F445660

General Info

Members Datasets Scaffolds Average Seq Length
446 249 892 289

Family's Representative Sequence

Representative Sequence 3300005406|Ga0070703_10007787|Ga0070703_100077873
Length 314
Sequence MTATTPDGPGSAAPASGPLPGAVRGGGRRHVLAELYRHPRAQILLLLTPPLGWFGIVYMGSLALLLVTAFWTFDSATGRVVQHWTLDNFAQLINQPAFRTIALRTLLFATAVTVADMLIAFPIAFYMAQVASPRTRSVLFMLCLLPLWASYLVRVYAWRVILSPNGPLDWALGLVGLGPAGLYPSELGAGIVFTYLWLPYMILPLYAGLERVPRSLLEASADLGARSSTTFRRVILPLVLPALAAGSIFTFSLTLGDYITPGLVSNNQFIGNVVFEQQGVSGNLPLAAAFALVPVGIMAIYLFVARRLGAFEAL

Samples

Sample ID Description Type Environment
1 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
143 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
144 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
145 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.85
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 1.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070703_10007787 3300005406 Bacteria 3013
2 Ga0070658_10043156 3300005327 Bacteria 3643
3 Ga0070658_10076935 3300005327 Bacteria 2737
4 Ga0070683_100115111 3300005329 Bacteria 2538
5 Ga0070683_100177552 3300005329 Bacteria 2021
6 Ga0070683_100241807 3300005329 Bacteria 1717
7 Ga0070680_100060535 3300005336 Bacteria 3098
8 Ga0070682_100198210 3300005337 Bacteria 1414
9 Ga0070660_100117352 3300005339 Bacteria 2122
10 Ga0070659_100184755 3300005366 Bacteria 1712
11 Ga0070714_100003954 3300005435 Bacteria 11139
12 Ga0070714_100020810 3300005435 Bacteria 5363
13 Ga0070714_100115849 3300005435 Bacteria 2379
14 Ga0070714_100161469 3300005435 Bacteria 2028
15 Ga0070714_100313262 3300005435 Bacteria 1466
16 Ga0070710_10150322 3300005437 Bacteria 1436
17 Ga0070705_100001426 3300005440 Bacteria 12645
18 Ga0070700_100411308 3300005441 Unclassified 1020
19 Ga0070694_100033597 3300005444 Bacteria 3377
20 Ga0070694_100050478 3300005444 Bacteria 2804
21 Ga0070708_100032252 3300005445 Bacteria 4542
22 Ga0070708_100035008 3300005445 Bacteria 4372
23 Ga0070681_10070154 3300005458 Bacteria 3470
24 Ga0070681_10071149 3300005458 Bacteria 3443
25 Ga0070681_10203821 3300005458 Bacteria 1896
26 Ga0070681_10310762 3300005458 Bacteria 1485
27 Ga0070681_10360613 3300005458 Bacteria 1364
28 Ga0070681_10536163 3300005458 Bacteria 1084
29 Ga0070706_100023009 3300005467 Bacteria 5739
30 Ga0070706_100070050 3300005467 Bacteria 3244
31 Ga0070706_100144307 3300005467 Bacteria 2223
32 Ga0070706_100158105 3300005467 Bacteria 2116
33 Ga0070707_100019609 3300005468 Bacteria 6373
34 Ga0070707_100262676 3300005468 Bacteria 1679
35 Ga0070707_100288805 3300005468 Bacteria 1594
36 Ga0070698_100236955 3300005471 Bacteria 1758
37 Ga0070698_100252932 3300005471 Bacteria 1694
38 Ga0070699_100095353 3300005518 Bacteria 2605
39 Ga0070699_100155489 3300005518 Unclassified 2024
40 Ga0070699_100326452 3300005518 Bacteria 1380
41 Ga0070699_100360788 3300005518 Bacteria 1310
42 Ga0070679_100231211 3300005530 Bacteria 1808
43 Ga0070679_100255722 3300005530 Bacteria 1707
44 Ga0070684_100191657 3300005535 Bacteria 1860
45 Ga0070684_100281241 3300005535 Bacteria 1524
46 Ga0070697_100011629 3300005536 Bacteria 6879
47 Ga0070697_100155856 3300005536 Bacteria 1928
48 Ga0068853_100448896 3300005539 Bacteria 1213
49 Ga0070686_100078040 3300005544 Bacteria 2185
50 Ga0070695_100010923 3300005545 Bacteria 5426
51 Ga0070695_100035855 3300005545 Bacteria 3118
52 Ga0070695_100048665 3300005545 Bacteria 2711
53 Ga0070696_100007862 3300005546 Bacteria 7118
54 Ga0070696_100322255 3300005546 Bacteria 1190
55 Ga0070665_100276307 3300005548 Bacteria 1682
56 Ga0070704_100022153 3300005549 Bacteria 4131
57 Ga0070704_100032883 3300005549 Bacteria 3502
58 Ga0068855_100188983 3300005563 Bacteria 2324
59 Ga0070664_100387305 3300005564 Bacteria 1277
60 Ga0068857_100041160 3300005577 Bacteria 4097
61 Ga0068854_100063632 3300005578 Bacteria 2678
62 Ga0068854_100084499 3300005578 Bacteria 2349
63 Ga0068856_100169762 3300005614 Bacteria 2193
64 Ga0068856_100412951 3300005614 Bacteria 1370
65 Ga0070702_100139381 3300005615 Bacteria 1543
66 Ga0068864_100008950 3300005618 Bacteria 8253
67 Ga0068863_100318328 3300005841 Bacteria 1511
68 Ga0068863_100327810 3300005841 Unclassified 1488
69 Ga0068860_100049011 3300005843 Bacteria 4026
