411
832 Ga0500643_029605
833 Ga0500644_0023243
834 Ga0500644_0181436
835 Ga0500651_0077910
836 Ga0500566_0154254
837 Ga0500556_0000003
838 Ga0500556_0011257
839 Ga0500562_041104
840 Ga0500592_003029
841 Ga0500594_0002223
842 Ga0500595_003700
843 Ga0500626_030117
844 Ga0500652_000921
845 Ga0500658_0000058
846 Ga0500559_0004819
847 Ga0500568_0001594
848 Ga0500568_0001943
849 Ga0500577_0169598
850 Ga0500604_0000208
851 Ga0500616_0000114
852 Ga0500616_0027644
853 Ga0500616_0070155
854 Ga0500622_0005705
855 Ga0500627_0130911
856 Ga0500636_0052503
857 Ga0501084_0006355
858 Ga0501082_0022242
859 Ga0501082_0338226
860 Ga0466962_0229822
861 2513862159
862 2514047669
863 2517895311
864 2563061075
865 2603857608
866 2643754847
867 2713476034
868 2793069283
869 2848863605
870 2888378903
871 2903750429
872 2904698644
873 2906403977
874 2906663540
875 2908745504
876 2908761976
877 2919076605
878 2935613705
879 2935643346
880 2935713141
881 2935832869
882 2935873365
883 2935879207
884 2935996852
885 3001890525
886 3005477031
887 8019578836
888 8019596907
889 8019604808
890 8019613722
891 8024490714
892 8054009065

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

174

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9681 2 231
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9559 2 231
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9518 2 221
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9337 2 221
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9337 2 221
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9874 1 229 3.40.50.300
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9664 1 229 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9599 1 230 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9528 2 231 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9524 2 216 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A854GVC9-F1-model_v4 deleted 0.9915 1 227
AF-A0A496QUQ5-F1-model_v4 ABC transporter ATP-binding protein 0.9879 2 231 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A6G6K803-F1-model_v4 ABC transporter ATP-binding protein 0.9869 1 229 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A1S1RJF5-F1-model_v4 ABC transporter ATP-binding protein 0.9865 2 229 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A238D136-F1-model_v4 Leucine/isoleucine/valine transporter subunit ATP-binding component of ABC superfamily 0.9863 1 228 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887

Map