F445707

General Info

Members Datasets Scaffolds Average Seq Length
446 222 892 396

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10018806|Ga0111539_100188063
Length 454
Sequence LSLSRSPWGHRIFLLTPIDLPIRAADYHSLMGWRLPVVVVTVWLMTVMPFAASPADDAAQSAAETSRELRLRALDLAYNLDHDQAIELLRRAIALTPDDPTPHRSLASVLWLNMLFRRGAVTVDHYMGTFTRSSVDLPKPPPEIDNEFRTHVNRAIELAEKKVAANPKDPQSHYDLGAAVGLQASYVATVEGKLLAGFRAARRCYDEHEKVLSLDPSRKDAGLVVGTYRYVVSTLSLPVRMVAYVAGFGGGRDRGIQMLRETAESDLDGRTPTAPRDARVETGNDVRADALFALILVYNRERQYDAALQALERLRRIYPRNRLLWLESGSTALRAGRGQQADELLSQGLAALAKDQRPRMPGEEALWHYKRGAARALQGRTDDATADLKFAVGADPQNWVNGRARVELGRLALKRGDRTSAANEAKQAETLCDRGNDPVCVQDARSVLRSSNGR

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
164 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
165 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
166 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
208 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.36
Nodule 0
Rhizoplane 5.61
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 16.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10018806 3300009094 Bacteria 8548
2 Ga0065712_10015510 3300005290 Unclassified 1695
3 Ga0065715_10123360 3300005293 Bacteria 2162
4 Ga0065715_10141974 3300005293 Unclassified 1840
5 Ga0070676_10042669 3300005328 Bacteria 2635
6 Ga0070683_100003314 3300005329 Bacteria 13030
7 Ga0070670_100005220 3300005331 Bacteria 10937
8 Ga0070670_100008400 3300005331 Bacteria 8803
9 Ga0070670_100015917 3300005331 Bacteria 6454
10 Ga0070670_100037563 3300005331 Bacteria 4167
11 Ga0070670_100292105 3300005331 Unclassified 1425
12 Ga0070677_10030157 3300005333 Unclassified 2063
13 Ga0068869_100001677 3300005334 Bacteria 13229
14 Ga0070666_10069730 3300005335 Bacteria 2391
15 Ga0070680_100215775 3300005336 Bacteria 1619
16 Ga0068868_100035997 3300005338 Bacteria 3829
17 Ga0070689_100107419 3300005340 Bacteria 2216
18 Ga0070692_10036727 3300005345 Bacteria 2487
19 Ga0070668_100093450 3300005347 Bacteria 2374
20 Ga0070668_100162944 3300005347 Bacteria 1810
21 Ga0070669_100013574 3300005353 Bacteria 5791
22 Ga0070669_100019713 3300005353 Bacteria 4818
23 Ga0070669_100040001 3300005353 Bacteria 3407
24 Ga0070669_100068426 3300005353 Bacteria 2621
25 Ga0070669_100211713 3300005353 Unclassified 1529
26 Ga0070675_100001537 3300005354 Bacteria 17074
27 Ga0070675_100053936 3300005354 Bacteria 3307
28 Ga0070675_100100903 3300005354 Bacteria 2431
29 Ga0070675_100115455 3300005354 Bacteria 2276
30 Ga0070671_100026851 3300005355 Bacteria 4736
31 Ga0070671_100077062 3300005355 Bacteria 2786
32 Ga0070674_100002406 3300005356 Bacteria 10334
33 Ga0070674_100043164 3300005356 Bacteria 3066
34 Ga0070674_100077377 3300005356 Unclassified 2368
35 Ga0070674_100123609 3300005356 Bacteria 1919
36 Ga0070674_100130253 3300005356 Bacteria 1874
37 Ga0070674_100162486 3300005356 Bacteria 1695
38 Ga0070673_100035172 3300005364 Bacteria 3796
39 Ga0070673_100233456 3300005364 Bacteria 1596
40 Ga0070673_100286790 3300005364 Unclassified 1446
41 Ga0070688_100120601 3300005365 Bacteria 1756
42 Ga0070659_100058026 3300005366 Bacteria 3053
43 Ga0070659_100077759 3300005366 Bacteria 2647
44 Ga0070667_100092540 3300005367 Bacteria 2602
45 Ga0070705_100030168 3300005440 Bacteria 2990
46 Ga0070700_100033216 3300005441 Bacteria 3106
47 Ga0070694_100159582 3300005444 Bacteria 1653
48 Ga0070663_100004732 3300005455 Bacteria 8027
49 Ga0070678_100087708 3300005456 Bacteria 2377
50 Ga0070662_100099557 3300005457 Unclassified 2197
51 Ga0070662_100172861 3300005457 Unclassified 1698
52 Ga0070681_10071580 3300005458 Bacteria 3432
53 Ga0068867_100025964 3300005459 Bacteria 4202
54 Ga0068867_100123820 3300005459 Bacteria 2001
55 Ga0070706_100252853 3300005467 Bacteria 1645
56 Ga0070706_100375129 3300005467 Unclassified 1325
57 Ga0070698_100026990 3300005471 Bacteria 5972
58 Ga0070698_100160156 3300005471 Bacteria 2195
59 Ga0070698_100238343 3300005471 Unclassified 1752
60 Ga0070699_100022149 3300005518 Bacteria 5475
61 Ga0070699_100108451 3300005518 Bacteria 2437
62 Ga0070679_100015797 3300005530 Bacteria 7262
63 Ga0070679_100144624 3300005530 Bacteria 2356
64 Ga0070684_100022577 3300005535 Bacteria 5251
65 Ga0070684_100122746 3300005535 Bacteria 2337
66 Ga0070684_100293160 3300005535 Bacteria 1492
67 Ga0070697_100170606 3300005536 Bacteria 1841
68 Ga0070672_100097158 3300005543 Bacteria 2384
69 Ga0070672_100166814 3300005543 Bacteria 1829
