F445656

General Info

Members Datasets Scaffolds Average Seq Length
446 310 892 474

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100023958|Ga0070669_1000239582
Length 469
Sequence MKVPPTAVRLSRRRLLSRGALALCASAVPARLGAQTVSPAMAVLSEYMAVARDRAVPPDVAEKAKHHILDTFAAMVSGSRLPPGVAALKLARGTMGRPVSSVVGSDLRTAPIDAALVNGVLAHSDETDDMAEDVAAGGDHLLRAVTLGYDVGPRVSMALGGSTFRNETRRSTHALAGTFGSAAAAGCIAGLDARQMRWLLDYASQQAGGYAVWARDSDHIEKAFVFGGMPARNGVTAAVLVRSGWNGVDDVFSGADNFFAVNAPRGTVATVADGLGERFEITNTDIKKWTVGTPIQAPLDALENLRTKRPFEAGEVSRVVVRLAPSVGSVVDNRDIPDICLQHMMAVMLLDKTASFHAAHDKARMQDPSVRRERAKVAYVPDDALVRLLPARVAVVEVTLTDGTALVEQVEAVRGTVRNPMPRAEVVAKAMDLMAPVLGRGRAEMLVQRVLTLEAVRDMRTLQPLLRPA

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
125 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
126 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
132 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
241 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
242 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
248 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
253 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
256 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
257 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
258 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
259 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
260 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
263 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
264 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
265 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
266 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
267 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
268 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
269 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
270 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
271 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
272 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
273 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
274 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
275 2922368715
276 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
277 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
278 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
279 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
280 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
281 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
282 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
283 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
284 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
285 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
286 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
287 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
288 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
289 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
290 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
291 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
292 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
293 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
294 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
295 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
296 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
297 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
298 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
299 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
300 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
301 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
302 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
303 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
304 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
305 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
306 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
307 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
308 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
309 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
310 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.89
Metatranscriptomes 0
Isolates 10.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 8.52
Rhizoplane 5.38
Rhizosphere 73.09
Stem 0
Stem Tuber 0
Unclassified 5.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100023958 3300005353 Bacteria 4373
2 rootH2_10091471 3300003320 Bacteria 3106
3 rootH1_10311004 3300003323 Unclassified 2625
4 JGI25160J50197_1002045 3300003354 Bacteria 9612
5 Ga0065715_10090481 3300005293 Bacteria 6931
6 Ga0070683_100002390 3300005329 Bacteria 14902
7 Ga0070683_100047889 3300005329 Bacteria 3951
8 Ga0070690_100003577 3300005330 Bacteria 8534
9 Ga0070670_100023901 3300005331 Bacteria 5258
10 Ga0070670_100031443 3300005331 Bacteria 4572
11 Ga0070670_100091062 3300005331 Bacteria 2621
12 Ga0070677_10000820 3300005333 Bacteria 10264
13 Ga0070677_10028029 3300005333 Bacteria 2125
14 Ga0068869_100000741 3300005334 Bacteria 18568
15 Ga0070666_10003920 3300005335 Bacteria 9041
