F445624

General Info

Members Datasets Scaffolds Average Seq Length
445 268 890 134

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0336468|Ga0501084_0336468_342_896
Length 166
Sequence VADRFAYECALRWSDMDAYGHVNNARFLTLYEEARVALMFVGARSRGLTSFEDGVVIVRHEIDYLRPVDYDTGAADGGATPRVRIELWVAEVGAARFTIGYELFDRGELASRARSVLVPVDLPTGRPRRLTTAERAFLRAYSIVAAHDGGQARHAPPSPDGGTVVR

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
137 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
168 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
169 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
170 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
218 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
221 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
222 2501939600 Micromonospora sp. L5 Isolate Unclassified
223 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
224 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
225 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
226 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
227 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
228 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
229 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
230 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
231 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
232 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
233 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
234 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
235 2855683550 Micromonospora sp. RP3T Isolate Unclassified
236 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
237 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
238 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
239 2858868258 Micromonospora sp. MH33 Isolate Unclassified
240 2858882152 Micromonospora noduli MED15 Isolate Nodule
241 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
242 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
243 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
244 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
245 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
246 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
247 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
248 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
249 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
250 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
251 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
252 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
253 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
254 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
255 2902582711 Micromonospora sp. AP08 Isolate Unclassified
256 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
257 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
258 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
259 649633069 Micromonospora sp. L5 Isolate Unclassified
260 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
261 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
262 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
263 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
264 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
265 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
266 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
267 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
268 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.99
Metatranscriptomes 0.45
Isolates 10.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 1.35
Rhizoplane 2.47
Rhizosphere 80.22
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0336468 3300054114 Bacteria 1275
2 LJQas_1010809 3300000549 Bacteria 1090
3 JGI25406J46586_10060062 3300003203 Bacteria 1231
4 JGI25404J52841_10063187 3300003659 Bacteria 775
5 Ga0070658_10930786 3300005327 Bacteria 756
6 Ga0070676_10083464 3300005328 Bacteria 1943
7 Ga0070683_100010149 3300005329 Bacteria 8085
8 Ga0070683_100013530 3300005329 Bacteria 7120
9 Ga0070683_100434541 3300005329 Bacteria 1252
10 Ga0070690_101430965 3300005330 Bacteria 557
11 Ga0070670_100251802 3300005331 Bacteria 1539
12 Ga0070670_100392104 3300005331 Bacteria 1225
13 Ga0068869_100119405 3300005334 Bacteria 2015
14 Ga0068869_101728030 3300005334 Bacteria 559
15 Ga0070680_100331420 3300005336 Bacteria 1293
16 Ga0070682_100754841 3300005337 Bacteria 786
17 Ga0070682_100764678 3300005337 Bacteria 781
18 Ga0070682_101535978 3300005337 Bacteria 574