70 Ga0070686_100013045 3300005544 Bacteria 4744
71 Ga0070686_100094485 3300005544 Bacteria 2007
72 Ga0070695_100065663 3300005545 Unclassified 2363
73 Ga0070696_100072489 3300005546 Bacteria 2426
74 Ga0070693_100145822 3300005547 Bacteria 1495
75 Ga0070665_100008701 3300005548 Bacteria 10272
76 Ga0070665_100102575 3300005548 Bacteria 2864
77 Ga0070704_100090754 3300005549 Unclassified 2276
78 Ga0070664_100002868 3300005564 Bacteria 13961
79 Ga0070664_100131910 3300005564 Bacteria 2195
80 Ga0068857_100006340 3300005577 Bacteria 10130
81 Ga0068854_100023914 3300005578 Bacteria 4177
82 Ga0068854_100074849 3300005578 Bacteria 2485
83 Ga0068854_100087195 3300005578 Unclassified 2315
84 Ga0070702_100028816 3300005615 Bacteria 3012
85 Ga0070702_100075001 3300005615 Bacteria 2009
86 Ga0068852_100168601 3300005616 Unclassified 2050
87 Ga0068859_100256982 3300005617 Bacteria 1838
88 Ga0068864_100032268 3300005618 Bacteria 4449
89 Ga0068864_100121428 3300005618 Bacteria 2336
90 Ga0068866_10028327 3300005718 Unclassified 2668
91 Ga0068866_10101905 3300005718 Bacteria 1585
92 Ga0068861_100088384 3300005719 Bacteria 2440
93 Ga0068861_100099601 3300005719 Bacteria 2309
94 Ga0068861_100107506 3300005719 Bacteria 2230
95 Ga0068863_100038451 3300005841 Bacteria 4552
96 Ga0068863_100100191 3300005841 Bacteria 2753
97 Ga0068858_100046937 3300005842 Bacteria 4004
98 Ga0068858_100085978 3300005842 Bacteria 2926
99 Ga0068858_100156854 3300005842 Unclassified 2142
100 Ga0068858_100173744 3300005842 Bacteria 2033
101 Ga0068858_100218834 3300005842 Bacteria 1803
102 Ga0068860_100223491 3300005843 Bacteria 1829
103 Ga0068862_100021251 3300005844 Bacteria 5425
104 Ga0068862_100171786 3300005844 Unclassified 1941
105 Ga0068862_100342637 3300005844 Unclassified 1385
106 Ga0075365_10000537 3300006038 Bacteria 14580
107 Ga0075365_10018924 3300006038 Bacteria 4241
108 Ga0075368_10021321 3300006042 Bacteria 2460
109 Ga0075364_10003436 3300006051 Bacteria 9007
110 Ga0070716_100099428 3300006173 Bacteria 1780
111 Ga0075362_10001307 3300006177 Bacteria 7897
112 Ga0075366_10032854 3300006195 Bacteria 3055
113 Ga0097621_100034502 3300006237 Bacteria 4037
114 Ga0097621_100067716 3300006237 Bacteria 2943
115 Ga0075370_10012915 3300006353 Bacteria 4426
116 Ga0068871_100060038 3300006358 Bacteria 3100
117 Ga0075428_100000086 3300006844 Bacteria 77110
118 Ga0075428_100005069 3300006844 Bacteria 14649
119 Ga0075428_100021313 3300006844 Bacteria 7175
120 Ga0075428_100021570 3300006844 Bacteria 7132
121 Ga0075428_100021952 3300006844 Bacteria 7069
122 Ga0075430_100000028 3300006846 Bacteria 74712
123 Ga0075430_100066242 3300006846 Bacteria 3033
124 Ga0075430_100174717 3300006846 Bacteria 1787
125 Ga0075431_100020026 3300006847 Bacteria 6831
126 Ga0075431_100026699 3300006847 Bacteria 5923
127 Ga0075431_100058296 3300006847 Unclassified 3984
128 Ga0075431_100063982 3300006847 Bacteria 3797
129 Ga0075431_100093032 3300006847 Unclassified 3112
130 Ga0075431_100213100 3300006847 Bacteria 1972
131 Ga0075433_10158629 3300006852 Bacteria 2013
132 Ga0075434_100000523 3300006871 Bacteria 29248
133 Ga0075434_100020736 3300006871 Bacteria 6378
134 Ga0075434_100021223 3300006871 Bacteria 6312
135 Ga0075434_100065112 3300006871 Bacteria 3630
136 Ga0075434_100264070 3300006871 Bacteria 1741
137 Ga0075434_100320050 3300006871 Bacteria 1572
138 Ga0075434_100353665 3300006871 Bacteria 1490
139 Ga0075429_100000933 3300006880 Bacteria 23145
140 Ga0075429_100081686 3300006880 Bacteria 2818
141 Ga0068865_100081983 3300006881 Bacteria 2318
142 Ga0068865_100092461 3300006881 Bacteria 2198
143 Ga0075436_100001250 3300006914 Bacteria 17270
144 Ga0075436_100010393 3300006914 Bacteria 6379
145 Ga0075436_100079794 3300006914 Bacteria 2267
146 Ga0097620_100256997 3300006931 Bacteria 1838
147 Ga0075435_100001499 3300007076 Bacteria 14991
148 Ga0075435_100005464 3300007076 Bacteria 8877
149 Ga0075435_100014271 3300007076 Bacteria 5932
150 Ga0075435_100022377 3300007076 Bacteria 4877
151 Ga0075435_100220103 3300007076 Unclassified 1612
152 Ga0105240_10130315 3300009093 Bacteria 3017
153 Ga0111539_10000166 3300009094 Bacteria 76156
154 Ga0111539_10015963 3300009094 Bacteria 9329
155 Ga0111539_10021625 3300009094 Bacteria 7912
156 Ga0111539_10024488 3300009094 Bacteria 7403
157 Ga0111539_10370329 3300009094 Bacteria 1667
158 Ga0105245_10047193 3300009098 Bacteria 3849