70 Ga0068862_100112427 3300005844 Bacteria 2392
71 Ga0068862_100559990 3300005844 Bacteria 1092
72 Ga0081539_10011992 3300005985 Bacteria 6753
73 Ga0081539_10032067 3300005985 Bacteria 3224
74 Ga0070717_10161015 3300006028 Bacteria 1947
75 Ga0070712_100138682 3300006175 Bacteria 1853
76 Ga0075428_100008921 3300006844 Bacteria 11125
77 Ga0075433_10068004 3300006852 Bacteria 3126
78 Ga0075434_100030817 3300006871 Bacteria 5285
79 Ga0075434_100085456 3300006871 Bacteria 3154
80 Ga0075434_100464402 3300006871 Bacteria 1287
81 Ga0075429_100051288 3300006880 Bacteria 3590
82 Ga0068865_100056134 3300006881 Bacteria 2742
83 Ga0075436_100001308 3300006914 Bacteria 16927
84 Ga0075436_100267090 3300006914 Bacteria 1221
85 Ga0075435_100003663 3300007076 Bacteria 10464
86 Ga0105240_10032119 3300009093 Bacteria 6799
87 Ga0105240_10032405 3300009093 Bacteria 6765
88 Ga0111539_10031411 3300009094 Bacteria 6452
89 Ga0111539_10166140 3300009094 Bacteria 2580
90 Ga0105245_10240341 3300009098 Bacteria 1755
91 Ga0105247_10274617 3300009101 Bacteria 1161
92 Ga0114129_10002173 3300009147 Bacteria 27004
93 Ga0114129_10040981 3300009147 Bacteria 6526
94 Ga0105243_10486681 3300009148 Bacteria 1166
95 Ga0105241_10066817 3300009174 Bacteria 2782
96 Ga0105241_10354250 3300009174 Bacteria 1275
97 Ga0105248_10672526 3300009177 Bacteria 1168
98 Ga0105237_10108456 3300009545 Bacteria 2768
99 Ga0105238_10080959 3300009551 Bacteria 3236
100 Ga0105249_10171351 3300009553 Bacteria 2105
101 Ga0105239_10188049 3300010375 Bacteria 2311
102 Ga0105239_10291068 3300010375 Bacteria 1839
103 Ga0105246_10267379 3300011119 Bacteria 1365
104 Ga0157370_10210445 3300013104 Bacteria 1802
105 Ga0157369_10191410 3300013105 Bacteria 2149
106 Ga0157374_10010178 3300013296 Bacteria 8085
107 Ga0157374_10028093 3300013296 Bacteria 5080
108 Ga0157374_10132631 3300013296 Bacteria 2412
109 Ga0163162_10078961 3300013306 Bacteria 3357
110 Ga0163162_10196913 3300013306 Bacteria 2144
111 Ga0163162_10212800 3300013306 Bacteria 2063
112 Ga0157372_10119363 3300013307 Bacteria 3027
113 Ga0157372_10139382 3300013307 Bacteria 2793
114 Ga0163163_10018606 3300014325 Bacteria 6508
115 Ga0163163_10263598 3300014325 Bacteria 1774
116 Ga0163163_10316780 3300014325 Bacteria 1613
117 Ga0182008_10026814 3300014497 Bacteria 2921
118 Ga0157379_10049381 3300014968 Bacteria 3757
119 Ga0182006_1025406 3300015261 Bacteria 2433
120 Ga0213871_10035355 3300021441 Bacteria 1321
121 Ga0224712_10023480 3300022467 Bacteria 2142
122 Ga0207653_10010130 3300025885 Bacteria 2939
123 Ga0207688_10160355 3300025901 Bacteria 1333
124 Ga0207705_10007079 3300025909 Bacteria 8273
125 Ga0207705_10216865 3300025909 Bacteria 1452
126 Ga0207684_10007113 3300025910 Bacteria 10116
127 Ga0207684_10119595 3300025910 Bacteria 2258
128 Ga0207654_10065248 3300025911 Bacteria 2143
129 Ga0207707_10024334 3300025912 Bacteria 5299
130 Ga0207707_10035384 3300025912 Bacteria 4368
131 Ga0207707_10052532 3300025912 Bacteria 3548
132 Ga0207707_10275029 3300025912 Bacteria 1459
133 Ga0207707_10294382 3300025912 Bacteria 1404
134 Ga0207707_10299264 3300025912 Bacteria 1391
135 Ga0207695_10003453 3300025913 Bacteria 22270
136 Ga0207671_10145257 3300025914 Bacteria 1830
137 Ga0207693_10040065 3300025915 Bacteria 3689
138 Ga0207663_10073054 3300025916 Bacteria 2219
139 Ga0207660_10189749 3300025917 Bacteria 1600
140 Ga0207660_10436573 3300025917 Bacteria 1058
141 Ga0207662_10068955 3300025918 Bacteria 2136
142 Ga0207657_10153273 3300025919 Bacteria 1876
143 Ga0207652_10097720 3300025921 Bacteria 2589
144 Ga0207652_10171463 3300025921 Bacteria 1947
145 Ga0207652_10399103 3300025921 Bacteria 1241
146 Ga0207646_10008055 3300025922 Bacteria 10622
147 Ga0207646_10097859 3300025922 Bacteria 2629
148 Ga0207646_10105235 3300025922 Bacteria 2530
149 Ga0207646_10220428 3300025922 Bacteria 1714
150 Ga0207687_10008575 3300025927 Bacteria 6685
151 Ga0207687_10014413 3300025927 Bacteria 5173
152 Ga0207687_10116795 3300025927 Bacteria 1989
153 Ga0207664_10060836 3300025929 Bacteria 3011
154 Ga0207664_10064726 3300025929 Bacteria 2925
155 Ga0207664_10097775 3300025929 Bacteria 2419
156 Ga0207664_10359702 3300025929 Bacteria 1289