19 Ga0068868_100003717 3300005338 Bacteria 10654
20 Ga0068868_100092354 3300005338 Bacteria 2439
21 Ga0068868_101140818 3300005338 Bacteria 719
22 Ga0070660_100089019 3300005339 Bacteria 2432
23 Ga0070660_100095618 3300005339 Bacteria 2348
24 Ga0070661_100022535 3300005344 Bacteria 4510
25 Ga0070661_101296693 3300005344 Bacteria 611
26 Ga0070692_10164863 3300005345 Bacteria 1272
27 Ga0070692_11091759 3300005345 Bacteria 563
28 Ga0070668_100063232 3300005347 Bacteria 2868
29 Ga0070668_100179275 3300005347 Bacteria 1729
30 Ga0070668_100907657 3300005347 Bacteria 788
31 Ga0070669_100692876 3300005353 Bacteria 860
32 Ga0070675_100005553 3300005354 Bacteria 9655
33 Ga0070671_100648755 3300005355 Bacteria 914
34 Ga0070674_100357161 3300005356 Bacteria 1182
35 Ga0070673_101066276 3300005364 Bacteria 754
36 Ga0070688_100399356 3300005365 Bacteria 1017
37 Ga0070659_100013442 3300005366 Bacteria 6093
38 Ga0070659_100928102 3300005366 Bacteria 762
39 Ga0070667_101598381 3300005367 Bacteria 613
40 Ga0070709_10159953 3300005434 Bacteria 1565
41 Ga0070714_100136967 3300005435 Bacteria 2194
42 Ga0070714_101425677 3300005435 Bacteria 676
43 Ga0070710_10059791 3300005437 Bacteria 2165
44 Ga0070711_100987564 3300005439 Bacteria 722
45 Ga0070700_100532081 3300005441 Bacteria 910
46 Ga0070663_100016647 3300005455 Bacteria 4782
47 Ga0070663_100440791 3300005455 Bacteria 1072
48 Ga0070678_101087912 3300005456 Bacteria 738
49 Ga0070662_100132551 3300005457 Bacteria 1923
50 Ga0070681_10139183 3300005458 Bacteria 2357
51 Ga0068867_100901338 3300005459 Bacteria 796
52 Ga0070679_101114627 3300005530 Bacteria 734
53 Ga0070684_100778581 3300005535 Bacteria 894
54 Ga0070684_101844482 3300005535 Bacteria 571
55 Ga0070697_101597841 3300005536 Bacteria 583
56 Ga0070672_101360053 3300005543 Bacteria 635
57 Ga0070693_100287215 3300005547 Bacteria 1104
58 Ga0070665_100770954 3300005548 Bacteria 975
59 Ga0070665_101573825 3300005548 Bacteria 665
60 Ga0070664_100001575 3300005564 Bacteria 18239
61 Ga0070664_100069352 3300005564 Bacteria 3017
62 Ga0070664_100411518 3300005564 Bacteria 1238
63 Ga0068857_100062474 3300005577 Bacteria 3310
64 Ga0068857_100352802 3300005577 Bacteria 1362
65 Ga0068854_101777902 3300005578 Bacteria 565
66 Ga0068856_100784785 3300005614 Bacteria 972
67 Ga0070702_100075741 3300005615 Bacteria 2001
68 Ga0068852_100908283 3300005616 Bacteria 898
69 Ga0068859_100192509 3300005617 Bacteria 2124
70 Ga0068859_100657748 3300005617 Bacteria 1140
71 Ga0068859_101276153 3300005617 Bacteria 809
72 Ga0068859_101725494 3300005617 Bacteria 692
73 Ga0068864_100045358 3300005618 Bacteria 3771
74 Ga0068864_100197519 3300005618 Bacteria 1846
75 Ga0068864_100433971 3300005618 Bacteria 1254
76 Ga0068864_101195103 3300005618 Bacteria 759
77 Ga0068861_100080726 3300005719 Bacteria 2545
78 Ga0068861_100496959 3300005719 Bacteria 1102
79 Ga0068851_10500038 3300005834 Bacteria 729
80 Ga0068870_10070059 3300005840 Bacteria 1910
81 Ga0068870_10225300 3300005840 Bacteria 1150
82 Ga0068863_100071478 3300005841 Bacteria 3282
83 Ga0068863_100825490 3300005841 Bacteria 925
84 Ga0068863_101088219 3300005841 Bacteria 804
85 Ga0068863_101351513 3300005841 Bacteria 720
86 Ga0068863_101873879 3300005841 Bacteria 610
87 Ga0068858_100032785 3300005842 Bacteria 4825
88 Ga0068858_100070282 3300005842 Bacteria 3245
89 Ga0068858_100224216 3300005842 Bacteria 1781
90 Ga0068860_100865956 3300005843 Bacteria 919
91 Ga0068860_102472989 3300005843 Bacteria 539
92 Ga0068862_100077043 3300005844 Bacteria 2887
93 Ga0068862_100085935 3300005844 Bacteria 2734
94 Ga0068862_100141500 3300005844 Bacteria 2136
95 Ga0081540_1000716 3300005983 Bacteria 30796
96 Ga0081540_1042087 3300005983 Bacteria 2360
97 Ga0081539_10004409 3300005985 Bacteria 15586
98 Ga0081539_10005630 3300005985 Bacteria 12603
99 Ga0081539_10009999 3300005985 Bacteria 7813
100 Ga0070717_11074206 3300006028 Bacteria 733
101 Ga0070716_101476544 3300006173 Bacteria 555
102 Ga0097621_101888763 3300006237 Bacteria 570
103 Ga0068871_101267462 3300006358 Bacteria 693
104 Ga0068871_101422884 3300006358 Bacteria 654
105 Ga0075428_100003789 3300006844 Bacteria 16575
106 Ga0075428_100007646 3300006844 Bacteria 11978
107 Ga0075428_100093171 3300006844 Bacteria 3284
108 Ga0075428_100168479 3300006844 Bacteria 2376
109 Ga0075428_100259906 3300006844 Bacteria 1870
110 Ga0075428_100381183 3300006844 Bacteria 1512
111 Ga0075428_100390344 3300006844 Bacteria 1492
112 Ga0075428_100837787 3300006844 Bacteria 977
113 Ga0075430_100000638 3300006846 Bacteria 26664