16 Ga0070680_100117018 3300005336 Bacteria 2222
17 Ga0068868_100010978 3300005338 Bacteria 6580
18 Ga0070689_100044996 3300005340 Unclassified 3397
19 Ga0070668_100037358 3300005347 Bacteria 3709
20 Ga0070669_100006451 3300005353 Bacteria 8448
21 Ga0070669_100060361 3300005353 Bacteria 2786
22 Ga0070669_100071497 3300005353 Bacteria 2567
23 Ga0070671_100052372 3300005355 Unclassified 3394
24 Ga0070671_100138122 3300005355 Unclassified 2056
25 Ga0070671_100151381 3300005355 Bacteria 1959
26 Ga0070688_100086571 3300005365 Bacteria 2039
27 Ga0070659_100096945 3300005366 Unclassified 2369
28 Ga0070709_10006358 3300005434 Bacteria 6434
29 Ga0070714_100059325 3300005435 Bacteria 3281
30 Ga0070714_100060737 3300005435 Bacteria 3245
31 Ga0070714_100120725 3300005435 Bacteria 2331
32 Ga0070714_100189596 3300005435 Bacteria 1875
33 Ga0070713_100028770 3300005436 Bacteria 4391
34 Ga0070710_10058320 3300005437 Bacteria 2190
35 Ga0070701_10022044 3300005438 Unclassified 3050
36 Ga0070711_100025517 3300005439 Bacteria 3868
37 Ga0070705_100000627 3300005440 Bacteria 20377
38 Ga0070700_100062813 3300005441 Bacteria 2348
39 Ga0070694_100022821 3300005444 Bacteria 4015
40 Ga0070708_100036287 3300005445 Bacteria 4299
41 Ga0070663_100022332 3300005455 Bacteria 4229
42 Ga0070663_100028390 3300005455 Bacteria 3809
43 Ga0070662_100053551 3300005457 Unclassified 2921
44 Ga0070681_10027061 3300005458 Bacteria 5766
45 Ga0070681_10140666 3300005458 Bacteria 2343
46 Ga0068867_100010386 3300005459 Bacteria 6569
47 Ga0070706_100019185 3300005467 Bacteria 6310
48 Ga0070707_100275129 3300005468 Bacteria 1637
49 Ga0070698_100008888 3300005471 Bacteria 10798
50 Ga0070698_100128973 3300005471 Bacteria 2485
51 Ga0070699_100021139 3300005518 Bacteria 5610
52 Ga0070679_100157521 3300005530 Bacteria 2245
53 Ga0070679_100218730 3300005530 Bacteria 1866
54 Ga0070684_100008533 3300005535 Bacteria 8018
55 Ga0070684_100066459 3300005535 Bacteria 3165
56 Ga0070684_100116409 3300005535 Bacteria 2401
57 Ga0070697_100031777 3300005536 Bacteria 4247
58 Ga0070686_100004648 3300005544 Bacteria 7572
59 Ga0070695_100001243 3300005545 Bacteria 14004
60 Ga0070696_100002835 3300005546 Bacteria 11523
61 Ga0070665_100064837 3300005548 Bacteria 3664
62 Ga0070704_100012178 3300005549 Bacteria 5307
63 Ga0070664_100006688 3300005564 Bacteria 9298
64 Ga0070664_100014633 3300005564 Bacteria 6404
65 Ga0068857_100026811 3300005577 Bacteria 5081
66 Ga0068857_100049929 3300005577 Bacteria 3712
67 Ga0068857_100134581 3300005577 Unclassified 2231
68 Ga0070702_100011807 3300005615 Unclassified 4356
69 Ga0068861_100095376 3300005719 Bacteria 2356
70 Ga0068870_10054709 3300005840 Bacteria 2124
71 Ga0068863_100192475 3300005841 Bacteria 1960
72 Ga0068858_100174196 3300005842 Bacteria 2030
73 Ga0068860_100010622 3300005843 Bacteria 9091
74 Ga0068862_100021169 3300005844 Bacteria 5436
75 Ga0068862_100107571 3300005844 Bacteria 2445
76 Ga0070717_10000296 3300006028 Bacteria 33438
77 Ga0070717_10020773 3300006028 Bacteria 5169
78 Ga0075365_10031913 3300006038 Bacteria 3383
79 Ga0070716_100015381 3300006173 Bacteria 3930
80 Ga0070716_100047774 3300006173 Bacteria 2416
81 Ga0070712_100009492 3300006175 Bacteria 6133
82 Ga0070712_100009886 3300006175 Bacteria 6014
83 Ga0070712_100021949 3300006175 Bacteria 4198
84 Ga0075369_10031480 3300006186 Bacteria 2240
85 Ga0068871_100024711 3300006358 Unclassified 4663
86 Ga0075430_100064077 3300006846 Bacteria 3087
87 Ga0075431_100017408 3300006847 Bacteria 7302
88 Ga0075431_100085882 3300006847 Bacteria 3248
89 Ga0075433_10001806 3300006852 Bacteria 16058
90 Ga0075433_10072869 3300006852 Bacteria 3021
91 Ga0075433_10181980 3300006852 Bacteria 1870
92 Ga0075434_100000830 3300006871 Bacteria 24547
93 Ga0075434_100020530 3300006871 Bacteria 6408
94 Ga0075429_100011476 3300006880 Bacteria 7681
95 Ga0075429_100142940 3300006880 Bacteria 2094
96 Ga0105240_10009685 3300009093 Bacteria 13614
97 Ga0114129_10150796 3300009147 Bacteria 3182
98 Ga0105241_10032253 3300009174 Bacteria 3926
99 Ga0105248_10244951 3300009177 Bacteria 2018
100 Ga0105237_10049103 3300009545 Bacteria 4243
101 Ga0105237_10161858 3300009545 Bacteria 2237
102 Ga0105238_10001003 3300009551 Bacteria 28821
103 Ga0105238_10050651 3300009551 Bacteria 4180
104 Ga0105249_10000858 3300009553 Bacteria 27086
105 Ga0157370_10027209 3300013104 Bacteria 5639
106 Ga0157369_10002124 3300013105 Bacteria 23888
107 Ga0157369_10003530 3300013105 Bacteria 18591
108 Ga0157369_10004766 3300013105 Bacteria 15947
109 Ga0163162_10013347 3300013306 Bacteria 8023
110 Ga0157372_10092834 3300013307 Bacteria 3434
111 Ga0163163_10040035 3300014325 Bacteria 4575
112 Ga0163163_10106655 3300014325 Bacteria 2828
113 Ga0157380_10007744 3300014326 Bacteria 7646
114 Ga0157380_10021159 3300014326 Bacteria 4875
115 Ga0157380_10060858 3300014326 Bacteria 3019
116 Ga0157379_10026651 3300014968 Bacteria 5145
117 Ga0213872_10010539 3300021361 Bacteria 4396
118 Ga0213875_10000012 3300021388 Bacteria 312017
119 Ga0207426_1000534 3300025302 Bacteria 54468