157 Ga0207690_10078084 3300025932 Bacteria 2303
158 Ga0207690_10274354 3300025932 Bacteria 1311
159 Ga0207709_10035786 3300025935 Bacteria 2938
160 Ga0207704_10394503 3300025938 Bacteria 1090
161 Ga0207661_10066760 3300025944 Bacteria 2923
162 Ga0207679_10091304 3300025945 Bacteria 2357
163 Ga0207679_10176232 3300025945 Bacteria 1765
164 Ga0207667_10016235 3300025949 Bacteria 8415
165 Ga0207667_10190656 3300025949 Bacteria 2103
166 Ga0207640_10027932 3300025981 Bacteria 3443
167 Ga0207640_10248718 3300025981 Bacteria 1378
168 Ga0207703_10048740 3300026035 Bacteria 3421
169 Ga0207639_10650431 3300026041 Bacteria 975
170 Ga0207708_10027405 3300026075 Bacteria 4314
171 Ga0207702_10185902 3300026078 Bacteria 1916
172 Ga0207702_10209355 3300026078 Bacteria 1812
173 Ga0207702_10255673 3300026078 Bacteria 1647
174 Ga0207648_10070187 3300026089 Bacteria 3054
175 Ga0207676_10028045 3300026095 Bacteria 4201
176 Ga0207674_10002691 3300026116 Bacteria 22179
177 Ga0207674_10016112 3300026116 Bacteria 8189
178 Ga0209971_1017428 3300027682 Bacteria 1702
179 Ga0209998_10001225 3300027717 Bacteria 6313
180 Ga0209974_10002077 3300027876 Bacteria 7327
181 Ga0268266_10234079 3300028379 Bacteria 1693
182 Ga0268265_10027477 3300028380 Bacteria 4063
183 Ga0265319_1000329 3300028563 Bacteria 34971
184 Ga0265319_1006101 3300028563 Bacteria 5643
185 Ga0265318_10004403 3300028577 Bacteria 6835
186 Ga0265318_10018864 3300028577 Bacteria 2807
187 Ga0265323_10045077 3300028653 Bacteria 1586
188 Ga0265322_10026948 3300028654 Bacteria 1642
189 Ga0265338_10008673 3300028800 Bacteria 12299
190 Ga0265338_10009048 3300028800 Bacteria 11977
191 Ga0265338_10039198 3300028800 Bacteria 4475
192 Ga0265332_10008655 3300031238 Bacteria 4566
193 Ga0265328_10004919 3300031239 Bacteria 5756
194 Ga0265320_10014834 3300031240 Bacteria 4420
195 Ga0265320_10030996 3300031240 Bacteria 2750
196 Ga0265320_10076318 3300031240 Bacteria 1570
197 Ga0265325_10002339 3300031241 Bacteria 12848
198 Ga0265339_10158395 3300031249 Bacteria 1140
199 Ga0265331_10019545 3300031250 Bacteria 3498
200 Ga0265327_10001178 3300031251 Bacteria 35439
201 Ga0265316_10005528 3300031344 Bacteria 12258
202 Ga0265316_10018885 3300031344 Bacteria 5917
203 Ga0265314_10004208 3300031711 Bacteria 13500
204 Ga0265342_10008808 3300031712 Bacteria 7193
205 Ga0265342_10027800 3300031712 Bacteria 3528
206 Ga0307405_10130806 3300031731 Bacteria 1734
207 Ga0307406_10231304 3300031901 Bacteria 1381
208 Ga0307412_10215310 3300031911 Bacteria 1469
209 Ga0307409_100033572 3300031995 Bacteria 3736
210 Ga0307409_100075266 3300031995 Bacteria 2702
211 Ga0307416_100058626 3300032002 Bacteria 3123
212 Ga0307416_100187157 3300032002 Bacteria 1948
213 Ga0307411_10012810 3300032005 Bacteria 4597
214 Ga0307415_100044460 3300032126 Bacteria 2970
215 Ga0307415_100125634 3300032126 Bacteria 1932
216 Ga0373943_0014253 3300035170 Bacteria 3597
217 Ga0373946_0039940 3300035171 Bacteria 1917
218 Ga0373935_0082928 3300035692 Bacteria 2086
219 Ga0373947_0011160 3300035725 Bacteria 5158
220 Ga0373947_0098738 3300035725 Bacteria 1832
221 Ga0373947_0130452 3300035725 Bacteria 1604
222 Ga0373937_0097193 3300036401 Bacteria 2731
223 Ga0373925_0015963 3300037068 Bacteria 5437
224 Ga0373925_0359807 3300037068 Bacteria 1183
225 Ga0395899_0016952 3300037312 Bacteria 5553
226 Ga0395899_0042045 3300037312 Bacteria 3413
227 Ga0395899_0098962 3300037312 Bacteria 2107
228 Ga0395900_0016307 3300037418 Bacteria 7573
229 Ga0395900_0022770 3300037418 Bacteria 6410
230 Ga0395900_0108772 3300037418 Bacteria 2848
231 Ga0395898_0006100 3300037466 Bacteria 12923
232 Ga0395898_0024021 3300037466 Bacteria 6151
233 Ga0395898_0046015 3300037466 Bacteria 4287
234 Ga0395898_0048998 3300037466 Bacteria 4141
235 Ga0395898_0109316 3300037466 Bacteria 2651
236 Ga0395898_0130988 3300037466 Bacteria 2402
237 Ga0395898_0190472 3300037466 Bacteria 1959
238 Ga0395898_0246388 3300037466 Bacteria 1704
239 Ga0395898_0273723 3300037466 Bacteria 1610
240 Ga0395905_0026049 3300037471 Bacteria 5514
241 Ga0395905_0046144 3300037471 Bacteria 4086
242 Ga0395905_0188156 3300037471 Bacteria 1937
243 Ga0395905_0644576 3300037471 Bacteria 961
244 Ga0395901_0012354 3300038443 Bacteria 8662