114 Ga0075430_100013068 3300006846 Bacteria 7075
115 Ga0075430_100040137 3300006846 Bacteria 3962
116 Ga0075430_100066633 3300006846 Bacteria 3024
117 Ga0075430_100073506 3300006846 Bacteria 2867
118 Ga0075430_100335259 3300006846 Bacteria 1250
119 Ga0075430_100518227 3300006846 Bacteria 984
120 Ga0075431_100002104 3300006847 Bacteria 19025
121 Ga0075431_100029188 3300006847 Bacteria 5674
122 Ga0075431_100220640 3300006847 Bacteria 1934
123 Ga0075431_100390601 3300006847 Bacteria 1394
124 Ga0075431_100778598 3300006847 Bacteria 931
125 Ga0075431_101149879 3300006847 Bacteria 740
126 Ga0075429_100042367 3300006880 Bacteria 3962
127 Ga0075429_100171817 3300006880 Bacteria 1898
128 Ga0075429_100268575 3300006880 Bacteria 1494
129 Ga0068865_100091675 3300006881 Bacteria 2206
130 Ga0097620_100192511 3300006931 Bacteria 2124
131 Ga0097620_100657679 3300006931 Bacteria 1140
132 Ga0097620_101276059 3300006931 Bacteria 809
133 Ga0097620_101725420 3300006931 Bacteria 692
134 Ga0111539_12122460 3300009094 Bacteria 652
135 Ga0105245_10809464 3300009098 Bacteria 975
136 Ga0105245_12573783 3300009098 Bacteria 562
137 Ga0105247_10850655 3300009101 Bacteria 700
138 Ga0114129_10000096 3300009147 Bacteria 85256
139 Ga0114129_10001855 3300009147 Bacteria 28806
140 Ga0114129_10004654 3300009147 Bacteria 19373
141 Ga0114129_10269037 3300009147 Bacteria 2281
142 Ga0114129_10340837 3300009147 Bacteria 1988
143 Ga0114129_10549298 3300009147 Bacteria 1502
144 Ga0114129_11319589 3300009147 Bacteria 893
145 Ga0114129_12144245 3300009147 Bacteria 673
146 Ga0105243_10539058 3300009148 Bacteria 1113
147 Ga0105241_11620441 3300009174 Bacteria 626
148 Ga0105248_10032470 3300009177 Bacteria 5835
149 Ga0105248_10433198 3300009177 Bacteria 1481
150 Ga0105237_11557420 3300009545 Bacteria 668
151 Ga0105237_11694272 3300009545 Bacteria 639
152 Ga0105238_10416414 3300009551 Bacteria 1338
153 Ga0105249_11165207 3300009553 Bacteria 841
154 Ga0105239_10194137 3300010375 Bacteria 2273
155 Ga0105239_10380657 3300010375 Bacteria 1595
156 Ga0105246_10447020 3300011119 Bacteria 1085
157 Ga0105246_11869262 3300011119 Bacteria 576
158 Ga0157338_1072580 3300012515 Bacteria 541
159 Ga0157369_10014560 3300013105 Bacteria 8874
160 Ga0157369_11802505 3300013105 Bacteria 621
161 Ga0157378_10091703 3300013297 Bacteria 2763
162 Ga0157372_11554728 3300013307 Bacteria 762
163 Ga0157372_11836642 3300013307 Bacteria 697
164 Ga0157375_10928049 3300013308 Bacteria 1013
165 Ga0157375_12267707 3300013308 Bacteria 647
166 Ga0163163_10441173 3300014325 Bacteria 1362
167 Ga0163163_10632810 3300014325 Bacteria 1133
168 Ga0163163_11632874 3300014325 Bacteria 705
169 Ga0163163_12417397 3300014325 Bacteria 584
170 Ga0182008_10113336 3300014497 Bacteria 1344
171 Ga0157377_10017446 3300014745 Bacteria 3713
172 Ga0157379_10128648 3300014968 Bacteria 2279
173 Ga0197907_10659800 3300020069 Bacteria 1162
174 Ga0206354_11531957 3300020081 Bacteria 720
175 Ga0207656_10192885 3300025321 Bacteria 982
176 Ga0207692_10912384 3300025898 Bacteria 578
177 Ga0207645_10081735 3300025907 Bacteria 2071
178 Ga0207643_10061886 3300025908 Bacteria 2138
179 Ga0207643_10306317 3300025908 Bacteria 989
180 Ga0207654_10092705 3300025911 Bacteria 1845
181 Ga0207707_10793730 3300025912 Bacteria 789
182 Ga0207671_10908899 3300025914 Bacteria 696
183 Ga0207660_10371264 3300025917 Bacteria 1149
184 Ga0207657_10052559 3300025919 Bacteria 3535
185 Ga0207657_10167723 3300025919 Bacteria 1780
186 Ga0207657_10676070 3300025919 Bacteria 803
187 Ga0207649_10028913 3300025920 Bacteria 3269
188 Ga0207649_10558995 3300025920 Bacteria 876
189 Ga0207652_10874939 3300025921 Bacteria 795
190 Ga0207659_10009305 3300025926 Bacteria 6135
191 Ga0207687_10085793 3300025927 Bacteria 2285
192 Ga0207687_10783640 3300025927 Bacteria 812
193 Ga0207700_11150959 3300025928 Bacteria 693
194 Ga0207690_10012194 3300025932 Bacteria 5144
195 Ga0207690_10721775 3300025932 Bacteria 820
196 Ga0207706_10207153 3300025933 Bacteria 1719
197 Ga0207686_11273206 3300025934 Bacteria 603
198 Ga0207704_10493638 3300025938 Bacteria 985
199 Ga0207704_10578163 3300025938 Bacteria 917
200 Ga0207711_10021432 3300025941 Bacteria 5399
201 Ga0207711_10556556 3300025941 Unclassified 1070
202 Ga0207689_10243988 3300025942 Bacteria 1485
203 Ga0207689_10291264 3300025942 Bacteria 1352
204 Ga0207689_10576597 3300025942 Bacteria 946
205 Ga0207661_10016683 3300025944 Bacteria 5421
206 Ga0207661_10022397 3300025944 Bacteria 4758
207 Ga0207679_10000807 3300025945 Bacteria 20330
208 Ga0207679_10044815 3300025945 Bacteria 3195