120 Ga0207697_10000704 3300025315 Bacteria 19037
121 Ga0207682_10001891 3300025893 Bacteria 9509
122 Ga0207682_10022107 3300025893 Unclassified 2504
123 Ga0207642_10015478 3300025899 Bacteria 2843
124 Ga0207688_10001036 3300025901 Bacteria 14244
125 Ga0207685_10021141 3300025905 Bacteria 2176
126 Ga0207699_10007897 3300025906 Bacteria 5220
127 Ga0207699_10045556 3300025906 Bacteria 2561
128 Ga0207645_10003443 3300025907 Bacteria 12023
129 Ga0207645_10035715 3300025907 Unclassified 3190
130 Ga0207643_10015350 3300025908 Bacteria 4169
131 Ga0207684_10011362 3300025910 Bacteria 7793
132 Ga0207707_10031577 3300025912 Bacteria 4635
133 Ga0207707_10066256 3300025912 Bacteria 3145
134 Ga0207707_10159815 3300025912 Bacteria 1970
135 Ga0207695_10013810 3300025913 Bacteria 9609
136 Ga0207693_10000981 3300025915 Bacteria 25583
137 Ga0207693_10003605 3300025915 Bacteria 13222
138 Ga0207663_10018576 3300025916 Bacteria 3900
139 Ga0207663_10025751 3300025916 Bacteria 3406
140 Ga0207663_10045911 3300025916 Bacteria 2689
141 Ga0207660_10071539 3300025917 Bacteria 2524
142 Ga0207660_10091096 3300025917 Bacteria 2260
143 Ga0207662_10020087 3300025918 Unclassified 3810
144 Ga0207649_10115339 3300025920 Bacteria 1802
145 Ga0207652_10143993 3300025921 Bacteria 2132
146 Ga0207681_10017699 3300025923 Bacteria 4479
147 Ga0207681_10027824 3300025923 Bacteria 3659
148 Ga0207681_10104164 3300025923 Bacteria 2052
149 Ga0207650_10007824 3300025925 Bacteria 7280
150 Ga0207650_10042689 3300025925 Bacteria 3327
151 Ga0207650_10111004 3300025925 Bacteria 2123
152 Ga0207659_10009263 3300025926 Bacteria 6148
153 Ga0207659_10124917 3300025926 Unclassified 1977
154 Ga0207659_10130840 3300025926 Bacteria 1936
155 Ga0207700_10001101 3300025928 Bacteria 15581
156 Ga0207644_10046822 3300025931 Unclassified 3083
157 Ga0207644_10081554 3300025931 Bacteria 2391
158 Ga0207706_10006185 3300025933 Bacteria 11117
159 Ga0207686_10007792 3300025934 Bacteria 5773
160 Ga0207704_10026907 3300025938 Bacteria 3162
161 Ga0207691_10001298 3300025940 Bacteria 24940
162 Ga0207689_10095614 3300025942 Unclassified 2440
163 Ga0207661_10000611 3300025944 Bacteria 22884
164 Ga0207661_10008857 3300025944 Bacteria 7203
165 Ga0207661_10029761 3300025944 Bacteria 4197
166 Ga0207679_10006588 3300025945 Bacteria 7343
167 Ga0207651_10152141 3300025960 Bacteria 1802
168 Ga0207640_10063544 3300025981 Bacteria 2454
169 Ga0207677_10044732 3300026023 Unclassified 2952
170 Ga0207678_10090731 3300026067 Bacteria 2612
171 Ga0207678_10091881 3300026067 Bacteria 2594
172 Ga0207708_10054689 3300026075 Bacteria 3044
173 Ga0207708_10071036 3300026075 Bacteria 2666
174 Ga0207641_10030319 3300026088 Bacteria 4480
175 Ga0207648_10020731 3300026089 Bacteria 5917
176 Ga0207648_10040753 3300026089 Bacteria 4080
177 Ga0207675_100083481 3300026118 Bacteria 2996
178 Ga0207683_10035838 3300026121 Bacteria 4315
179 Ga0207428_10005162 3300027907 Bacteria 12226
180 Ga0268266_10210597 3300028379 Unclassified 1782
181 Ga0265339_10020719 3300031249 Bacteria 3837
182 Ga0307510_10102788 3300033180 Bacteria 2638
183 Ga0373926_0034856 3300035083 Bacteria 1783
184 Ga0373944_0003257 3300035089 Bacteria 4175
185 Ga0373923_0005576 3300035111 Bacteria 4282
186 Ga0373923_0009420 3300035111 Bacteria 3524
187 Ga0373936_0013462 3300035113 Bacteria 3121
188 Ga0373945_0011646 3300035116 Bacteria 2910
189 Ga0373953_0011562 3300035117 Bacteria 3102
190 Ga0373954_0004249 3300035118 Bacteria 6155
191 Ga0373954_0007749 3300035118 Bacteria 4698
192 Ga0373954_0016520 3300035118 Bacteria 3304
193 Ga0373957_0018479 3300035120 Bacteria 2443
194 Ga0373946_0018946 3300035171 Bacteria 2647
195 Ga0373955_0052773 3300035172 Bacteria 2218
196 Ga0373961_0017268 3300035241 Unclassified 1870
197 Ga0373924_0009347 3300035410 Bacteria 3588
198 Ga0373935_0109655 3300035692 Bacteria 1830
199 Ga0373927_0047709 3300035695 Bacteria 2770
200 Ga0373927_0049501 3300035695 Bacteria 2717
201 Ga0373927_0083159 3300035695 Bacteria 2075
202 Ga0373933_0000112 3300035724 Bacteria 52335
203 Ga0373933_0005334 3300035724 Bacteria 7007
204 Ga0373933_0029768 3300035724 Bacteria 3159
205 Ga0373933_0046488 3300035724 Bacteria 2578
206 Ga0373947_0167871 3300035725 Bacteria 1422
207 Ga0373937_0127877 3300036401 Bacteria 2371
208 Ga0373925_0066497 3300037068 Bacteria 2717
209 Ga0395900_0024542 3300037418 Bacteria 6173
210 Ga0395898_0002167 3300037466 Bacteria 24071
211 Ga0436364_1275667 3300037853 Bacteria 64182
212 Ga0395901_0400993 3300038443 Bacteria 1409
213 Ga0436365_0145660 3300039437 Bacteria 3075
214 Ga0436365_0246887 3300039437 Bacteria 2345
215 Ga0436360_0575966 3300039438 Bacteria 2278
216 Ga0436361_0512853 3300039447 Bacteria 4318
217 Ga0436361_1196342 3300039447 Bacteria 1474
218 Ga0436363_0874970 3300039450 Bacteria 2045
219 Ga0436362_0413346 3300039453 Bacteria 2480
220 Ga0466970_0024945 3300044765 Bacteria 3129
221 Ga0451576_0219055 3300045051 Bacteria 1987
222 Ga0495603_0028240 3300046455 Bacteria 3384
223 Ga0495629_0088571 3300046459 Bacteria 2159
224 Ga0495651_0038189 3300046462 Bacteria 3739