159 Ga0105245_10084559 3300009098 Bacteria 2907
160 Ga0105247_10016350 3300009101 Bacteria 4445
161 Ga0105247_10083501 3300009101 Bacteria 2017
162 Ga0114129_10000148 3300009147 Bacteria 74039
163 Ga0114129_10002628 3300009147 Bacteria 25000
164 Ga0114129_10010061 3300009147 Bacteria 13483
165 Ga0114129_10026337 3300009147 Bacteria 8235
166 Ga0114129_10027809 3300009147 Bacteria 8008
167 Ga0114129_10032840 3300009147 Bacteria 7333
168 Ga0114129_10039778 3300009147 Bacteria 6632
169 Ga0114129_10045015 3300009147 Bacteria 6206
170 Ga0114129_10069628 3300009147 Bacteria 4904
171 Ga0114129_10144605 3300009147 Bacteria 3258
172 Ga0114129_10173668 3300009147 Unclassified 2936
173 Ga0114129_10184790 3300009147 Bacteria 2834
174 Ga0114129_10237218 3300009147 Bacteria 2453
175 Ga0105243_10025058 3300009148 Bacteria 4556
176 Ga0105241_10017088 3300009174 Bacteria 5328
177 Ga0105242_10061874 3300009176 Bacteria 3079
178 Ga0105242_10096569 3300009176 Bacteria 2497
179 Ga0105248_10013978 3300009177 Bacteria 8832
180 Ga0105248_10032706 3300009177 Bacteria 5809
181 Ga0105248_10051493 3300009177 Bacteria 4620
182 Ga0105248_10160361 3300009177 Unclassified 2537
183 Ga0105248_10171720 3300009177 Bacteria 2443
184 Ga0105238_10051643 3300009551 Bacteria 4135
185 Ga0105249_10006133 3300009553 Bacteria 10429
186 Ga0105249_10215108 3300009553 Bacteria 1888
187 Ga0105239_10156488 3300010375 Bacteria 2545
188 Ga0157378_10002676 3300013297 Bacteria 15871
189 Ga0163162_10062747 3300013306 Bacteria 3757
190 Ga0163162_10248362 3300013306 Bacteria 1911
191 Ga0163163_10004547 3300014325 Bacteria 11847
192 Ga0163163_10135939 3300014325 Bacteria 2500
193 Ga0157380_10087562 3300014326 Bacteria 2561
194 Ga0157380_10245777 3300014326 Bacteria 1616
195 Ga0157377_10032885 3300014745 Bacteria 2827
196 Ga0157379_10024992 3300014968 Bacteria 5303
197 Ga0157379_10241562 3300014968 Bacteria 1638
198 Ga0157376_10011150 3300014969 Bacteria 6613
199 Ga0207697_10000030 3300025315 Bacteria 51253
200 Ga0207682_10035511 3300025893 Bacteria 2014
201 Ga0207688_10000192 3300025901 Bacteria 27058
202 Ga0207680_10093449 3300025903 Unclassified 1919
203 Ga0207645_10039747 3300025907 Bacteria 3014
204 Ga0207645_10132046 3300025907 Bacteria 1625
205 Ga0207654_10113103 3300025911 Bacteria 1692
206 Ga0207707_10018864 3300025912 Bacteria 6016
207 Ga0207695_10092779 3300025913 Bacteria 3029
208 Ga0207660_10112176 3300025917 Bacteria 2053
209 Ga0207662_10006656 3300025918 Bacteria 6245
210 Ga0207652_10041513 3300025921 Bacteria 3911
211 Ga0207681_10009845 3300025923 Bacteria 5846
212 Ga0207681_10016372 3300025923 Bacteria 4638
213 Ga0207681_10070624 3300025923 Bacteria 2432
214 Ga0207681_10076170 3300025923 Unclassified 2355
215 Ga0207681_10083642 3300025923 Bacteria 2259
216 Ga0207650_10005995 3300025925 Bacteria 8293
217 Ga0207650_10014975 3300025925 Bacteria 5394
218 Ga0207650_10017758 3300025925 Unclassified 4983
219 Ga0207650_10079810 3300025925 Bacteria 2479
220 Ga0207650_10273403 3300025925 Unclassified 1373
221 Ga0207659_10001294 3300025926 Bacteria 14955
222 Ga0207659_10038280 3300025926 Bacteria 3335
223 Ga0207659_10063636 3300025926 Bacteria 2667
224 Ga0207687_10079568 3300025927 Bacteria 2363
225 Ga0207700_10290256 3300025928 Bacteria 1409
226 Ga0207644_10053991 3300025931 Bacteria 2893
227 Ga0207644_10143242 3300025931 Unclassified 1842
228 Ga0207690_10032751 3300025932 Bacteria 3337
229 Ga0207706_10031317 3300025933 Bacteria 4739
230 Ga0207706_10150220 3300025933 Unclassified 2049
231 Ga0207686_10037849 3300025934 Bacteria 2914
232 Ga0207709_10041132 3300025935 Bacteria 2772
233 Ga0207669_10002771 3300025937 Bacteria 7516
234 Ga0207704_10003262 3300025938 Bacteria 7360
235 Ga0207704_10097140 3300025938 Bacteria 1952
236 Ga0207665_10080186 3300025939 Bacteria 2245
237 Ga0207691_10006296 3300025940 Bacteria 11461
238 Ga0207691_10023688 3300025940 Bacteria 5780
239 Ga0207691_10046262 3300025940 Bacteria 3999
240 Ga0207691_10179875 3300025940 Bacteria 1848
241 Ga0207711_10038516 3300025941 Bacteria 4066
242 Ga0207711_10067637 3300025941 Bacteria 3093
243 Ga0207711_10074172 3300025941 Bacteria 2959
244 Ga0207711_10077611 3300025941 Unclassified 2895
245 Ga0207711_10091216 3300025941 Bacteria 2680
246 Ga0207711_10102608 3300025941 Bacteria 2532
247 Ga0207689_10024785 3300025942 Bacteria 5029
248 Ga0207689_10028977 3300025942 Bacteria 4628