209 Ga0207712_10332514 3300025961 Bacteria 1257
210 Ga0207668_10001393 3300025972 Bacteria 14246
211 Ga0207677_10001757 3300026023 Bacteria 11465
212 Ga0207677_10025633 3300026023 Bacteria 3682
213 Ga0207703_10054821 3300026035 Bacteria 3243
214 Ga0207703_11502796 3300026035 Bacteria 648
215 Ga0207639_10878457 3300026041 Bacteria 837
216 Ga0207678_10034725 3300026067 Bacteria 4392
217 Ga0207678_10530202 3300026067 Bacteria 1028
218 Ga0207708_10002968 3300026075 Bacteria 12507
219 Ga0207702_10232854 3300026078 Bacteria 1722
220 Ga0207702_10426606 3300026078 Bacteria 1283
221 Ga0207702_11463837 3300026078 Bacteria 677
222 Ga0207641_10785786 3300026088 Bacteria 941
223 Ga0207641_12340966 3300026088 Bacteria 533
224 Ga0207676_10717072 3300026095 Bacteria 970
225 Ga0207676_11312799 3300026095 Bacteria 718
226 Ga0207674_10047704 3300026116 Bacteria 4389
227 Ga0207674_10594465 3300026116 Bacteria 1069
228 Ga0207675_100099005 3300026118 Bacteria 2746
229 Ga0207683_10308441 3300026121 Bacteria 1448
230 Ga0207683_10330516 3300026121 Bacteria 1397
231 Ga0207683_10620284 3300026121 Bacteria 1001
232 Ga0207698_10864685 3300026142 Bacteria 910
233 Ga0268266_10542034 3300028379 Bacteria 1114
234 Ga0268265_10130543 3300028380 Bacteria 2087
235 Ga0268265_11318112 3300028380 Bacteria 722
236 Ga0268264_10568140 3300028381 Bacteria 1114
237 Ga0307517_10045549 3300028786 Bacteria 4603
238 Ga0307517_10300266 3300028786 Bacteria 901
239 Ga0307515_10000217 3300028794 Bacteria 142129
240 Ga0307515_10018640 3300028794 Bacteria 12539
241 Ga0307515_10053150 3300028794 Bacteria 5985
242 Ga0307515_10117741 3300028794 Bacteria 3038
243 Ga0307515_10299700 3300028794 Bacteria 1294
244 Ga0307512_10004430 3300030522 Bacteria 15402
245 Ga0307512_10026611 3300030522 Bacteria 5106
246 Ga0307513_10022892 3300031456 Bacteria 7323
247 Ga0307513_10026112 3300031456 Bacteria 6742
248 Ga0307509_10115716 3300031507 Bacteria 2673
249 Ga0307509_10128264 3300031507 Bacteria 2498
250 Ga0307509_10138632 3300031507 Bacteria 2373
251 Ga0307508_10000473 3300031616 Bacteria 48634
252 Ga0307508_10009886 3300031616 Bacteria 8744
253 Ga0307508_10124974 3300031616 Bacteria 2175
254 Ga0307508_10603836 3300031616 Bacteria 699
255 Ga0307514_10313798 3300031649 Bacteria 867
256 Ga0307516_10014622 3300031730 Bacteria 8294
257 Ga0307516_10020295 3300031730 Bacteria 6865
258 Ga0307516_10091734 3300031730 Bacteria 2865
259 Ga0307405_10028977 3300031731 Bacteria 3231
260 Ga0307405_10885193 3300031731 Bacteria 754
261 Ga0307413_10498726 3300031824 Bacteria 977
262 Ga0307413_10649135 3300031824 Bacteria 870
263 Ga0307413_10871954 3300031824 Bacteria 762
264 Ga0307413_11346637 3300031824 Bacteria 626
265 Ga0307410_10085013 3300031852 Bacteria 2232
266 Ga0307410_10254537 3300031852 Bacteria 1367
267 Ga0307406_10403533 3300031901 Bacteria 1084
268 Ga0307406_10705777 3300031901 Bacteria 843
269 Ga0307406_11609640 3300031901 Bacteria 574
270 Ga0307412_10579249 3300031911 Bacteria 947
271 Ga0307409_100244006 3300031995 Bacteria 1637
272 Ga0307409_102227051 3300031995 Bacteria 577
273 Ga0307416_101347939 3300032002 Bacteria 819
274 Ga0307414_10230737 3300032004 Bacteria 1526
275 Ga0307411_10297958 3300032005 Bacteria 1292
276 Ga0307411_12354347 3300032005 Bacteria 501
277 Ga0307415_100015704 3300032126 Bacteria 4494
278 Ga0307415_100022435 3300032126 Bacteria 3896
279 Ga0307415_100093789 3300032126 Bacteria 2181
280 Ga0307415_100242805 3300032126 Bacteria 1458
281 Ga0307415_100485372 3300032126 Bacteria 1077
282 Ga0307415_101827843 3300032126 Bacteria 588
283 Ga0307507_10162861 3300033179 Bacteria 1643
284 Ga0307507_10180373 3300033179 Bacteria 1511
285 Ga0307510_10025111 3300033180 Bacteria 6877
286 Ga0307510_10537343 3300033180 Bacteria 614
287 Ga0373950_0022264 3300034818 Bacteria 1126
288 Ga0373938_0054159 3300034957 Bacteria 923
289 Ga0373928_0095876 3300035084 Bacteria 767
290 Ga0373951_0000495 3300035091 Bacteria 11188
291 Ga0373932_0027062 3300035112 Bacteria 1565
292 Ga0373932_0450689 3300035112 Bacteria 505
293 Ga0373939_0089582 3300035114 Bacteria 1037
294 Ga0373941_0020083 3300035115 Bacteria 1868
295 Ga0373957_0306385 3300035120 Bacteria 674
296 Ga0373942_0000138 3300035207 Bacteria 17365
297 Ga0373962_0003734 3300035242 Bacteria 3663
298 Ga0395899_0352080 3300037312 Bacteria 985
299 Ga0395900_0019032 3300037418 Bacteria 7000
300 Ga0395900_0021078 3300037418 Bacteria 6660
301 Ga0395900_1335011 3300037418 Bacteria 631
302 Ga0395898_0201803 3300037466 Bacteria 1898