225 Ga0495651_0077208 3300046462 Bacteria 2521
226 Ga0495651_0096570 3300046462 Bacteria 2208
227 Ga0495653_0014793 3300046463 Bacteria 6364
228 Ga0495580_0015549 3300046472 Bacteria 5735
229 Ga0495582_0040774 3300046473 Bacteria 2558
230 Ga0495582_0066620 3300046473 Bacteria 1990
231 Ga0495639_0002360 3300046475 Bacteria 8252
232 Ga0495639_0003671 3300046475 Bacteria 6613
233 Ga0495662_0051816 3300046476 Bacteria 1981
234 Ga0495664_0003190 3300046477 Bacteria 8902
235 Ga0495664_0003515 3300046477 Bacteria 8538
236 Ga0495664_0026876 3300046477 Bacteria 3353
237 Ga0495585_0005373 3300046492 Bacteria 8085
238 Ga0495583_0030806 3300046506 Bacteria 2608
239 Ga0495606_0038894 3300046507 Bacteria 3213
240 Ga0495608_0019420 3300046511 Bacteria 4676
241 Ga0495608_0062065 3300046511 Bacteria 2456
242 Ga0495618_0004519 3300046514 Bacteria 8548
243 Ga0495618_0104830 3300046514 Bacteria 1810
244 Ga0495618_0108909 3300046514 Bacteria 1774
245 Ga0495628_0042015 3300046516 Bacteria 3648
246 Ga0495628_0081736 3300046516 Bacteria 2509
247 Ga0495630_0031501 3300046517 Bacteria 3948
248 Ga0495630_0198979 3300046517 Bacteria 1529
249 Ga0495644_0004221 3300046523 Bacteria 5643
250 Ga0495648_0034094 3300046524 Bacteria 3318
251 Ga0495666_0001821 3300046526 Bacteria 10527
252 Ga0495652_0051556 3300046529 Bacteria 3513
253 Ga0495652_0071284 3300046529 Bacteria 2901
254 Ga0495652_0073170 3300046529 Bacteria 2855
255 Ga0495652_0098031 3300046529 Bacteria 2383
256 Ga0495665_0021938 3300046531 Bacteria 3433
257 Ga0495640_0020257 3300046533 Bacteria 4898
258 Ga0495640_0026061 3300046533 Bacteria 4231
259 Ga0495586_0048617 3300046535 Bacteria 2292
260 Ga0495645_0006341 3300046543 Bacteria 8207
261 Ga0495645_0017760 3300046543 Bacteria 5102
262 Ga0495645_0061615 3300046543 Bacteria 2718
263 Ga0495645_0109379 3300046543 Bacteria 1957
264 Ga0495622_0029254 3300046557 Bacteria 2574
265 Ga0495622_0030483 3300046557 Bacteria 2520
266 Ga0495633_0004226 3300046558 Bacteria 9197
267 Ga0495667_0001706 3300046559 Bacteria 14586
268 Ga0495667_0010335 3300046559 Bacteria 6314
269 Ga0495656_0006220 3300046615 Bacteria 4177
270 Ga0495635_0055638 3300046663 Bacteria 2725
271 Ga0495659_0003611 3300046664 Bacteria 4920
272 Ga0495661_0039376 3300046665 Bacteria 2938
273 Ga0495588_0015139 3300046674 Bacteria 3705
274 Ga0495657_0018508 3300046675 Bacteria 5036
275 Ga0495657_0103156 3300046675 Bacteria 1815
276 Ga0495599_0007326 3300046678 Bacteria 6688
277 Ga0495599_0052309 3300046678 Bacteria 2558
278 Ga0495623_0023192 3300046679 Bacteria 4005
279 Ga0495646_0059429 3300046680 Bacteria 2283
280 Ga0495647_0003225 3300046681 Bacteria 5220
281 Ga0495658_0003757 3300046683 Bacteria 7513
282 Ga0495613_0020002 3300046689 Bacteria 4989
283 Ga0495613_0024319 3300046689 Bacteria 4512
284 Ga0495624_0036024 3300046690 Bacteria 3192
285 Ga0495624_0058421 3300046690 Bacteria 2422
286 Ga0495624_0116461 3300046690 Bacteria 1642
287 Ga0495670_0000539 3300046691 Bacteria 18006
288 Ga0495600_0012381 3300046809 Bacteria 5331
289 Ga0495600_0015716 3300046809 Bacteria 4791
290 Ga0495600_0064928 3300046809 Bacteria 2386
291 Ga0495581_0043072 3300047315 Bacteria 2612
292 Ga0495581_0059166 3300047315 Bacteria 2214
293 Ga0495604_0019108 3300047317 Bacteria 5486
294 Ga0495604_0101550 3300047317 Bacteria 2112
295 Ga0495674_0191313 3300047319 Bacteria 1700
296 Ga0495676_0060925 3300047321 Bacteria 2954
297 Ga0495676_0108436 3300047321 Bacteria 2042
298 Ga0495680_0013119 3300047322 Bacteria 7241
299 Ga0495680_0026793 3300047322 Bacteria 4746
300 Ga0495675_0078260 3300047444 Bacteria 2082
301 Ga0495673_0068053 3300047469 Bacteria 1506
302 Ga0495684_0002578 3300047471 Bacteria 14408
303 Ga0495684_0152117 3300047471 Bacteria 1729
304 Ga0495686_0102223 3300047472 Bacteria 1727
305 Ga0495593_0022513 3300047673 Bacteria 3510
306 Ga0495602_0017697 3300048088 Bacteria 7138
307 Ga0495602_0032079 3300048088 Bacteria 4953
308 Ga0495602_0101933 3300048088 Bacteria 2353
309 Ga0496102_0013425 3300048905 Bacteria 7094
310 Ga0496102_0088104 3300048905 Bacteria 2869
311 Ga0496104_0000660 3300048907 Bacteria 29613
312 Ga0496104_0003387 3300048907 Bacteria 13766
313 Ga0496104_0005581 3300048907 Bacteria 11015
314 Ga0496104_0011657 3300048907 Bacteria 7881
315 Ga0496105_0002175 3300048908 Bacteria 14199
316 Ga0496105_0003503 3300048908 Bacteria 11628
317 Ga0496105_0028271 3300048908 Bacteria 4586
318 Ga0496106_0083127 3300048909 Bacteria 2462
319 Ga0496106_0148709 3300048909 Bacteria 1847
320 Ga0496107_0038117 3300048910 Bacteria 3449
321 Ga0496108_0004851 3300048911 Bacteria 10857
322 Ga0496109_0013590 3300048912 Bacteria 7069
323 Ga0496109_0052251 3300048912 Unclassified 3724
324 Ga0496109_0139034 3300048912 Bacteria 2270
325 Ga0496110_0003951 3300048913 Bacteria 11402
326 Ga0496110_0310287 3300048913 Unclassified 1437
327 Ga0496111_0007708 3300048914 Bacteria 7080
328 Ga0496112_0018005 3300048915 Bacteria 6648
329 Ga0496112_0087988 3300048915 Bacteria 3074
330 Ga0496113_0010564 3300048916 Bacteria 6109
331 Ga0496113_0081547 3300048916 Bacteria 2480