249 Ga0207679_10018277 3300025945 Bacteria 4694
250 Ga0207679_10093022 3300025945 Bacteria 2337
251 Ga0207679_10259768 3300025945 Unclassified 1481
252 Ga0207712_10243890 3300025961 Bacteria 1449
253 Ga0207668_10255125 3300025972 Bacteria 1426
254 Ga0207640_10035557 3300025981 Bacteria 3119
255 Ga0207677_10065285 3300026023 Bacteria 2539
256 Ga0207703_10024778 3300026035 Bacteria 4721
257 Ga0207703_10085911 3300026035 Bacteria 2634
258 Ga0207703_10148179 3300026035 Unclassified 2043
259 Ga0207678_10010470 3300026067 Bacteria 8145
260 Ga0207708_10017752 3300026075 Bacteria 5357
261 Ga0207708_10077215 3300026075 Bacteria 2556
262 Ga0207641_10103417 3300026088 Bacteria 2513
263 Ga0207648_10006288 3300026089 Bacteria 11819
264 Ga0207648_10117810 3300026089 Unclassified 2334
265 Ga0207676_10049994 3300026095 Unclassified 3257
266 Ga0207676_10148954 3300026095 Bacteria 2013
267 Ga0207674_10008381 3300026116 Bacteria 11954
268 Ga0207675_100018063 3300026118 Bacteria 6577
269 Ga0207675_100065242 3300026118 Bacteria 3403
270 Ga0207675_100068009 3300026118 Bacteria 3330
271 Ga0207675_100113018 3300026118 Bacteria 2564
272 Ga0207675_100156182 3300026118 Bacteria 2174
273 Ga0207683_10108693 3300026121 Bacteria 2482
274 Ga0207683_10124036 3300026121 Bacteria 2320
275 Ga0207698_10034801 3300026142 Unclassified 3677
276 Ga0207698_10129802 3300026142 Unclassified 2151
277 Ga0209971_1024914 3300027682 Bacteria 1429
278 Ga0207428_10000251 3300027907 Bacteria 73186
279 Ga0207428_10026176 3300027907 Unclassified 4871
280 Ga0207428_10033792 3300027907 Bacteria 4195
281 Ga0207428_10037988 3300027907 Bacteria 3917
282 Ga0268266_10006329 3300028379 Bacteria 10851
283 Ga0268266_10076954 3300028379 Bacteria 2900
284 Ga0268265_10044643 3300028380 Bacteria 3301
285 Ga0268265_10154187 3300028380 Bacteria 1941
286 Ga0268265_10270852 3300028380 Unclassified 1514
287 Ga0268264_10109182 3300028381 Bacteria 2420
288 Ga0307408_100008192 3300031548 Bacteria 6904
289 Ga0307408_100027898 3300031548 Bacteria 3895
290 Ga0307408_100089137 3300031548 Bacteria 2325
291 Ga0307408_100103209 3300031548 Unclassified 2176
292 Ga0307408_100234293 3300031548 Unclassified 1505
293 Ga0307405_10031285 3300031731 Unclassified 3131
294 Ga0307413_10104624 3300031824 Unclassified 1880
295 Ga0307409_100068500 3300031995 Unclassified 2807
296 Ga0307409_100296015 3300031995 Bacteria 1503
297 Ga0307416_100044689 3300032002 Unclassified 3480
298 Ga0307416_100143152 3300032002 Bacteria 2177
299 Ga0307416_100231171 3300032002 Bacteria 1783
300 Ga0307414_10209171 3300032004 Bacteria 1593
301 Ga0307411_10026347 3300032005 Bacteria 3500
302 Ga0307411_10130146 3300032005 Bacteria 1838
303 Ga0307411_10149875 3300032005 Unclassified 1732
304 Ga0307415_100022106 3300032126 Unclassified 3921
305 Ga0373950_0003138 3300034818 Bacteria 2336
306 Ga0373959_0006769 3300034820 Bacteria 1912
307 Ga0373938_0002512 3300034957 Bacteria 2962
308 Ga0373929_0000270 3300035085 Bacteria 9587
309 Ga0373940_0002055 3300035088 Bacteria 3821
310 Ga0373949_0000697 3300035090 Bacteria 10925
311 Ga0373939_0000518 3300035114 Bacteria 9713
312 Ga0373939_0037972 3300035114 Bacteria 1434
313 Ga0373942_0003583 3300035207 Bacteria 3641
314 Ga0373931_0004272 3300035691 Bacteria 6506
315 Ga0373931_0033196 3300035691 Bacteria 2674
316 Ga0373931_0065789 3300035691 Unclassified 1965
317 Ga0373931_0204648 3300035691 Unclassified 1181
318 Ga0373937_0035574 3300036401 Bacteria 4534
319 Ga0373937_0104939 3300036401 Bacteria 2625
320 Ga0373925_0002251 3300037068 Bacteria 15632
321 Ga0395905_0290794 3300037471 Bacteria 1521
322 Ga0395901_0337216 3300038443 Bacteria 1558
323 Ga0439439_0019796 3300041406 Bacteria 1672
324 Ga0439461_0030196 3300041410 Bacteria 1125
325 Ga0450894_001691 3300042131 Bacteria 3112
326 Ga0450896_004542 3300042133 Bacteria 1881
327 Ga0439446_0015371 3300042156 Bacteria 2122
328 Ga0439446_0017027 3300042156 Bacteria 2029
329 Ga0439464_0004067 3300042439 Unclassified 3720
330 Ga0453684_0132084 3300044712 Bacteria 2995
331 Ga0451576_0094181 3300045051 Bacteria 3114
332 Ga0451576_0220574 3300045051 Bacteria 1980
333 Ga0495629_0188715 3300046459 Unclassified 1427
334 Ga0495586_0087546 3300046535 Unclassified 1717
335 Ga0495645_0006058 3300046543 Bacteria 8362
336 Ga0495659_0003408 3300046664 Bacteria 5083
337 Ga0495658_0109852 3300046683 Bacteria 1657
338 Ga0495669_0010436 3300046684 Bacteria 3926