245 Ga0395901_0057463 3300038443 Bacteria 4046
246 Ga0395901_0359994 3300038443 Bacteria 1500
247 Ga0395901_0580316 3300038443 Bacteria 1133
248 Ga0436360_1194431 3300039438 Bacteria 4187
249 Ga0439465_0027439 3300041413 Bacteria 1804
250 Ga0439441_016516 3300042001 Bacteria 1317
251 Ga0439451_043352 3300042009 Unclassified 902
252 Ga0450910_006887 3300042147 Bacteria 1575
253 Ga0466965_0044677 3300044683 Bacteria 2190
254 Ga0466966_0019634 3300044684 Bacteria 4446
255 Ga0466963_0001304 3300044694 Bacteria 13253
256 Ga0466963_0002920 3300044694 Bacteria 9654
257 Ga0466963_0031230 3300044694 Bacteria 3442
258 Ga0466963_0155624 3300044694 Bacteria 1589
259 Ga0466971_0061495 3300044719 Bacteria 1698
260 Ga0466968_0007362 3300044735 Bacteria 4183
261 Ga0466968_0025235 3300044735 Bacteria 2433
262 Ga0466968_0057814 3300044735 Bacteria 1668
263 Ga0466968_0058482 3300044735 Bacteria 1659
264 Ga0466957_0038817 3300044842 Bacteria 2871
265 Ga0466957_0158348 3300044842 Bacteria 1469
266 Ga0466957_0243367 3300044842 Bacteria 1194
267 Ga0466960_0076569 3300044901 Bacteria 1676
268 Ga0466959_0003133 3300045049 Bacteria 10722
269 Ga0466959_0073167 3300045049 Bacteria 2480
270 Ga0466959_0078710 3300045049 Bacteria 2377
271 Ga0451576_0124202 3300045051 Bacteria 2689
272 Ga0466958_0011668 3300045836 Bacteria 4955
273 Ga0466967_0003829 3300045976 Bacteria 9957
274 Ga0466967_0013131 3300045976 Bacteria 6382
275 Ga0466967_0027207 3300045976 Bacteria 4754
276 Ga0466967_0032960 3300045976 Bacteria 4380
277 Ga0466967_0049117 3300045976 Bacteria 3688
278 Ga0466967_0058806 3300045976 Bacteria 3399
279 Ga0466967_0069097 3300045976 Bacteria 3156
280 Ga0466967_0069904 3300045976 Bacteria 3140
281 Ga0466967_0093103 3300045976 Bacteria 2741
282 Ga0466967_0104231 3300045976 Bacteria 2596
283 Ga0466967_0157500 3300045976 Bacteria 2129
284 Ga0466967_0158235 3300045976 Bacteria 2124
285 Ga0466967_0185632 3300045976 Bacteria 1963
286 Ga0495603_0010395 3300046455 Bacteria 5636
287 Ga0495629_0023731 3300046459 Bacteria 4368
288 Ga0495641_0010751 3300046461 Bacteria 5271
289 Ga0495641_0037709 3300046461 Unclassified 2263
290 Ga0495651_0078592 3300046462 Bacteria 2495
291 Ga0495653_0121136 3300046463 Bacteria 1864
292 Ga0495580_0022800 3300046472 Bacteria 4603
293 Ga0495580_0032931 3300046472 Bacteria 3735
294 Ga0495582_0019666 3300046473 Bacteria 3692
295 Ga0495639_0036797 3300046475 Bacteria 2193
296 Ga0495662_0022337 3300046476 Bacteria 3055
297 Ga0495664_0086937 3300046477 Bacteria 1878
298 Ga0495664_0211592 3300046477 Bacteria 1174
299 Ga0495585_0034975 3300046492 Bacteria 2841
300 Ga0495594_0034608 3300046499 Bacteria 2749
301 Ga0495608_0036413 3300046511 Bacteria 3313
302 Ga0495618_0018469 3300046514 Bacteria 4280
303 Ga0495630_0052465 3300046517 Bacteria 3053
304 Ga0495665_0004788 3300046531 Bacteria 7306
305 Ga0495640_0056162 3300046533 Bacteria 2690
306 Ga0495586_0080593 3300046535 Bacteria 1788
307 Ga0495587_0046839 3300046536 Bacteria 2565
308 Ga0495667_0017443 3300046559 Bacteria 4848
309 Ga0495667_0143173 3300046559 Bacteria 1540
310 Ga0495634_0009466 3300046642 Bacteria 7184
311 Ga0495635_0038023 3300046663 Bacteria 3331
312 Ga0495588_0162156 3300046674 Bacteria 1182
313 Ga0495657_0042645 3300046675 Bacteria 3096
314 Ga0495646_0094104 3300046680 Bacteria 1726
315 Ga0495647_0026448 3300046681 Bacteria 2126
316 Ga0495658_0017189 3300046683 Bacteria 3733
317 Ga0495613_0074519 3300046689 Bacteria 2471
318 Ga0495624_0010277 3300046690 Bacteria 6449
319 Ga0495600_0017148 3300046809 Bacteria 4604
320 Ga0495581_0047581 3300047315 Bacteria 2478
321 Ga0495604_0036600 3300047317 Bacteria 3869
322 Ga0495674_0046905 3300047319 Bacteria 3833
323 Ga0495674_0068034 3300047319 Bacteria 3084
324 Ga0495676_0015036 3300047321 Bacteria 6908
325 Ga0495676_0081992 3300047321 Bacteria 2442
326 Ga0495680_0017798 3300047322 Bacteria 6049
327 Ga0495680_0343196 3300047322 Bacteria 1041
328 Ga0495614_0014651 3300048089 Bacteria 3428
329 Ga0496101_0062645 3300048904 Bacteria 2705
330 Ga0496101_0078624 3300048904 Bacteria 2434
331 Ga0496101_0518249 3300048904 Bacteria 942
332 Ga0496102_0006846 3300048905 Bacteria 9729
333 Ga0496102_0045463 3300048905 Bacteria 3987
334 Ga0496103_0005781 3300048906 Bacteria 7383