332 Ga0496115_0017341 3300048918 Bacteria 5503
333 Ga0496119_0009594 3300048922 Bacteria 8264
334 Ga0496121_0039030 3300048924 Bacteria 4192
335 Ga0496121_0107969 3300048924 Bacteria 2130
336 Ga0496125_0048945 3300048928 Bacteria 3518
337 Ga0496126_0058392 3300048929 Bacteria 3478
338 Ga0496126_0099264 3300048929 Bacteria 2550
339 Ga0495682_0010228 3300049460 Bacteria 3642
340 Ga0501046_0064012 3300049580 Bacteria 2871
341 Ga0501047_0121279 3300049581 Bacteria 2496
342 Ga0501070_0006237 3300049586 Bacteria 10149
343 Ga0501074_0025299 3300049590 Bacteria 4312
344 Ga0501080_0032567 3300049742 Bacteria 4862
345 Ga0501044_0031657 3300049823 Bacteria 5565
346 nmdc:mga0yw44_43270_c1 3300050492 Bacteria 2688
347 nmdc:mga09592_174404_c1 3300050508 Bacteria 1860
348 nmdc:mga09592_67101_c1 3300050508 Unclassified 3042
349 nmdc:mga0qj67_37230_c1 3300050509 Unclassified 3810
350 nmdc:mga06r32_11961_c1 3300050510 Bacteria 7822
351 nmdc:mga06r32_230101_c1 3300050510 Bacteria 1842
352 nmdc:mga0n895_128087_c1 3300050512 Bacteria 2563
353 nmdc:mga0n895_143518_c1 3300050512 Bacteria 2417
354 nmdc:mga0n895_165177_c1 3300050512 Bacteria 2245
355 nmdc:mga0n895_221917_c1 3300050512 Bacteria 1919
356 nmdc:mga0n895_3505_c1 3300050512 Bacteria 12669
357 nmdc:mga08x19_8384_c1 3300050514 Bacteria 6157
358 nmdc:mga0a205_162294_c1 3300050515 Bacteria 2131
359 nmdc:mga0a205_38218_c1 3300050515 Bacteria 4617
360 nmdc:mga0a205_8668_c1 3300050515 Bacteria 8615
361 Ga0495601_0009036 3300053077 Bacteria 5884
362 Ga0495612_0013307 3300053078 Bacteria 3314
363 Ga0495612_0018515 3300053078 Bacteria 2788
364 Ga0495612_0022687 3300053078 Bacteria 2515
365 Ga0495619_0017674 3300053085 Bacteria 4517
366 Ga0495619_0065864 3300053085 Bacteria 2418
367 Ga0495619_0112913 3300053085 Bacteria 1858
368 Ga0495619_0150622 3300053085 Bacteria 1605
369 Ga0500643_000057 3300053087 Bacteria 131401
370 Ga0500643_027610 3300053087 Bacteria 1763
371 Ga0500644_0000660 3300053088 Bacteria 12703
372 Ga0500566_0000077 3300053094 Bacteria 48099
373 Ga0500640_000705 3300053095 Bacteria 8914
374 Ga0500555_001035 3300053103 Bacteria 9379
375 Ga0500556_0009188 3300053104 Bacteria 2867
376 Ga0500572_000049 3300053111 Bacteria 36078
377 Ga0500572_001678 3300053111 Bacteria 5783
378 Ga0500595_000083 3300053119 Bacteria 66474
379 Ga0500607_041634 3300053121 Bacteria 2483
380 Ga0500608_018816 3300053122 Bacteria 3158
381 Ga0500642_0020924 3300053130 Bacteria 2581
382 Ga0500658_0022666 3300053134 Bacteria 2391
383 Ga0500559_0000246 3300053136 Bacteria 42730
384 Ga0500559_0033715 3300053136 Bacteria 2205
385 Ga0500568_0039667 3300053139 Bacteria 1899
386 Ga0500603_000053 3300053150 Bacteria 28532
387 Ga0500616_0000006 3300053153 Bacteria 944738
388 Ga0500616_0005579 3300053153 Bacteria 8507
389 Ga0500616_0027029 3300053153 Bacteria 3171
390 Ga0500622_0014922 3300053156 Bacteria 4164
391 Ga0500624_008758 3300053157 Bacteria 1424
392 Ga0500630_000158 3300053159 Bacteria 24806
393 Ga0500639_000171 3300053163 Bacteria 31550
394 Ga0500636_0000211 3300053177 Bacteria 31679
395 Ga0500576_042752 3300053725 Bacteria 2035
396 Ga0500645_001220 3300053730 Bacteria 13575
397 Ga0500596_000216 3300053735 Bacteria 9735
398 Ga0500596_000526 3300053735 Bacteria 7227
399 Ga0500599_003094 3300053736 Bacteria 2020
400 Ga0500601_000042 3300053737 Bacteria 25824
401 2509152118 2508501128 Bacteria 8613869
402 2511398514 2511231028 Bacteria 8046582
403 2513888300 2513237141 Bacteria 8496279
404 2528849128 2528768022 Bacteria 10457665
405 2824666738 2824661429 Bacteria 9877870
406 2824707430 2824704595 Bacteria 9667483
407 2824754616 2824753945 Bacteria 9787441
408 2824765338 2824763712 Bacteria 9792355
409 2879108945 2879099564 Bacteria 10442239
410 2904719375 2904711408 Bacteria 9771557
411 2922371038
412 2932785737 2932784394 Bacteria 9704911
413 2932813673 2932809354 Bacteria 9135765
414 2932822359 2932818245 Bacteria 9955613
415 2932830801 2932828146 Bacteria 9745859
416 2935620846 2935616580 Bacteria 9032984
417 2935639927 2935638405 Bacteria 10015038
418 2935667219 2935665750 Bacteria 9571747
419 2935677700 2935675223 Bacteria 9928132
420 2935690361 2935684952 Bacteria 9590419
421 2935697316 2935694250 Bacteria 9291695
422 2935704975 2935703347 Bacteria 10242284
423 2935717943 2935713505 Bacteria 9608509
424 2935726907 2935722832 Bacteria 9608746
425 2935735677 2935732158 Bacteria 9706831
426 2935745052 2935741537 Bacteria 9707219
427 2935755371 2935750917 Bacteria 9590372
428 2935762123 2935760218 Bacteria 9817913
429 2935803623 2935801545 Bacteria 9301974
430 2935811541 2935810662 Bacteria 9401221
431 2935829410 2935827899 Bacteria 10038562
432 2935842612 2935837841 Bacteria 9454360
433 2935858654 2935855204 Bacteria 9035059
434 2935866924 2935864058 Bacteria 9784707
435 2935877055 2935873716 Bacteria 9632195
436 2935961913 2935959822 Bacteria 7869783
437 2935995311 2935992306 Bacteria 9802711
438 2936004198 2936002035 Bacteria 9362176
439 2936038123 2936037263 Bacteria 9446081
440 2940561348 2940556831 Bacteria 9590747
441 2941544541 2941538514 Bacteria 9402094