339 Ga0495649_0124340 3300046694 Bacteria 1363
340 Ga0495674_0095875 3300047319 Bacteria 2529
341 Ga0496101_0128834 3300048904 Bacteria 1920
342 Ga0496101_0145070 3300048904 Bacteria 1812
343 Ga0496102_0040560 3300048905 Bacteria 4211
344 Ga0496102_0192638 3300048905 Bacteria 1921
345 Ga0496104_0004713 3300048907 Bacteria 11870
346 Ga0496104_0098165 3300048907 Bacteria 2804
347 Ga0496104_0311511 3300048907 Bacteria 1487
348 Ga0496108_0020047 3300048911 Bacteria 5495
349 Ga0496108_0063495 3300048911 Bacteria 3110
350 Ga0496109_0130383 3300048912 Bacteria 2346
351 Ga0496109_0173884 3300048912 Bacteria 2021
352 Ga0496109_0236535 3300048912 Bacteria 1718
353 Ga0496109_0277605 3300048912 Bacteria 1579
354 Ga0496110_0031203 3300048913 Unclassified 4597
355 Ga0496110_0433232 3300048913 Bacteria 1198
356 Ga0496111_0000987 3300048914 Bacteria 15586
357 Ga0496112_0004128 3300048915 Bacteria 12218
358 Ga0496112_0009087 3300048915 Bacteria 8929
359 Ga0496112_0116857 3300048915 Unclassified 2637
360 Ga0496112_0151062 3300048915 Bacteria 2290
361 Ga0496113_0096295 3300048916 Bacteria 2288
362 Ga0496114_0044965 3300048917 Bacteria 3666
363 Ga0496114_0069201 3300048917 Bacteria 2964
364 Ga0496114_0214872 3300048917 Bacteria 1687
365 Ga0496115_0031613 3300048918 Bacteria 4171
366 Ga0501034_0025562 3300049571 Bacteria 6012
367 Ga0501034_0034655 3300049571 Bacteria 5119
368 Ga0501036_0125863 3300049572 Unclassified 2164
369 Ga0501036_0247601 3300049572 Unclassified 1494
370 Ga0501040_0010913 3300049576 Bacteria 5941
371 Ga0501047_0116467 3300049581 Bacteria 2554
372 Ga0501071_0020559 3300049587 Bacteria 4588
373 Ga0501072_0060945 3300049588 Unclassified 2975
374 Ga0501074_0015558 3300049590 Bacteria 5530
375 Ga0501074_0074700 3300049590 Bacteria 2434
376 Ga0501075_0032450 3300049591 Bacteria 3880
377 Ga0501075_0032721 3300049591 Bacteria 3865
378 Ga0501076_0036997 3300049592 Unclassified 3826
379 Ga0501076_0105931 3300049592 Unclassified 2269
380 Ga0501077_0040724 3300049593 Unclassified 2959
381 Ga0501079_0028855 3300049741 Bacteria 4259
382 Ga0501079_0046189 3300049741 Unclassified 3360
383 Ga0501079_0179100 3300049741 Bacteria 1654
384 Ga0501045_0023933 3300049824 Unclassified 4384
385 Ga0501045_0030076 3300049824 Bacteria 3929
386 Ga0501045_0096258 3300049824 Bacteria 2190
387 nmdc:mga03n38_64898_c1 3300050490 Unclassified 1672
388 nmdc:mga00v17_1869_c1 3300050491 Bacteria 10893
389 nmdc:mga00v17_3795_c1 3300050491 Bacteria 7796
390 nmdc:mga0yw44_11244_c1 3300050492 Bacteria 4610
391 nmdc:mga0yw44_14870_c1 3300050492 Unclassified 4149
392 nmdc:mga0k408_97821_c1 3300050493 Unclassified 1729
393 nmdc:mga06z11_27635_c1 3300050494 Bacteria 2713
394 nmdc:mga04h51_7730_c1 3300050495 Bacteria 2849
395 nmdc:mga05p37_11606_c1 3300050507 Bacteria 10499
396 nmdc:mga05p37_163323_c1 3300050507 Unclassified 2719
397 nmdc:mga05p37_16703_c1 3300050507 Bacteria 8845
398 nmdc:mga05p37_1902_c1 3300050507 Bacteria 24340
399 nmdc:mga05p37_210305_c1 3300050507 Bacteria 2352
400 nmdc:mga05p37_214882_c1 3300050507 Bacteria 2323
401 nmdc:mga05p37_315689_c1 3300050507 Bacteria 1851
402 nmdc:mga05p37_31767_c1 3300050507 Bacteria 6452
403 nmdc:mga05p37_325347_c1 3300050507 Bacteria 1818
404 nmdc:mga05p37_57255_c1 3300050507 Bacteria 4801
405 nmdc:mga05p37_577481_c1 3300050507 Bacteria 1274
406 nmdc:mga05p37_58196_c1 3300050507 Bacteria 4760
407 nmdc:mga05p37_70669_c1 3300050507 Bacteria 4294
408 nmdc:mga09592_2657_c1 3300050508 Bacteria 14462
409 nmdc:mga09592_34560_c1 3300050508 Bacteria 4225
410 nmdc:mga0qj67_45769_c1 3300050509 Bacteria 3452
411 nmdc:mga0qj67_57990_c1 3300050509 Bacteria 3070
412 nmdc:mga06r32_13495_c1 3300050510 Bacteria 7404
413 nmdc:mga06r32_22247_c1 3300050510 Bacteria 5859
414 nmdc:mga06r32_26165_c1 3300050510 Bacteria 5436
415 nmdc:mga06r32_323934_c1 3300050510 Bacteria 1526
416 nmdc:mga06r32_366158_c1 3300050510 Unclassified 1425
417 nmdc:mga06r32_50555_c1 3300050510 Bacteria 3976
418 nmdc:mga08y16_1853_c1 3300050511 Bacteria 21480
419 nmdc:mga08y16_225977_c1 3300050511 Unclassified 1937
420 nmdc:mga08y16_50399_c1 3300050511 Unclassified 4357
421 nmdc:mga08y16_60548_c1 3300050511 Bacteria 3954
422 nmdc:mga08y16_7157_c1 3300050511 Bacteria 11711
423 nmdc:mga08y16_96066_c1 3300050511 Bacteria 3086
424 nmdc:mga0n895_133774_c1 3300050512 Bacteria 2505
425 nmdc:mga0n895_1504_c1 3300050512 Bacteria 17485