335 Ga0496104_0181205 3300048907 Bacteria 2017
336 Ga0496104_0221288 3300048907 Bacteria 1805
337 Ga0496105_0191701 3300048908 Bacteria 1671
338 Ga0496106_0014073 3300048909 Bacteria 5911
339 Ga0496106_0018754 3300048909 Bacteria 5124
340 Ga0496106_0078165 3300048909 Bacteria 2538
341 Ga0496107_0013903 3300048910 Bacteria 5628
342 Ga0496108_0043699 3300048911 Bacteria 3742
343 Ga0496108_0276533 3300048911 Bacteria 1462
344 Ga0496108_0313948 3300048911 Bacteria 1366
345 Ga0496109_0005008 3300048912 Bacteria 11061
346 Ga0496109_0037430 3300048912 Bacteria 4383
347 Ga0496109_0039418 3300048912 Bacteria 4276
348 Ga0496109_0125565 3300048912 Bacteria 2392
349 Ga0496110_0000044 3300048913 Bacteria 61218
350 Ga0496110_0107847 3300048913 Bacteria 2500
351 Ga0496110_0117277 3300048913 Bacteria 2397
352 Ga0496111_0027329 3300048914 Bacteria 4035
353 Ga0496111_0099411 3300048914 Bacteria 2137
354 Ga0496111_0232348 3300048914 Bacteria 1370
355 Ga0496112_0002608 3300048915 Bacteria 14552
356 Ga0496112_0043041 3300048915 Bacteria 4420
357 Ga0496112_0079473 3300048915 Bacteria 3244
358 Ga0496112_0622628 3300048915 Bacteria 1010
359 Ga0496114_0066259 3300048917 Bacteria 3027
360 Ga0496114_0083805 3300048917 Bacteria 2698
361 Ga0496114_0110523 3300048917 Bacteria 2355
362 Ga0496114_0162375 3300048917 Bacteria 1943
363 Ga0496115_0272450 3300048918 Bacteria 1390
364 Ga0501031_0072952 3300049568 Bacteria 2235
365 Ga0501033_0070857 3300049570 Bacteria 2561
366 Ga0501034_0026355 3300049571 Bacteria 5920
367 Ga0501036_0131196 3300049572 Bacteria 2116
368 Ga0501036_0239703 3300049572 Bacteria 1521
369 Ga0501037_0137611 3300049573 Bacteria 1749
370 Ga0501038_0250633 3300049574 Bacteria 1403
371 Ga0501039_0087898 3300049575 Bacteria 2421
372 Ga0501039_0146410 3300049575 Bacteria 1856
373 Ga0501039_0235924 3300049575 Bacteria 1438
374 Ga0501040_0046252 3300049576 Bacteria 2971
375 Ga0501040_0231458 3300049576 Bacteria 1316
376 Ga0501041_0003430 3300049577 Bacteria 9118
377 Ga0501042_0002266 3300049578 Bacteria 11745
378 Ga0501046_0299266 3300049580 Bacteria 1175
379 Ga0501067_0000458 3300049583 Bacteria 22348
380 Ga0501067_0076927 3300049583 Bacteria 1849
381 Ga0501067_0095102 3300049583 Bacteria 1654
382 Ga0501068_0003911 3300049584 Bacteria 8097
383 Ga0501069_0001118 3300049585 Bacteria 12949
384 Ga0501069_0046803 3300049585 Bacteria 2400
385 Ga0501069_0089024 3300049585 Bacteria 1745
386 Ga0501070_0010986 3300049586 Bacteria 7644
387 Ga0501070_0094666 3300049586 Bacteria 2472
388 Ga0501071_0015566 3300049587 Bacteria 5222
389 Ga0501071_0015607 3300049587 Bacteria 5216
390 Ga0501071_0057047 3300049587 Bacteria 2822
391 Ga0501071_0308714 3300049587 Bacteria 1200
392 Ga0501072_0005228 3300049588 Bacteria 9881
393 Ga0501072_0009079 3300049588 Bacteria 7550
394 Ga0501072_0176368 3300049588 Bacteria 1705
395 Ga0501072_0322164 3300049588 Bacteria 1228
396 Ga0501073_0069843 3300049589 Bacteria 2447
397 Ga0501073_0116631 3300049589 Bacteria 1851
398 Ga0501074_0025530 3300049590 Bacteria 4290
399 Ga0501074_0025857 3300049590 Bacteria 4259
400 Ga0501075_0080732 3300049591 Bacteria 2462
401 Ga0501075_0197299 3300049591 Bacteria 1535
402 Ga0501075_0381065 3300049591 Bacteria 1075
403 Ga0501076_0307160 3300049592 Bacteria 1301
404 Ga0501077_0072951 3300049593 Bacteria 2175
405 Ga0501077_0148239 3300049593 Bacteria 1489
406 Ga0501077_0232488 3300049593 Bacteria 1172
407 Ga0501235_036396 3300049669 Bacteria 1119
408 Ga0501079_0046016 3300049741 Bacteria 3367
409 Ga0501079_0230602 3300049741 Bacteria 1446
410 Ga0501079_0597725 3300049741 Bacteria 868
411 Ga0501080_0012748 3300049742 Bacteria 7710
412 Ga0501080_0041008 3300049742 Bacteria 4315
413 Ga0501081_0170400 3300049743 Bacteria 1572
414 Ga0501081_0225469 3300049743 Bacteria 1364
415 Ga0501083_0007706 3300049744 Bacteria 7634
416 Ga0501044_0357977 3300049823 Bacteria 1378
417 Ga0501045_0349841 3300049824 Bacteria 1100
418 nmdc:mga05p37_41_c1 3300050507 Bacteria 108003
419 nmdc:mga05p37_43216_c1 3300050507 Bacteria 5542
420 nmdc:mga09592_110345_c1 3300050508 Bacteria 2360
421 nmdc:mga08y16_131845_c1 3300050511 Bacteria 2598
422 nmdc:mga08y16_22901_c1 3300050511 Bacteria 6593
423 nmdc:mga0n895_1275_c1 3300050512 Bacteria 18603