442 3005712472 3005710791 Bacteria 7622528
443 8016516598 8016511872 Bacteria 9921665
444 8017059951 8017057580 Bacteria 10023680
445 8019604177 8019597564 Bacteria 10041141
446 8019614351 8019608314 Bacteria 10042931
447 Ga0070669_100023958
448 rootH2_10091471
449 rootH1_10311004
450 JGI25160J50197_1002045
451 Ga0065715_10090481
452 Ga0070683_100002390
453 Ga0070683_100047889
454 Ga0070690_100003577
455 Ga0070670_100023901
456 Ga0070670_100031443
457 Ga0070670_100091062
458 Ga0070677_10000820
459 Ga0070677_10028029
460 Ga0068869_100000741
461 Ga0070666_10003920
462 Ga0070680_100117018
463 Ga0068868_100010978
464 Ga0070689_100044996
465 Ga0070668_100037358
466 Ga0070669_100006451
467 Ga0070669_100060361
468 Ga0070669_100071497
469 Ga0070671_100052372
470 Ga0070671_100138122
471 Ga0070671_100151381
472 Ga0070688_100086571
473 Ga0070659_100096945
474 Ga0070709_10006358
475 Ga0070714_100059325
476 Ga0070714_100060737
477 Ga0070714_100120725
478 Ga0070714_100189596
479 Ga0070713_100028770
480 Ga0070710_10058320
481 Ga0070701_10022044
482 Ga0070711_100025517
483 Ga0070705_100000627
484 Ga0070700_100062813
485 Ga0070694_100022821
486 Ga0070708_100036287
487 Ga0070663_100022332
488 Ga0070663_100028390
489 Ga0070662_100053551
490 Ga0070681_10027061
491 Ga0070681_10140666
492 Ga0068867_100010386
493 Ga0070706_100019185
494 Ga0070707_100275129
495 Ga0070698_100008888
496 Ga0070698_100128973
497 Ga0070699_100021139
498 Ga0070679_100157521
499 Ga0070679_100218730
500 Ga0070684_100008533
501 Ga0070684_100066459
502 Ga0070684_100116409
503 Ga0070697_100031777
504 Ga0070686_100004648
505 Ga0070695_100001243
506 Ga0070696_100002835
507 Ga0070665_100064837
508 Ga0070704_100012178
509 Ga0070664_100006688
510 Ga0070664_100014633
511 Ga0068857_100026811
512 Ga0068857_100049929
513 Ga0068857_100134581
514 Ga0070702_100011807
515 Ga0068861_100095376
516 Ga0068870_10054709
517 Ga0068863_100192475
518 Ga0068858_100174196
519 Ga0068860_100010622
520 Ga0068862_100021169
521 Ga0068862_100107571
522 Ga0070717_10000296
523 Ga0070717_10020773
524 Ga0075365_10031913
525 Ga0070716_100015381
526 Ga0070716_100047774
527 Ga0070712_100009492
528 Ga0070712_100009886
529 Ga0070712_100021949
530 Ga0075369_10031480
531 Ga0068871_100024711
532 Ga0075430_100064077
533 Ga0075431_100017408
534 Ga0075431_100085882
535 Ga0075433_10001806
536 Ga0075433_10072869
537 Ga0075433_10181980
538 Ga0075434_100000830
539 Ga0075434_100020530
540 Ga0075429_100011476
541 Ga0075429_100142940
542 Ga0105240_10009685
543 Ga0114129_10150796
544 Ga0105241_10032253
545 Ga0105248_10244951
546 Ga0105237_10049103
547 Ga0105237_10161858
548 Ga0105238_10001003
549 Ga0105238_10050651
550 Ga0105249_10000858
551 Ga0157370_10027209
552 Ga0157369_10002124
553 Ga0157369_10003530
554 Ga0157369_10004766
555 Ga0163162_10013347
556 Ga0157372_10092834
557 Ga0163163_10040035
558 Ga0163163_10106655
559 Ga0157380_10007744
560 Ga0157380_10021159
561 Ga0157380_10060858
562 Ga0157379_10026651
563 Ga0213872_10010539
564 Ga0213875_10000012
565 Ga0207426_1000534
566 Ga0207697_10000704
567 Ga0207682_10001891
568 Ga0207682_10022107
569 Ga0207642_10015478
570 Ga0207688_10001036
571 Ga0207685_10021141
572 Ga0207699_10007897
573 Ga0207699_10045556
574 Ga0207645_10003443
575 Ga0207645_10035715
576 Ga0207643_10015350
577 Ga0207684_10011362
578 Ga0207707_10031577
579 Ga0207707_10066256
580 Ga0207707_10159815
581 Ga0207695_10013810
582 Ga0207693_10000981
583 Ga0207693_10003605
584 Ga0207663_10018576
585 Ga0207663_10025751
586 Ga0207663_10045911
587 Ga0207660_10071539
588 Ga0207660_10091096
589 Ga0207662_10020087
590 Ga0207649_10115339
591 Ga0207652_10143993
592 Ga0207681_10017699
593 Ga0207681_10027824
594 Ga0207681_10104164
595 Ga0207650_10007824
596 Ga0207650_10042689
597 Ga0207650_10111004
598 Ga0207659_10009263
599 Ga0207659_10124917
600 Ga0207659_10130840
601 Ga0207700_10001101
602 Ga0207644_10046822
603 Ga0207644_10081554
604 Ga0207706_10006185
605 Ga0207686_10007792
606 Ga0207704_10026907
607 Ga0207691_10001298
608 Ga0207689_10095614
609 Ga0207661_10000611
610 Ga0207661_10008857
611 Ga0207661_10029761
612 Ga0207679_10006588
613 Ga0207651_10152141
614 Ga0207640_10063544
615 Ga0207677_10044732
616 Ga0207678_10090731
617 Ga0207678_10091881
618 Ga0207708_10054689
619 Ga0207708_10071036
620 Ga0207641_10030319
621 Ga0207648_10020731
622 Ga0207648_10040753
623 Ga0207675_100083481
624 Ga0207683_10035838
625 Ga0207428_10005162
626 Ga0268266_10210597
627 Ga0265339_10020719
628 Ga0307510_10102788
629 Ga0373926_0034856
630 Ga0373944_0003257
631 Ga0373923_0005576
632 Ga0373923_0009420
633 Ga0373936_0013462
634 Ga0373945_0011646
635 Ga0373953_0011562
636 Ga0373954_0004249
637 Ga0373954_0007749
638 Ga0373954_0016520
639 Ga0373957_0018479
640 Ga0373946_0018946
641 Ga0373955_0052773
642 Ga0373961_0017268
643 Ga0373924_0009347
644 Ga0373935_0109655
645 Ga0373927_0047709
646 Ga0373927_0049501
647 Ga0373927_0083159
648 Ga0373933_0000112
649 Ga0373933_0005334
650 Ga0373933_0029768
651 Ga0373933_0046488
652 Ga0373947_0167871
653 Ga0373937_0127877