426 nmdc:mga0n895_766_c1 3300050512 Bacteria 22816
427 nmdc:mga0n895_94535_c1 3300050512 Bacteria 2993
428 nmdc:mga0rr50_109_c1 3300050513 Bacteria 46163
429 nmdc:mga0rr50_18146_c1 3300050513 Bacteria 4719
430 nmdc:mga0rr50_42295_c1 3300050513 Bacteria 3327
431 nmdc:mga08x19_150887_c1 3300050514 Bacteria 1574
432 nmdc:mga0a205_12032_c1 3300050515 Bacteria 7992
433 nmdc:mga0a205_24279_c1 3300050515 Bacteria 5762
434 nmdc:mga0a205_244861_c1 3300050515 Bacteria 1673
435 nmdc:mga0a205_2484_c1 3300050515 Bacteria 16260
436 nmdc:mga0a205_6915_c1 3300050515 Bacteria 10256
437 Ga0495601_0083710 3300053077 Unclassified 2049
438 Ga0495619_0011118 3300053085 Bacteria 5662
439 Ga0495619_0026793 3300053085 Bacteria 3711
440 Ga0590071_000434 3300059421 Bacteria 12127
441 Ga0590071_005357 3300059421 Bacteria 3087
442 Ga0590074_004462 3300059423 Unclassified 2313
443 Ga0590075_002156 3300059424 Unclassified 4732
444 Ga0590077_000352 3300059426 Bacteria 13005
445 Ga0501082_0093161 3300060353 Bacteria 2603
446 Ga0501082_0282177 3300060353 Unclassified 1446
447 Ga0111539_10018806
448 Ga0065712_10015510
449 Ga0065715_10123360
450 Ga0065715_10141974
451 Ga0070676_10042669
452 Ga0070683_100003314
453 Ga0070670_100005220
454 Ga0070670_100008400
455 Ga0070670_100015917
456 Ga0070670_100037563
457 Ga0070670_100292105
458 Ga0070677_10030157
459 Ga0068869_100001677
460 Ga0070666_10069730
461 Ga0070680_100215775
462 Ga0068868_100035997
463 Ga0070689_100107419
464 Ga0070692_10036727
465 Ga0070668_100093450
466 Ga0070668_100162944
467 Ga0070669_100013574
468 Ga0070669_100019713
469 Ga0070669_100040001
470 Ga0070669_100068426
471 Ga0070669_100211713
472 Ga0070675_100001537
473 Ga0070675_100053936
474 Ga0070675_100100903
475 Ga0070675_100115455
476 Ga0070671_100026851
477 Ga0070671_100077062
478 Ga0070674_100002406
479 Ga0070674_100043164
480 Ga0070674_100077377
481 Ga0070674_100123609
482 Ga0070674_100130253
483 Ga0070674_100162486
484 Ga0070673_100035172
485 Ga0070673_100233456
486 Ga0070673_100286790
487 Ga0070688_100120601
488 Ga0070659_100058026
489 Ga0070659_100077759
490 Ga0070667_100092540
491 Ga0070705_100030168
492 Ga0070700_100033216
493 Ga0070694_100159582
494 Ga0070663_100004732
495 Ga0070678_100087708
496 Ga0070662_100099557
497 Ga0070662_100172861
498 Ga0070681_10071580
499 Ga0068867_100025964
500 Ga0068867_100123820
501 Ga0070706_100252853
502 Ga0070706_100375129
503 Ga0070698_100026990
504 Ga0070698_100160156
505 Ga0070698_100238343
506 Ga0070699_100022149
507 Ga0070699_100108451
508 Ga0070679_100015797
509 Ga0070679_100144624
510 Ga0070684_100022577
511 Ga0070684_100122746
512 Ga0070684_100293160
513 Ga0070697_100170606
514 Ga0070672_100097158
515 Ga0070672_100166814
516 Ga0070686_100013045
517 Ga0070686_100094485
518 Ga0070695_100065663
519 Ga0070696_100072489
520 Ga0070693_100145822
521 Ga0070665_100008701
522 Ga0070665_100102575
523 Ga0070704_100090754
524 Ga0070664_100002868
525 Ga0070664_100131910
526 Ga0068857_100006340
527 Ga0068854_100023914
528 Ga0068854_100074849
529 Ga0068854_100087195
530 Ga0070702_100028816
531 Ga0070702_100075001
532 Ga0068852_100168601
533 Ga0068859_100256982
534 Ga0068864_100032268
535 Ga0068864_100121428
536 Ga0068866_10028327
537 Ga0068866_10101905
538 Ga0068861_100088384
539 Ga0068861_100099601
540 Ga0068861_100107506
541 Ga0068863_100038451
542 Ga0068863_100100191
543 Ga0068858_100046937
544 Ga0068858_100085978
545 Ga0068858_100156854
546 Ga0068858_100173744
547 Ga0068858_100218834
548 Ga0068860_100223491
549 Ga0068862_100021251
550 Ga0068862_100171786
551 Ga0068862_100342637
552 Ga0075365_10000537
553 Ga0075365_10018924
554 Ga0075368_10021321
555 Ga0075364_10003436
556 Ga0070716_100099428
557 Ga0075362_10001307
558 Ga0075366_10032854
559 Ga0097621_100034502
560 Ga0097621_100067716
561 Ga0075370_10012915
562 Ga0068871_100060038
563 Ga0075428_100000086
564 Ga0075428_100005069
565 Ga0075428_100021313
566 Ga0075428_100021570
567 Ga0075428_100021952
568 Ga0075430_100000028
569 Ga0075430_100066242
570 Ga0075430_100174717
571 Ga0075431_100020026
572 Ga0075431_100026699
573 Ga0075431_100058296
574 Ga0075431_100063982
575 Ga0075431_100093032
576 Ga0075431_100213100
577 Ga0075433_10158629
578 Ga0075434_100000523
579 Ga0075434_100020736
580 Ga0075434_100021223
581 Ga0075434_100065112
582 Ga0075434_100264070
583 Ga0075434_100320050
584 Ga0075434_100353665
585 Ga0075429_100000933
586 Ga0075429_100081686