303 Ga0395898_1082359 3300037466 Bacteria 735
304 Ga0395905_0030296 3300037471 Bacteria 5099
305 Ga0395905_0193771 3300037471 Bacteria 1906
306 Ga0436364_1405012 3300037853 Bacteria 1460
307 Ga0395901_0134404 3300038443 Bacteria 2599
308 Ga0395901_0170946 3300038443 Bacteria 2280
309 Ga0451787_612177 3300041441 Bacteria 553
310 Ga0451793_1238640 3300041452 Bacteria 516
311 Ga0451795_1024294 3300041456 Bacteria 799
312 Ga0451798_0429870 3300041458 Bacteria 900
313 Ga0451802_0134248 3300041460 Bacteria 513
314 Ga0451804_0844886 3300041463 Bacteria 724
315 Ga0451837_0426992 3300041494 Bacteria 587
316 Ga0451841_1105358 3300041498 Bacteria 842
317 Ga0451849_0275624 3300041505 Bacteria 640
318 Ga0451843_1170535 3300041509 Bacteria 737
319 Ga0451853_3720861 3300041512 Bacteria 1216
320 Ga0450888_070713 3300042126 Bacteria 524
321 Ga0466958_1155239 3300045836 Bacteria 506
322 Ga0466967_0110529 3300045976 Bacteria 2524
323 Ga0466967_0239978 3300045976 Bacteria 1729
324 Ga0466967_0770143 3300045976 Bacteria 955
325 Ga0495603_0356098 3300046455 Bacteria 840
326 Ga0495629_0032313 3300046459 Bacteria 3706
327 Ga0495629_0164910 3300046459 Bacteria 1539
328 Ga0495629_0199393 3300046459 Bacteria 1384
329 Ga0495639_0262492 3300046475 Bacteria 856
330 Ga0495594_0009778 3300046499 Bacteria 4965
331 Ga0495594_0015668 3300046499 Bacteria 3985
332 Ga0495594_0051482 3300046499 Bacteria 2266
333 Ga0495594_0122238 3300046499 Bacteria 1472
334 Ga0495594_0798963 3300046499 Bacteria 532
335 Ga0495606_0001325 3300046507 Bacteria 33814
336 Ga0495632_0048060 3300046519 Bacteria 2114
337 Ga0495632_0056421 3300046519 Bacteria 1920
338 Ga0495668_0000425 3300046616 Bacteria 55002
339 Ga0495625_0001748 3300046660 Bacteria 25130
340 Ga0495588_0000358 3300046674 Bacteria 28601
341 Ga0495614_0002293 3300048089 Bacteria 8504
342 Ga0495626_0000051 3300048091 Bacteria 156449
343 Ga0496105_1164204 3300048908 Bacteria 569
344 Ga0496108_0000040 3300048911 Bacteria 147522
345 Ga0496112_0115742 3300048915 Bacteria 2651
346 Ga0496112_0179577 3300048915 Bacteria 2080
347 Ga0496112_0666779 3300048915 Bacteria 969
348 Ga0496126_0228883 3300048929 Bacteria 1558
349 Ga0496126_1139686 3300048929 Bacteria 577
350 Ga0501032_0532950 3300049569 Bacteria 749
351 Ga0501037_0279541 3300049573 Bacteria 1163
352 Ga0501038_0004303 3300049574 Bacteria 13236
353 Ga0501040_0373405 3300049576 Bacteria 1023
354 Ga0501042_0682749 3300049578 Bacteria 747
355 Ga0501047_0113225 3300049581 Bacteria 2595
356 Ga0501047_0574460 3300049581 Bacteria 950
357 Ga0501068_0195564 3300049584 Bacteria 1282
358 Ga0501069_0117318 3300049585 Bacteria 1519
359 Ga0501069_0680896 3300049585 Bacteria 620
360 Ga0501071_0567499 3300049587 Bacteria 872
361 Ga0501073_0215438 3300049589 Bacteria 1327
362 Ga0501074_0052807 3300049590 Bacteria 2933
363 Ga0501080_0429085 3300049742 Bacteria 1187
364 Ga0501035_0402906 3300049822 Bacteria 1138
365 Ga0501044_0031037 3300049823 Bacteria 5626
366 nmdc:mga05p37_2015_c1 3300050507 Bacteria 23699
367 nmdc:mga05p37_206252_c1 3300050507 Bacteria 2064
368 nmdc:mga05p37_2219901_c1 3300050507 Bacteria 509
369 nmdc:mga05p37_24225_c1 3300050507 Bacteria 7375
370 nmdc:mga05p37_268691_c1 3300050507 Bacteria 2038
371 nmdc:mga05p37_284_c1 3300050507 Bacteria 52993
372 nmdc:mga05p37_317429_c1 3300050507 Bacteria 1845
373 nmdc:mga09592_216853_c1 3300050508 Bacteria 1658
374 nmdc:mga09592_378745_c1 3300050508 Bacteria 1224
375 nmdc:mga09592_844_c1 3300050508 Bacteria 23824
376 nmdc:mga0qj67_22976_c1 3300050509 Bacteria 4791
377 nmdc:mga0qj67_277170_c1 3300050509 Bacteria 1359
378 nmdc:mga0qj67_285_c1 3300050509 Bacteria 35205
379 nmdc:mga0qj67_58678_c1 3300050509 Bacteria 1724
380 nmdc:mga0qj67_635_c2 3300050509 Bacteria 16820
381 nmdc:mga0qj67_645322_c1 3300050509 Bacteria 845
382 nmdc:mga06r32_1111149_c1 3300050510 Bacteria 739
383 nmdc:mga06r32_2256_c1 3300050510 Bacteria 17252
384 nmdc:mga06r32_523_c1 3300050510 Bacteria 33137
385 nmdc:mga06r32_583955_c1 3300050510 Bacteria 1089
386 nmdc:mga06r32_627098_c1 3300050510 Bacteria 1045
387 nmdc:mga06r32_80530_c1 3300050510 Bacteria 3169
388 nmdc:mga08y16_1910693_c1 3300050511 Bacteria 544
389 nmdc:mga08y16_4794_c1 3300050511 Bacteria 14108
390 Ga0500651_0346973 3300053093 Bacteria 843
391 Ga0500651_0792944 3300053093 Bacteria 500
392 Ga0500641_0021830 3300053096 Bacteria 2445
393 Ga0500660_125143 3300053100 Bacteria 1060
394 Ga0500652_278317 3300053131 Bacteria 654
395 Ga0500568_0001379 3300053139 Bacteria 15763
396 Ga0500577_0260183 3300053142 Bacteria 755