654 Ga0373925_0066497
655 Ga0395900_0024542
656 Ga0395898_0002167
657 Ga0436364_1275667
658 Ga0395901_0400993
659 Ga0436365_0145660
660 Ga0436365_0246887
661 Ga0436360_0575966
662 Ga0436361_0512853
663 Ga0436361_1196342
664 Ga0436363_0874970
665 Ga0436362_0413346
666 Ga0466970_0024945
667 Ga0451576_0219055
668 Ga0495603_0028240
669 Ga0495629_0088571
670 Ga0495651_0038189
671 Ga0495651_0077208
672 Ga0495651_0096570
673 Ga0495653_0014793
674 Ga0495580_0015549
675 Ga0495582_0040774
676 Ga0495582_0066620
677 Ga0495639_0002360
678 Ga0495639_0003671
679 Ga0495662_0051816
680 Ga0495664_0003190
681 Ga0495664_0003515
682 Ga0495664_0026876
683 Ga0495585_0005373
684 Ga0495583_0030806
685 Ga0495606_0038894
686 Ga0495608_0019420
687 Ga0495608_0062065
688 Ga0495618_0004519
689 Ga0495618_0104830
690 Ga0495618_0108909
691 Ga0495628_0042015
692 Ga0495628_0081736
693 Ga0495630_0031501
694 Ga0495630_0198979
695 Ga0495644_0004221
696 Ga0495648_0034094
697 Ga0495666_0001821
698 Ga0495652_0051556
699 Ga0495652_0071284
700 Ga0495652_0073170
701 Ga0495652_0098031
702 Ga0495665_0021938
703 Ga0495640_0020257
704 Ga0495640_0026061
705 Ga0495586_0048617
706 Ga0495645_0006341
707 Ga0495645_0017760
708 Ga0495645_0061615
709 Ga0495645_0109379
710 Ga0495622_0029254
711 Ga0495622_0030483
712 Ga0495633_0004226
713 Ga0495667_0001706
714 Ga0495667_0010335
715 Ga0495656_0006220
716 Ga0495635_0055638
717 Ga0495659_0003611
718 Ga0495661_0039376
719 Ga0495588_0015139
720 Ga0495657_0018508
721 Ga0495657_0103156
722 Ga0495599_0007326
723 Ga0495599_0052309
724 Ga0495623_0023192
725 Ga0495646_0059429
726 Ga0495647_0003225
727 Ga0495658_0003757
728 Ga0495613_0020002
729 Ga0495613_0024319
730 Ga0495624_0036024
731 Ga0495624_0058421
732 Ga0495624_0116461
733 Ga0495670_0000539
734 Ga0495600_0012381
735 Ga0495600_0015716
736 Ga0495600_0064928
737 Ga0495581_0043072
738 Ga0495581_0059166
739 Ga0495604_0019108
740 Ga0495604_0101550
741 Ga0495674_0191313
742 Ga0495676_0060925
743 Ga0495676_0108436
744 Ga0495680_0013119
745 Ga0495680_0026793
746 Ga0495675_0078260
747 Ga0495673_0068053
748 Ga0495684_0002578
749 Ga0495684_0152117
750 Ga0495686_0102223
751 Ga0495593_0022513
752 Ga0495602_0017697
753 Ga0495602_0032079
754 Ga0495602_0101933
755 Ga0496102_0013425
756 Ga0496102_0088104
757 Ga0496104_0000660
758 Ga0496104_0003387
759 Ga0496104_0005581
760 Ga0496104_0011657
761 Ga0496105_0002175
762 Ga0496105_0003503
763 Ga0496105_0028271
764 Ga0496106_0083127
765 Ga0496106_0148709
766 Ga0496107_0038117
767 Ga0496108_0004851
768 Ga0496109_0013590
769 Ga0496109_0052251
770 Ga0496109_0139034
771 Ga0496110_0003951
772 Ga0496110_0310287
773 Ga0496111_0007708
774 Ga0496112_0018005
775 Ga0496112_0087988
776 Ga0496113_0010564
777 Ga0496113_0081547
778 Ga0496115_0017341
779 Ga0496119_0009594
780 Ga0496121_0039030
781 Ga0496121_0107969
782 Ga0496125_0048945
783 Ga0496126_0058392
784 Ga0496126_0099264
785 Ga0495682_0010228
786 Ga0501046_0064012
787 Ga0501047_0121279
788 Ga0501070_0006237
789 Ga0501074_0025299
790 Ga0501080_0032567
791 Ga0501044_0031657
792 nmdc:mga0yw44_43270_c1
793 nmdc:mga09592_174404_c1
794 nmdc:mga09592_67101_c1
795 nmdc:mga0qj67_37230_c1
796 nmdc:mga06r32_11961_c1
797 nmdc:mga06r32_230101_c1
798 nmdc:mga0n895_128087_c1
799 nmdc:mga0n895_143518_c1
800 nmdc:mga0n895_165177_c1
801 nmdc:mga0n895_221917_c1
802 nmdc:mga0n895_3505_c1
803 nmdc:mga08x19_8384_c1
804 nmdc:mga0a205_162294_c1
805 nmdc:mga0a205_38218_c1
806 nmdc:mga0a205_8668_c1
807 Ga0495601_0009036
808 Ga0495612_0013307
809 Ga0495612_0018515
810 Ga0495612_0022687
811 Ga0495619_0017674
812 Ga0495619_0065864
813 Ga0495619_0112913
814 Ga0495619_0150622
815 Ga0500643_000057
816 Ga0500643_027610
817 Ga0500644_0000660
818 Ga0500566_0000077
819 Ga0500640_000705
820 Ga0500555_001035
821 Ga0500556_0009188
822 Ga0500572_000049
823 Ga0500572_001678
824 Ga0500595_000083
825 Ga0500607_041634
826 Ga0500608_018816
827 Ga0500642_0020924
828 Ga0500658_0022666
829 Ga0500559_0000246
830 Ga0500559_0033715
831 Ga0500568_0039667
832 Ga0500603_000053
833 Ga0500616_0000006
834 Ga0500616_0005579
835 Ga0500616_0027029
836 Ga0500622_0014922
837 Ga0500624_008758
838 Ga0500630_000158
839 Ga0500639_000171
840 Ga0500636_0000211
841 Ga0500576_042752
842 Ga0500645_001220
843 Ga0500596_000216
844 Ga0500596_000526
845 Ga0500599_003094
846 Ga0500601_000042
847 2509152118
848 2511398514
849 2513888300
850 2528849128
851 2824666738
852 2824707430
853 2824754616
854 2824765338
855 2879108945
856 2904719375
857 2922371038
858 2932785737
859 2932813673
860 2932822359
861 2932830801
862 2935620846
863 2935639927
864 2935667219
865 2935677700
866 2935690361
867 2935697316
868 2935704975
869 2935717943
870 2935726907
871 2935735677
872 2935745052
873 2935755371
874 2935762123
875 2935803623
876 2935811541
877 2935829410
878 2935842612
879 2935858654
880 2935866924
881 2935877055
882 2935961913
883 2935995311
884 2936004198
885 2936038123
886 2940561348
887 2941544541
888 3005712472
889 8016516598
890 8017059951
891 8019604177
892 8019614351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03972