587 Ga0068865_100081983
588 Ga0068865_100092461
589 Ga0075436_100001250
590 Ga0075436_100010393
591 Ga0075436_100079794
592 Ga0097620_100256997
593 Ga0075435_100001499
594 Ga0075435_100005464
595 Ga0075435_100014271
596 Ga0075435_100022377
597 Ga0075435_100220103
598 Ga0105240_10130315
599 Ga0111539_10000166
600 Ga0111539_10015963
601 Ga0111539_10021625
602 Ga0111539_10024488
603 Ga0111539_10370329
604 Ga0105245_10047193
605 Ga0105245_10084559
606 Ga0105247_10016350
607 Ga0105247_10083501
608 Ga0114129_10000148
609 Ga0114129_10002628
610 Ga0114129_10010061
611 Ga0114129_10026337
612 Ga0114129_10027809
613 Ga0114129_10032840
614 Ga0114129_10039778
615 Ga0114129_10045015
616 Ga0114129_10069628
617 Ga0114129_10144605
618 Ga0114129_10173668
619 Ga0114129_10184790
620 Ga0114129_10237218
621 Ga0105243_10025058
622 Ga0105241_10017088
623 Ga0105242_10061874
624 Ga0105242_10096569
625 Ga0105248_10013978
626 Ga0105248_10032706
627 Ga0105248_10051493
628 Ga0105248_10160361
629 Ga0105248_10171720
630 Ga0105238_10051643
631 Ga0105249_10006133
632 Ga0105249_10215108
633 Ga0105239_10156488
634 Ga0157378_10002676
635 Ga0163162_10062747
636 Ga0163162_10248362
637 Ga0163163_10004547
638 Ga0163163_10135939
639 Ga0157380_10087562
640 Ga0157380_10245777
641 Ga0157377_10032885
642 Ga0157379_10024992
643 Ga0157379_10241562
644 Ga0157376_10011150
645 Ga0207697_10000030
646 Ga0207682_10035511
647 Ga0207688_10000192
648 Ga0207680_10093449
649 Ga0207645_10039747
650 Ga0207645_10132046
651 Ga0207654_10113103
652 Ga0207707_10018864
653 Ga0207695_10092779
654 Ga0207660_10112176
655 Ga0207662_10006656
656 Ga0207652_10041513
657 Ga0207681_10009845
658 Ga0207681_10016372
659 Ga0207681_10070624
660 Ga0207681_10076170
661 Ga0207681_10083642
662 Ga0207650_10005995
663 Ga0207650_10014975
664 Ga0207650_10017758
665 Ga0207650_10079810
666 Ga0207650_10273403
667 Ga0207659_10001294
668 Ga0207659_10038280
669 Ga0207659_10063636
670 Ga0207687_10079568
671 Ga0207700_10290256
672 Ga0207644_10053991
673 Ga0207644_10143242
674 Ga0207690_10032751
675 Ga0207706_10031317
676 Ga0207706_10150220
677 Ga0207686_10037849
678 Ga0207709_10041132
679 Ga0207669_10002771
680 Ga0207704_10003262
681 Ga0207704_10097140
682 Ga0207665_10080186
683 Ga0207691_10006296
684 Ga0207691_10023688
685 Ga0207691_10046262
686 Ga0207691_10179875
687 Ga0207711_10038516
688 Ga0207711_10067637
689 Ga0207711_10074172
690 Ga0207711_10077611
691 Ga0207711_10091216
692 Ga0207711_10102608
693 Ga0207689_10024785
694 Ga0207689_10028977
695 Ga0207679_10018277
696 Ga0207679_10093022
697 Ga0207679_10259768
698 Ga0207712_10243890
699 Ga0207668_10255125
700 Ga0207640_10035557
701 Ga0207677_10065285
702 Ga0207703_10024778
703 Ga0207703_10085911
704 Ga0207703_10148179
705 Ga0207678_10010470
706 Ga0207708_10017752
707 Ga0207708_10077215
708 Ga0207641_10103417
709 Ga0207648_10006288
710 Ga0207648_10117810
711 Ga0207676_10049994
712 Ga0207676_10148954
713 Ga0207674_10008381
714 Ga0207675_100018063
715 Ga0207675_100065242
716 Ga0207675_100068009
717 Ga0207675_100113018
718 Ga0207675_100156182
719 Ga0207683_10108693
720 Ga0207683_10124036
721 Ga0207698_10034801
722 Ga0207698_10129802
723 Ga0209971_1024914
724 Ga0207428_10000251
725 Ga0207428_10026176
726 Ga0207428_10033792
727 Ga0207428_10037988
728 Ga0268266_10006329
729 Ga0268266_10076954
730 Ga0268265_10044643
731 Ga0268265_10154187
732 Ga0268265_10270852
733 Ga0268264_10109182
734 Ga0307408_100008192
735 Ga0307408_100027898
736 Ga0307408_100089137
737 Ga0307408_100103209
738 Ga0307408_100234293
739 Ga0307405_10031285
740 Ga0307413_10104624
741 Ga0307409_100068500
742 Ga0307409_100296015
743 Ga0307416_100044689
744 Ga0307416_100143152
745 Ga0307416_100231171
746 Ga0307414_10209171
747 Ga0307411_10026347
748 Ga0307411_10130146
749 Ga0307411_10149875
750 Ga0307415_100022106
751 Ga0373950_0003138
752 Ga0373959_0006769
753 Ga0373938_0002512
754 Ga0373929_0000270
755 Ga0373940_0002055
756 Ga0373949_0000697
757 Ga0373939_0000518
758 Ga0373939_0037972
759 Ga0373942_0003583
760 Ga0373931_0004272
761 Ga0373931_0033196
762 Ga0373931_0065789
763 Ga0373931_0204648
764 Ga0373937_0035574
765 Ga0373937_0104939
766 Ga0373925_0002251
767 Ga0395905_0290794
768 Ga0395901_0337216
769 Ga0439439_0019796
770 Ga0439461_0030196
771 Ga0450894_001691
772 Ga0450896_004542
773 Ga0439446_0015371
774 Ga0439446_0017027
775 Ga0439464_0004067
776 Ga0453684_0132084