424 nmdc:mga0n895_55038_c1 3300050512 Bacteria 3915
425 nmdc:mga0rr50_140153_c1 3300050513 Bacteria 1945
426 nmdc:mga08x19_77949_c1 3300050514 Bacteria 2171
427 nmdc:mga0a205_10769_c1 3300050515 Bacteria 8409
428 nmdc:mga0a205_56512_c1 3300050515 Bacteria 3789
429 nmdc:mga0a205_79915_c1 3300050515 Bacteria 3160
430 Ga0495601_0064489 3300053077 Bacteria 2329
431 Ga0495601_0275941 3300053077 Bacteria 1096
432 Ga0495612_0000404 3300053078 Bacteria 17304
433 Ga0495619_0016424 3300053085 Bacteria 4686
434 Ga0495619_0277022 3300053085 Bacteria 1162
435 Ga0501084_0068539 3300054114 Bacteria 2970
436 Ga0501084_0098067 3300054114 Bacteria 2461
437 Ga0501084_0160246 3300054114 Bacteria 1898
438 Ga0590077_019828 3300059426 Bacteria 1426
439 Ga0501082_0111328 3300060353 Bacteria 2370
440 Ga0501082_0163227 3300060353 Bacteria 1936
441 Ga0501082_0182350 3300060353 Bacteria 1826
442 Ga0530510_0004844 3300061734 Bacteria 9313
443 Ga0530510_0030527 3300061734 Bacteria 3871
444 Ga0530510_0087970 3300061734 Bacteria 2264
445 Ga0530510_0088044 3300061734 Bacteria 2263
446 Ga0530510_0286620 3300061734 Bacteria 1231
447 Ga0070703_10007787
448 Ga0070658_10043156
449 Ga0070658_10076935
450 Ga0070683_100115111
451 Ga0070683_100177552
452 Ga0070683_100241807
453 Ga0070680_100060535
454 Ga0070682_100198210
455 Ga0070660_100117352
456 Ga0070659_100184755
457 Ga0070714_100003954
458 Ga0070714_100020810
459 Ga0070714_100115849
460 Ga0070714_100161469
461 Ga0070714_100313262
462 Ga0070710_10150322
463 Ga0070705_100001426
464 Ga0070700_100411308
465 Ga0070694_100033597
466 Ga0070694_100050478
467 Ga0070708_100032252
468 Ga0070708_100035008
469 Ga0070681_10070154
470 Ga0070681_10071149
471 Ga0070681_10203821
472 Ga0070681_10310762
473 Ga0070681_10360613
474 Ga0070681_10536163
475 Ga0070706_100023009
476 Ga0070706_100070050
477 Ga0070706_100144307
478 Ga0070706_100158105
479 Ga0070707_100019609
480 Ga0070707_100262676
481 Ga0070707_100288805
482 Ga0070698_100236955
483 Ga0070698_100252932
484 Ga0070699_100095353
485 Ga0070699_100155489
486 Ga0070699_100326452
487 Ga0070699_100360788
488 Ga0070679_100231211
489 Ga0070679_100255722
490 Ga0070684_100191657
491 Ga0070684_100281241
492 Ga0070697_100011629
493 Ga0070697_100155856
494 Ga0068853_100448896
495 Ga0070686_100078040
496 Ga0070695_100010923
497 Ga0070695_100035855
498 Ga0070695_100048665
499 Ga0070696_100007862
500 Ga0070696_100322255
501 Ga0070665_100276307
502 Ga0070704_100022153
503 Ga0070704_100032883
504 Ga0068855_100188983
505 Ga0070664_100387305
506 Ga0068857_100041160
507 Ga0068854_100063632
508 Ga0068854_100084499
509 Ga0068856_100169762
510 Ga0068856_100412951
511 Ga0070702_100139381
512 Ga0068864_100008950
513 Ga0068863_100318328
514 Ga0068863_100327810
515 Ga0068860_100049011
516 Ga0068862_100112427
517 Ga0068862_100559990
518 Ga0081539_10011992
519 Ga0081539_10032067
520 Ga0070717_10161015
521 Ga0070712_100138682
522 Ga0075428_100008921
523 Ga0075433_10068004
524 Ga0075434_100030817
525 Ga0075434_100085456
526 Ga0075434_100464402
527 Ga0075429_100051288
528 Ga0068865_100056134
529 Ga0075436_100001308
530 Ga0075436_100267090
531 Ga0075435_100003663
532 Ga0105240_10032119
533 Ga0105240_10032405
534 Ga0111539_10031411
535 Ga0111539_10166140
536 Ga0105245_10240341
537 Ga0105247_10274617
538 Ga0114129_10002173
539 Ga0114129_10040981
540 Ga0105243_10486681
541 Ga0105241_10066817
542 Ga0105241_10354250
543 Ga0105248_10672526
544 Ga0105237_10108456
545 Ga0105238_10080959
546 Ga0105249_10171351
547 Ga0105239_10188049
548 Ga0105239_10291068
549 Ga0105246_10267379
550 Ga0157370_10210445
551 Ga0157369_10191410
552 Ga0157374_10010178
553 Ga0157374_10028093
554 Ga0157374_10132631
555 Ga0163162_10078961
556 Ga0163162_10196913
557 Ga0163162_10212800
558 Ga0157372_10119363
559 Ga0157372_10139382
560 Ga0163163_10018606
561 Ga0163163_10263598
562 Ga0163163_10316780
563 Ga0182008_10026814
564 Ga0157379_10049381
565 Ga0182006_1025406
566 Ga0213871_10035355
567 Ga0224712_10023480
568 Ga0207653_10010130
569 Ga0207688_10160355
570 Ga0207705_10007079
571 Ga0207705_10216865
572 Ga0207684_10007113
573 Ga0207684_10119595
574 Ga0207654_10065248
575 Ga0207707_10024334
576 Ga0207707_10035384