MmgE_PrpD_N

MmgE/PrpD N-terminal domain

42

270

0.95

PF19305

MmgE_PrpD_C

MmgE/PrpD C-terminal domain

289

454

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.8759 42 483
2hp0-assembly1.cif.gz_A crystal structure of iminodisuccinate epimerase 0.8648 42 483
6r6t-assembly1.cif.gz_B crystal structure of mouse cis-aconitate decarboxylase 0.8269 41 486
7bra-assembly1.cif.gz_B bacillus subtilis irg1 0.8213 42 486
7e9d-assembly1.cif.gz_B h102a mutant of irg1 from bacillus 0.8211 42 486
ID Description Score Start End Superfamily
2hp3B01 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.9168 42 303 1.10.4100.10
1szqB02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.8281 309 433 3.30.1330.120
af_A0A2R8RL39_271_404_1.10.4100.10 Mainly Alpha;Orthogonal Bundle;2-methylcitrate dehydratase PrpD;2-methylcitrate dehydratase PrpD 0.817 314 435 1.10.4100.10
2hp0B02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;2-methylcitrate dehydratase PrpD 0.7875 313 435 3.30.1330.120
af_D3Z1Y0_37_126_2.60.40.60 Mainly Beta;Sandwich;Immunoglobulin-like;Cadherins 0.7847 412 430 2.60.40.60
ID Description Score Start End GO Terms
AF-A0A537TDI6-F1-model_v4 MmgE/PrpD family protein 0.9772 43 489 GO:0016829
AF-C0IN98-F1-model_v4 MmgE/PrpD C-terminal domain-containing protein 0.9739 291 489 GO:0016829
AF-A0A537TDI6-F1-model_v4 MmgE/PrpD family protein 0.9729 43 489 GO:0016829
AF-A0A6A0JX67-F1-model_v4 MmgE/PrpD family protein 0.9646 137 486 GO:0016829
AF-C0IN98-F1-model_v4 MmgE/PrpD C-terminal domain-containing protein 0.9644 291 489 GO:0016829

Map