397 Ga0500600_0043576 3300053149 Bacteria 2577
398 Ga0501084_0438467 3300054114 Bacteria 1104
399 2501939627 2501939600 Bacteria 6907073
400 2515497346 2515154088 Bacteria 5526283
401 2515720886 2515154129 Bacteria 5584369
402 2515758323 2515154137 Bacteria 5711575
403 2516082632 2515154202 Bacteria 5471270
404 2516091794 2515154203 Bacteria 5458536
405 2623591327 2622736626 Bacteria 7181580
406 2676486229 2675903059 Bacteria 8644972
407 2772643429 2772190715 Bacteria 6959372
408 2831939823 2831935698 Bacteria 5963223
409 2832008600 2832004796 Bacteria 6538017
410 2855673663 2855670206 Bacteria 7120389
411 2855677967 2855676851 Bacteria 7063653
412 2855689256 2855683550 Bacteria 7134265
413 2856858256 2856858025 Bacteria 7255264
414 2857291126 2857288857 Bacteria 7189066
415 2858853988 2858848962 Bacteria 6963058
416 2858872321 2858868258 Bacteria 7683772
417 2858886957 2858882152 Bacteria 7230291
418 2858894525 2858888857 Bacteria 7060307
419 2858896440 2858895516 Bacteria 7378898
420 2858907401 2858902515 Bacteria 7086037
421 2866065432 2866065130 Bacteria 6518152
422 2867308328 2867302475 Bacteria 7087181
423 2867316967 2867312974 Bacteria 7058875
424 2867325343 2867319477 Bacteria 7069771
425 2867508251 2867507094 Bacteria 6506033
426 2869049429 2869048445 Bacteria 6875584
427 2869067630 2869061728 Bacteria 7112407
428 2869069338 2869068681 Bacteria 7205615
429 2880495811 2880489317 Bacteria 7096270
430 2880496552 2880495981 Bacteria 7340502
431 2887485503 2887478801 Bacteria 8972725
432 2902584095 2902582711 Bacteria 6187705
433 2929225192 2929219909 Bacteria 6984360
434 2929231837 2929226422 Bacteria 7248583
435 2996224513 2996221748 Bacteria 6799777
436 649813506 649633069 Bacteria 6962533
437 8001783818 8001781756 Bacteria 9586736
438 8003830830 8003830390 Bacteria 6541657
439 8003858494 8003856774 Bacteria 7675274
440 8003875629 8003870546 Bacteria 7396674
441 8023624328 8023623736 Bacteria 8593882
442 8054704814 8054704163 Bacteria 7247792
443 8054728477 8054727385 Bacteria 7558670
444 8054737340 8054734606 Bacteria 6947278
445 8055414884 8055412473 Bacteria 6257500
446 Ga0501084_0336468
447 LJQas_1010809
448 JGI25406J46586_10060062
449 JGI25404J52841_10063187
450 Ga0070658_10930786
451 Ga0070676_10083464
452 Ga0070683_100010149
453 Ga0070683_100013530
454 Ga0070683_100434541
455 Ga0070690_101430965
456 Ga0070670_100251802
457 Ga0070670_100392104
458 Ga0068869_100119405
459 Ga0068869_101728030
460 Ga0070680_100331420
461 Ga0070682_100754841
462 Ga0070682_100764678
463 Ga0070682_101535978
464 Ga0068868_100003717
465 Ga0068868_100092354
466 Ga0068868_101140818
467 Ga0070660_100089019
468 Ga0070660_100095618
469 Ga0070661_100022535
470 Ga0070661_101296693
471 Ga0070692_10164863
472 Ga0070692_11091759
473 Ga0070668_100063232
474 Ga0070668_100179275
475 Ga0070668_100907657
476 Ga0070669_100692876
477 Ga0070675_100005553
478 Ga0070671_100648755
479 Ga0070674_100357161
480 Ga0070673_101066276
481 Ga0070688_100399356
482 Ga0070659_100013442
483 Ga0070659_100928102
484 Ga0070667_101598381
485 Ga0070709_10159953
486 Ga0070714_100136967
487 Ga0070714_101425677
488 Ga0070710_10059791
489 Ga0070711_100987564
490 Ga0070700_100532081
491 Ga0070663_100016647
492 Ga0070663_100440791
493 Ga0070678_101087912
494 Ga0070662_100132551
495 Ga0070681_10139183
496 Ga0068867_100901338
497 Ga0070679_101114627
498 Ga0070684_100778581
499 Ga0070684_101844482
500 Ga0070697_101597841
501 Ga0070672_101360053
502 Ga0070693_100287215
503 Ga0070665_100770954
504 Ga0070665_101573825
505 Ga0070664_100001575
506 Ga0070664_100069352
507 Ga0070664_100411518
508 Ga0068857_100062474
509 Ga0068857_100352802
510 Ga0068854_101777902
511 Ga0068856_100784785
512 Ga0070702_100075741
513 Ga0068852_100908283
514 Ga0068859_100192509
515 Ga0068859_100657748
516 Ga0068859_101276153
517 Ga0068859_101725494
518 Ga0068864_100045358
519 Ga0068864_100197519
520 Ga0068864_100433971
521 Ga0068864_101195103
522 Ga0068861_100080726
523 Ga0068861_100496959
524 Ga0068851_10500038
525 Ga0068870_10070059
526 Ga0068870_10225300
527 Ga0068863_100071478
528 Ga0068863_100825490
529 Ga0068863_101088219
530 Ga0068863_101351513
531 Ga0068863_101873879
532 Ga0068858_100032785
533 Ga0068858_100070282
534 Ga0068858_100224216
535 Ga0068860_100865956
536 Ga0068860_102472989
537 Ga0068862_100077043
538 Ga0068862_100085935
539 Ga0068862_100141500
540 Ga0081540_1000716
541 Ga0081540_1042087
542 Ga0081539_10004409
543 Ga0081539_10005630
544 Ga0081539_10009999
545 Ga0070717_11074206
546 Ga0070716_101476544
547 Ga0097621_101888763