777 Ga0451576_0094181
778 Ga0451576_0220574
779 Ga0495629_0188715
780 Ga0495586_0087546
781 Ga0495645_0006058
782 Ga0495659_0003408
783 Ga0495658_0109852
784 Ga0495669_0010436
785 Ga0495649_0124340
786 Ga0495674_0095875
787 Ga0496101_0128834
788 Ga0496101_0145070
789 Ga0496102_0040560
790 Ga0496102_0192638
791 Ga0496104_0004713
792 Ga0496104_0098165
793 Ga0496104_0311511
794 Ga0496108_0020047
795 Ga0496108_0063495
796 Ga0496109_0130383
797 Ga0496109_0173884
798 Ga0496109_0236535
799 Ga0496109_0277605
800 Ga0496110_0031203
801 Ga0496110_0433232
802 Ga0496111_0000987
803 Ga0496112_0004128
804 Ga0496112_0009087
805 Ga0496112_0116857
806 Ga0496112_0151062
807 Ga0496113_0096295
808 Ga0496114_0044965
809 Ga0496114_0069201
810 Ga0496114_0214872
811 Ga0496115_0031613
812 Ga0501034_0025562
813 Ga0501034_0034655
814 Ga0501036_0125863
815 Ga0501036_0247601
816 Ga0501040_0010913
817 Ga0501047_0116467
818 Ga0501071_0020559
819 Ga0501072_0060945
820 Ga0501074_0015558
821 Ga0501074_0074700
822 Ga0501075_0032450
823 Ga0501075_0032721
824 Ga0501076_0036997
825 Ga0501076_0105931
826 Ga0501077_0040724
827 Ga0501079_0028855
828 Ga0501079_0046189
829 Ga0501079_0179100
830 Ga0501045_0023933
831 Ga0501045_0030076
832 Ga0501045_0096258
833 nmdc:mga03n38_64898_c1
834 nmdc:mga00v17_1869_c1
835 nmdc:mga00v17_3795_c1
836 nmdc:mga0yw44_11244_c1
837 nmdc:mga0yw44_14870_c1
838 nmdc:mga0k408_97821_c1
839 nmdc:mga06z11_27635_c1
840 nmdc:mga04h51_7730_c1
841 nmdc:mga05p37_11606_c1
842 nmdc:mga05p37_163323_c1
843 nmdc:mga05p37_16703_c1
844 nmdc:mga05p37_1902_c1
845 nmdc:mga05p37_210305_c1
846 nmdc:mga05p37_214882_c1
847 nmdc:mga05p37_315689_c1
848 nmdc:mga05p37_31767_c1
849 nmdc:mga05p37_325347_c1
850 nmdc:mga05p37_57255_c1
851 nmdc:mga05p37_577481_c1
852 nmdc:mga05p37_58196_c1
853 nmdc:mga05p37_70669_c1
854 nmdc:mga09592_2657_c1
855 nmdc:mga09592_34560_c1
856 nmdc:mga0qj67_45769_c1
857 nmdc:mga0qj67_57990_c1
858 nmdc:mga06r32_13495_c1
859 nmdc:mga06r32_22247_c1
860 nmdc:mga06r32_26165_c1
861 nmdc:mga06r32_323934_c1
862 nmdc:mga06r32_366158_c1
863 nmdc:mga06r32_50555_c1
864 nmdc:mga08y16_1853_c1
865 nmdc:mga08y16_225977_c1
866 nmdc:mga08y16_50399_c1
867 nmdc:mga08y16_60548_c1
868 nmdc:mga08y16_7157_c1
869 nmdc:mga08y16_96066_c1
870 nmdc:mga0n895_133774_c1
871 nmdc:mga0n895_1504_c1
872 nmdc:mga0n895_766_c1
873 nmdc:mga0n895_94535_c1
874 nmdc:mga0rr50_109_c1
875 nmdc:mga0rr50_18146_c1
876 nmdc:mga0rr50_42295_c1
877 nmdc:mga08x19_150887_c1
878 nmdc:mga0a205_12032_c1
879 nmdc:mga0a205_24279_c1
880 nmdc:mga0a205_244861_c1
881 nmdc:mga0a205_2484_c1
882 nmdc:mga0a205_6915_c1
883 Ga0495601_0083710
884 Ga0495619_0011118
885 Ga0495619_0026793
886 Ga0590071_000434
887 Ga0590071_005357
888 Ga0590074_004462
889 Ga0590075_002156
890 Ga0590077_000352
891 Ga0501082_0093161
892 Ga0501082_0282177

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fdt-assembly1.cif.gz_A nmr structure of the second tpr domain of the human rpap3 protein in complex with hsp70 peptide sgptieevd 0.8927 228 329
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.8806 17 67
6w5q-assembly8.cif.gz_H structure of the globular c-terminal domain of p. aeruginosa lpop 0.8574 220 330
8arc-assembly2.cif.gz_C heterologous complex of aeromonas hydrophila type iii secretion substrate ascx with photorhabdus luminescens subsp. laumondii lscy 0.8501 221 329
6w5q-assembly8.cif.gz_H structure of the globular c-terminal domain of p. aeruginosa lpop 0.8501 220 330
ID Description Score Start End Superfamily
af_A0A1D6KFP0_116_204_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9166 105 178 1.25.40.10
af_A4HXP1_1_128_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9062 225 329 1.25.40.10
af_Q86TZ1_175_262_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9026 105 181 1.25.40.10
af_G3UYY4_1474_1545_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8965 301 370 1.25.40.10
6fdtA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8927 228 329 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2V8HXK1-F1-model_v4 Tetratricopeptide repeat protein 0.9767 44 383
AF-A0A143PVF9-F1-model_v4 Zn-dependent protease, contains TPR repeats 0.974 20 384 GO:0006508
GO:0008233
AF-A0A7W1P8D7-F1-model_v4 Tetratricopeptide repeat protein 0.9719 12 331
AF-A0A3N5NY33-F1-model_v4 Tetratricopeptide repeat protein 0.9689 11 352
AF-A0A3N5YA59-F1-model_v4 Tetratricopeptide repeat protein 0.9629 8 384

Map