577 Ga0207707_10052532
578 Ga0207707_10275029
579 Ga0207707_10294382
580 Ga0207707_10299264
581 Ga0207695_10003453
582 Ga0207671_10145257
583 Ga0207693_10040065
584 Ga0207663_10073054
585 Ga0207660_10189749
586 Ga0207660_10436573
587 Ga0207662_10068955
588 Ga0207657_10153273
589 Ga0207652_10097720
590 Ga0207652_10171463
591 Ga0207652_10399103
592 Ga0207646_10008055
593 Ga0207646_10097859
594 Ga0207646_10105235
595 Ga0207646_10220428
596 Ga0207687_10008575
597 Ga0207687_10014413
598 Ga0207687_10116795
599 Ga0207664_10060836
600 Ga0207664_10064726
601 Ga0207664_10097775
602 Ga0207664_10359702
603 Ga0207690_10078084
604 Ga0207690_10274354
605 Ga0207709_10035786
606 Ga0207704_10394503
607 Ga0207661_10066760
608 Ga0207679_10091304
609 Ga0207679_10176232
610 Ga0207667_10016235
611 Ga0207667_10190656
612 Ga0207640_10027932
613 Ga0207640_10248718
614 Ga0207703_10048740
615 Ga0207639_10650431
616 Ga0207708_10027405
617 Ga0207702_10185902
618 Ga0207702_10209355
619 Ga0207702_10255673
620 Ga0207648_10070187
621 Ga0207676_10028045
622 Ga0207674_10002691
623 Ga0207674_10016112
624 Ga0209971_1017428
625 Ga0209998_10001225
626 Ga0209974_10002077
627 Ga0268266_10234079
628 Ga0268265_10027477
629 Ga0265319_1000329
630 Ga0265319_1006101
631 Ga0265318_10004403
632 Ga0265318_10018864
633 Ga0265323_10045077
634 Ga0265322_10026948
635 Ga0265338_10008673
636 Ga0265338_10009048
637 Ga0265338_10039198
638 Ga0265332_10008655
639 Ga0265328_10004919
640 Ga0265320_10014834
641 Ga0265320_10030996
642 Ga0265320_10076318
643 Ga0265325_10002339
644 Ga0265339_10158395
645 Ga0265331_10019545
646 Ga0265327_10001178
647 Ga0265316_10005528
648 Ga0265316_10018885
649 Ga0265314_10004208
650 Ga0265342_10008808
651 Ga0265342_10027800
652 Ga0307405_10130806
653 Ga0307406_10231304
654 Ga0307412_10215310
655 Ga0307409_100033572
656 Ga0307409_100075266
657 Ga0307416_100058626
658 Ga0307416_100187157
659 Ga0307411_10012810
660 Ga0307415_100044460
661 Ga0307415_100125634
662 Ga0373943_0014253
663 Ga0373946_0039940
664 Ga0373935_0082928
665 Ga0373947_0011160
666 Ga0373947_0098738
667 Ga0373947_0130452
668 Ga0373937_0097193
669 Ga0373925_0015963
670 Ga0373925_0359807
671 Ga0395899_0016952
672 Ga0395899_0042045
673 Ga0395899_0098962
674 Ga0395900_0016307
675 Ga0395900_0022770
676 Ga0395900_0108772
677 Ga0395898_0006100
678 Ga0395898_0024021
679 Ga0395898_0046015
680 Ga0395898_0048998
681 Ga0395898_0109316
682 Ga0395898_0130988
683 Ga0395898_0190472
684 Ga0395898_0246388
685 Ga0395898_0273723
686 Ga0395905_0026049
687 Ga0395905_0046144
688 Ga0395905_0188156
689 Ga0395905_0644576
690 Ga0395901_0012354
691 Ga0395901_0057463
692 Ga0395901_0359994
693 Ga0395901_0580316
694 Ga0436360_1194431
695 Ga0439465_0027439
696 Ga0439441_016516
697 Ga0439451_043352
698 Ga0450910_006887
699 Ga0466965_0044677
700 Ga0466966_0019634
701 Ga0466963_0001304
702 Ga0466963_0002920
703 Ga0466963_0031230
704 Ga0466963_0155624
705 Ga0466971_0061495
706 Ga0466968_0007362
707 Ga0466968_0025235
708 Ga0466968_0057814
709 Ga0466968_0058482
710 Ga0466957_0038817
711 Ga0466957_0158348
712 Ga0466957_0243367
713 Ga0466960_0076569
714 Ga0466959_0003133
715 Ga0466959_0073167
716 Ga0466959_0078710
717 Ga0451576_0124202
718 Ga0466958_0011668
719 Ga0466967_0003829
720 Ga0466967_0013131
721 Ga0466967_0027207
722 Ga0466967_0032960
723 Ga0466967_0049117
724 Ga0466967_0058806
725 Ga0466967_0069097
726 Ga0466967_0069904
727 Ga0466967_0093103
728 Ga0466967_0104231
729 Ga0466967_0157500
730 Ga0466967_0158235
731 Ga0466967_0185632
732 Ga0495603_0010395
733 Ga0495629_0023731
734 Ga0495641_0010751
735 Ga0495641_0037709
736 Ga0495651_0078592
737 Ga0495653_0121136
738 Ga0495580_0022800
739 Ga0495580_0032931
740 Ga0495582_0019666
741 Ga0495639_0036797
742 Ga0495662_0022337
743 Ga0495664_0086937
744 Ga0495664_0211592
745 Ga0495585_0034975
746 Ga0495594_0034608
747 Ga0495608_0036413
748 Ga0495618_0018469
749 Ga0495630_0052465
750 Ga0495665_0004788
751 Ga0495640_0056162
752 Ga0495586_0080593
753 Ga0495587_0046839
754 Ga0495667_0017443
755 Ga0495667_0143173
756 Ga0495634_0009466
757 Ga0495635_0038023
758 Ga0495588_0162156
759 Ga0495657_0042645
760 Ga0495646_0094104
761 Ga0495647_0026448
762 Ga0495658_0017189
763 Ga0495613_0074519