548 Ga0068871_101267462
549 Ga0068871_101422884
550 Ga0075428_100003789
551 Ga0075428_100007646
552 Ga0075428_100093171
553 Ga0075428_100168479
554 Ga0075428_100259906
555 Ga0075428_100381183
556 Ga0075428_100390344
557 Ga0075428_100837787
558 Ga0075430_100000638
559 Ga0075430_100013068
560 Ga0075430_100040137
561 Ga0075430_100066633
562 Ga0075430_100073506
563 Ga0075430_100335259
564 Ga0075430_100518227
565 Ga0075431_100002104
566 Ga0075431_100029188
567 Ga0075431_100220640
568 Ga0075431_100390601
569 Ga0075431_100778598
570 Ga0075431_101149879
571 Ga0075429_100042367
572 Ga0075429_100171817
573 Ga0075429_100268575
574 Ga0068865_100091675
575 Ga0097620_100192511
576 Ga0097620_100657679
577 Ga0097620_101276059
578 Ga0097620_101725420
579 Ga0111539_12122460
580 Ga0105245_10809464
581 Ga0105245_12573783
582 Ga0105247_10850655
583 Ga0114129_10000096
584 Ga0114129_10001855
585 Ga0114129_10004654
586 Ga0114129_10269037
587 Ga0114129_10340837
588 Ga0114129_10549298
589 Ga0114129_11319589
590 Ga0114129_12144245
591 Ga0105243_10539058
592 Ga0105241_11620441
593 Ga0105248_10032470
594 Ga0105248_10433198
595 Ga0105237_11557420
596 Ga0105237_11694272
597 Ga0105238_10416414
598 Ga0105249_11165207
599 Ga0105239_10194137
600 Ga0105239_10380657
601 Ga0105246_10447020
602 Ga0105246_11869262
603 Ga0157338_1072580
604 Ga0157369_10014560
605 Ga0157369_11802505
606 Ga0157378_10091703
607 Ga0157372_11554728
608 Ga0157372_11836642
609 Ga0157375_10928049
610 Ga0157375_12267707
611 Ga0163163_10441173
612 Ga0163163_10632810
613 Ga0163163_11632874
614 Ga0163163_12417397
615 Ga0182008_10113336
616 Ga0157377_10017446
617 Ga0157379_10128648
618 Ga0197907_10659800
619 Ga0206354_11531957
620 Ga0207656_10192885
621 Ga0207692_10912384
622 Ga0207645_10081735
623 Ga0207643_10061886
624 Ga0207643_10306317
625 Ga0207654_10092705
626 Ga0207707_10793730
627 Ga0207671_10908899
628 Ga0207660_10371264
629 Ga0207657_10052559
630 Ga0207657_10167723
631 Ga0207657_10676070
632 Ga0207649_10028913
633 Ga0207649_10558995
634 Ga0207652_10874939
635 Ga0207659_10009305
636 Ga0207687_10085793
637 Ga0207687_10783640
638 Ga0207700_11150959
639 Ga0207690_10012194
640 Ga0207690_10721775
641 Ga0207706_10207153
642 Ga0207686_11273206
643 Ga0207704_10493638
644 Ga0207704_10578163
645 Ga0207711_10021432
646 Ga0207711_10556556
647 Ga0207689_10243988
648 Ga0207689_10291264
649 Ga0207689_10576597
650 Ga0207661_10016683
651 Ga0207661_10022397
652 Ga0207679_10000807
653 Ga0207679_10044815
654 Ga0207712_10332514
655 Ga0207668_10001393
656 Ga0207677_10001757
657 Ga0207677_10025633
658 Ga0207703_10054821
659 Ga0207703_11502796
660 Ga0207639_10878457
661 Ga0207678_10034725
662 Ga0207678_10530202
663 Ga0207708_10002968
664 Ga0207702_10232854
665 Ga0207702_10426606
666 Ga0207702_11463837
667 Ga0207641_10785786
668 Ga0207641_12340966
669 Ga0207676_10717072
670 Ga0207676_11312799
671 Ga0207674_10047704
672 Ga0207674_10594465
673 Ga0207675_100099005
674 Ga0207683_10308441
675 Ga0207683_10330516
676 Ga0207683_10620284
677 Ga0207698_10864685
678 Ga0268266_10542034
679 Ga0268265_10130543
680 Ga0268265_11318112
681 Ga0268264_10568140
682 Ga0307517_10045549
683 Ga0307517_10300266
684 Ga0307515_10000217
685 Ga0307515_10018640
686 Ga0307515_10053150
687 Ga0307515_10117741
688 Ga0307515_10299700
689 Ga0307512_10004430
690 Ga0307512_10026611
691 Ga0307513_10022892
692 Ga0307513_10026112
693 Ga0307509_10115716
694 Ga0307509_10128264
695 Ga0307509_10138632
696 Ga0307508_10000473
697 Ga0307508_10009886
698 Ga0307508_10124974
699 Ga0307508_10603836
700 Ga0307514_10313798
701 Ga0307516_10014622
702 Ga0307516_10020295
703 Ga0307516_10091734
704 Ga0307405_10028977
705 Ga0307405_10885193
706 Ga0307413_10498726
707 Ga0307413_10649135
708 Ga0307413_10871954
709 Ga0307413_11346637
710 Ga0307410_10085013
711 Ga0307410_10254537
712 Ga0307406_10403533
713 Ga0307406_10705777
714 Ga0307406_11609640
715 Ga0307412_10579249
716 Ga0307409_100244006
717 Ga0307409_102227051
718 Ga0307416_101347939
719 Ga0307414_10230737
720 Ga0307411_10297958
721 Ga0307411_12354347
722 Ga0307415_100015704
723 Ga0307415_100022435
724 Ga0307415_100093789
725 Ga0307415_100242805
726 Ga0307415_100485372
727 Ga0307415_101827843
728 Ga0307507_10162861
729 Ga0307507_10180373
730 Ga0307510_10025111
731 Ga0307510_10537343
732 Ga0373950_0022264
733 Ga0373938_0054159
734 Ga0373928_0095876
735 Ga0373951_0000495
736 Ga0373932_0027062
737 Ga0373932_0450689
738 Ga0373939_0089582
739 Ga0373941_0020083
740 Ga0373957_0306385
741 Ga0373942_0000138
742 Ga0373962_0003734
743 Ga0395899_0352080
744 Ga0395900_0019032
745 Ga0395900_0021078
746 Ga0395900_1335011
747 Ga0395898_0201803
748 Ga0395898_1082359
749 Ga0395905_0030296
750 Ga0395905_0193771
751 Ga0436364_1405012
752 Ga0395901_0134404
753 Ga0395901_0170946
754 Ga0451787_612177
755 Ga0451793_1238640
756 Ga0451795_1024294
757 Ga0451798_0429870
758 Ga0451802_0134248
759 Ga0451804_0844886
760 Ga0451837_0426992
761 Ga0451841_1105358
762 Ga0451849_0275624
763 Ga0451843_1170535
764 Ga0451853_3720861
765 Ga0450888_070713
766 Ga0466958_1155239
767 Ga0466967_0110529
768 Ga0466967_0239978
769 Ga0466967_0770143
770 Ga0495603_0356098
771 Ga0495629_0032313
772 Ga0495629_0164910
773 Ga0495629_0199393
774 Ga0495639_0262492
775 Ga0495594_0009778
776 Ga0495594_0015668
777 Ga0495594_0051482
778 Ga0495594_0122238
779 Ga0495594_0798963
780 Ga0495606_0001325
781 Ga0495632_0048060
782 Ga0495632_0056421
783 Ga0495668_0000425
784 Ga0495625_0001748
785 Ga0495588_0000358
786 Ga0495614_0002293
787 Ga0495626_0000051
788 Ga0496105_1164204
789 Ga0496108_0000040
790 Ga0496112_0115742
791 Ga0496112_0179577
792 Ga0496112_0666779
793 Ga0496126_0228883
794 Ga0496126_1139686
795 Ga0501032_0532950
796 Ga0501037_0279541
797 Ga0501038_0004303
798 Ga0501040_0373405
799 Ga0501042_0682749
800 Ga0501047_0113225
801 Ga0501047_0574460
802 Ga0501068_0195564
803 Ga0501069_0117318
804 Ga0501069_0680896
805 Ga0501071_0567499
806 Ga0501073_0215438
807 Ga0501074_0052807
808 Ga0501080_0429085
809 Ga0501035_0402906
810 Ga0501044_0031037
811 nmdc:mga05p37_2015_c1
812 nmdc:mga05p37_206252_c1
813 nmdc:mga05p37_2219901_c1
814 nmdc:mga05p37_24225_c1
815 nmdc:mga05p37_268691_c1
816 nmdc:mga05p37_284_c1
817 nmdc:mga05p37_317429_c1
818 nmdc:mga09592_216853_c1
819 nmdc:mga09592_378745_c1
820 nmdc:mga09592_844_c1
821 nmdc:mga0qj67_22976_c1
822 nmdc:mga0qj67_277170_c1
823 nmdc:mga0qj67_285_c1
824 nmdc:mga0qj67_58678_c1
825 nmdc:mga0qj67_635_c2
826 nmdc:mga0qj67_645322_c1
827 nmdc:mga06r32_1111149_c1
828 nmdc:mga06r32_2256_c1
829 nmdc:mga06r32_523_c1
830 nmdc:mga06r32_583955_c1
831 nmdc:mga06r32_627098_c1
832 nmdc:mga06r32_80530_c1
833 nmdc:mga08y16_1910693_c1
834 nmdc:mga08y16_4794_c1
835 Ga0500651_0346973
836 Ga0500651_0792944
837 Ga0500641_0021830
838 Ga0500660_125143
839 Ga0500652_278317
840 Ga0500568_0001379
841 Ga0500577_0260183
842 Ga0500600_0043576
843 Ga0501084_0438467
844 2501939627
845 2515497346
846 2515720886
847 2515758323
848 2516082632
849 2516091794
850 2623591327
851 2676486229
852 2772643429
853 2831939823
854 2832008600
855 2855673663
856 2855677967
857 2855689256
858 2856858256
859 2857291126
860 2858853988
861 2858872321
862 2858886957
863 2858894525
864 2858896440
865 2858907401
866 2866065432
867 2867308328
868 2867316967
869 2867325343
870 2867508251
871 2869049429
872 2869067630
873 2869069338
874 2880495811
875 2880496552
876 2887485503
877 2902584095
878 2929225192
879 2929231837
880 2996224513
881 649813506
882 8001783818
883 8003830830
884 8003858494
885 8003875629
886 8023624328
887 8054704814
888 8054728477
889 8054737340
890 8055414884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

19

75

0.95

PF13279

4HBT_2

Thioesterase-like superfamily

11

158

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rd7-assembly1.cif.gz_A crystal structure of acyl-coa thioesterase from mycobacterium avium 0.899 55 115
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.8922 4 132
1tbu-assembly1.cif.gz_C crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.8881 54 113
2cye-assembly3.cif.gz_D crystal structure of thioesterase complexed with coenzyme a and zn from thermus thermophilus hb8 0.8872 5 132
3hm0-assembly1.cif.gz_D crystal structure of probable thioesterase from bartonella henselae 0.8854 3 125
ID Description Score Start End Superfamily
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8922 4 132 3.10.129.10
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8881 54 113 3.10.129.10
3hm0D00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8854 3 125 3.10.129.10
2cyeD00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8799 5 132 3.10.129.10
3ck1B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8779 2 137 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A4Y3WQE3-F1-model_v4 Thioesterase 0.9663 1 135
AF-A0A263DJU3-F1-model_v4 Thioesterase 0.9567 3 137 GO:0047617
AF-A0A1W2LST1-F1-model_v4 Thioesterase 0.9546 2 132 GO:0047617
AF-A0A4Y3R0F6-F1-model_v4 Thioesterase 0.9527 2 137 GO:0047617
AF-A0A561BVA5-F1-model_v4 Acyl-CoA thioester hydrolase 0.9494 3 136 GO:0047617

Map