764 Ga0495624_0010277
765 Ga0495600_0017148
766 Ga0495581_0047581
767 Ga0495604_0036600
768 Ga0495674_0046905
769 Ga0495674_0068034
770 Ga0495676_0015036
771 Ga0495676_0081992
772 Ga0495680_0017798
773 Ga0495680_0343196
774 Ga0495614_0014651
775 Ga0496101_0062645
776 Ga0496101_0078624
777 Ga0496101_0518249
778 Ga0496102_0006846
779 Ga0496102_0045463
780 Ga0496103_0005781
781 Ga0496104_0181205
782 Ga0496104_0221288
783 Ga0496105_0191701
784 Ga0496106_0014073
785 Ga0496106_0018754
786 Ga0496106_0078165
787 Ga0496107_0013903
788 Ga0496108_0043699
789 Ga0496108_0276533
790 Ga0496108_0313948
791 Ga0496109_0005008
792 Ga0496109_0037430
793 Ga0496109_0039418
794 Ga0496109_0125565
795 Ga0496110_0000044
796 Ga0496110_0107847
797 Ga0496110_0117277
798 Ga0496111_0027329
799 Ga0496111_0099411
800 Ga0496111_0232348
801 Ga0496112_0002608
802 Ga0496112_0043041
803 Ga0496112_0079473
804 Ga0496112_0622628
805 Ga0496114_0066259
806 Ga0496114_0083805
807 Ga0496114_0110523
808 Ga0496114_0162375
809 Ga0496115_0272450
810 Ga0501031_0072952
811 Ga0501033_0070857
812 Ga0501034_0026355
813 Ga0501036_0131196
814 Ga0501036_0239703
815 Ga0501037_0137611
816 Ga0501038_0250633
817 Ga0501039_0087898
818 Ga0501039_0146410
819 Ga0501039_0235924
820 Ga0501040_0046252
821 Ga0501040_0231458
822 Ga0501041_0003430
823 Ga0501042_0002266
824 Ga0501046_0299266
825 Ga0501067_0000458
826 Ga0501067_0076927
827 Ga0501067_0095102
828 Ga0501068_0003911
829 Ga0501069_0001118
830 Ga0501069_0046803
831 Ga0501069_0089024
832 Ga0501070_0010986
833 Ga0501070_0094666
834 Ga0501071_0015566
835 Ga0501071_0015607
836 Ga0501071_0057047
837 Ga0501071_0308714
838 Ga0501072_0005228
839 Ga0501072_0009079
840 Ga0501072_0176368
841 Ga0501072_0322164
842 Ga0501073_0069843
843 Ga0501073_0116631
844 Ga0501074_0025530
845 Ga0501074_0025857
846 Ga0501075_0080732
847 Ga0501075_0197299
848 Ga0501075_0381065
849 Ga0501076_0307160
850 Ga0501077_0072951
851 Ga0501077_0148239
852 Ga0501077_0232488
853 Ga0501235_036396
854 Ga0501079_0046016
855 Ga0501079_0230602
856 Ga0501079_0597725
857 Ga0501080_0012748
858 Ga0501080_0041008
859 Ga0501081_0170400
860 Ga0501081_0225469
861 Ga0501083_0007706
862 Ga0501044_0357977
863 Ga0501045_0349841
864 nmdc:mga05p37_41_c1
865 nmdc:mga05p37_43216_c1
866 nmdc:mga09592_110345_c1
867 nmdc:mga08y16_131845_c1
868 nmdc:mga08y16_22901_c1
869 nmdc:mga0n895_1275_c1
870 nmdc:mga0n895_55038_c1
871 nmdc:mga0rr50_140153_c1
872 nmdc:mga08x19_77949_c1
873 nmdc:mga0a205_10769_c1
874 nmdc:mga0a205_56512_c1
875 nmdc:mga0a205_79915_c1
876 Ga0495601_0064489
877 Ga0495601_0275941
878 Ga0495612_0000404
879 Ga0495619_0016424
880 Ga0495619_0277022
881 Ga0501084_0068539
882 Ga0501084_0098067
883 Ga0501084_0160246
884 Ga0590077_019828
885 Ga0501082_0111328
886 Ga0501082_0163227
887 Ga0501082_0182350
888 Ga0530510_0004844
889 Ga0530510_0030527
890 Ga0530510_0087970
891 Ga0530510_0088044
892 Ga0530510_0286620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

120

310

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.7914 21 283
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.7672 21 281
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.7608 21 278
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7482 23 281
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.7379 69 273
ID Description Score Start End Superfamily
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8994 28 278 1.10.3720.10
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8641 38 284 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8413 29 280 1.10.3720.10
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8166 28 278 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.812 69 280 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A433VTG0-F1-model_v4 deleted 0.9057 42 287
AF-A0A535YR96-F1-model_v4 ABC transporter permease 0.9024 3 287 GO:0005886
GO:0055085
AF-A0A1G4V4U1-F1-model_v4 Putative spermidine/putrescine transport system permease protein 0.9001 23 287 GO:0005886
GO:0055085
AF-A0A7C6VBM9-F1-model_v4 ABC transporter permease 0.8976 12 287 GO:0005886
GO:0055085
AF-A0A100W6V7-F1-model_v4 ABC-type spermidine/putrescine transport system, permease component I 0.8962 25 287 GO:0005886
GO:0055085

Map