F445483

General Info

Members Datasets Scaffolds Average Seq Length
445 256 442 364

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10028899|Ga0105240_100288996
Length 434
Sequence VANCRALWISGRFRQVTALQLCGQGGVHGVGCNAASNGLDLERNAPRQPSRTCRNRFGSVTIKTRPFFLSAMTQANDERVRALLATVIDPHTGQDLVAGGALKGVGVDGGNVAVDIALGYPAQTFAPVLAEQVRAALRADPAIADASVNVTSRVRAHKVQKELMPLPNVKNIIAVASGKGGVGKSTTAVNLALALVAEGAQVGVLDADIYGPSIPRMLGVSGKPDTKDGQHLEPKLAHGVQAMSIGFMIEEDTPMIWRGPMVTQALTQLLNETNWVDLDYLIIDLPPGTGDIQLTLCQRVPVSGALIVTTPQDIALLDAKKALKMFEKVEVPVLGIIENMALHTCSHCGHTEHIFGSGGGEKMATQYGVPLLGSLPLDIHIREQADGGAPSVAADPSSAVAASYREIARKAAAQLSLHARSKSIQFPKIVIQNT

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
168 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
181 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
193 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
194 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
195 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
196 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
250 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
251 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 1.8
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.89
Nodule 0
Rhizoplane 1.12
Rhizosphere 82.25
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001112 3300002737 Bacteria 16257
2 JGI25157J39369_1000362 3300002741 Bacteria 31445
3 JGI25157J39369_1002018 3300002741 Bacteria 5884
4 JGI25157J39369_1002330 3300002741 Bacteria 4926
5 JGI25164J39214_1000331 3300002772 Bacteria 30265
6 JGI25165J46597_1000158 3300003214 Bacteria 108257
7 Ga0055539_1002649 3300003752 Bacteria 2669
8 Ga0055533_1007117 3300003756 Bacteria 1558
9 Ga0055525_1000346 3300003759 Bacteria 33587
10 Ga0055527_1000149 3300003760 Bacteria 49224
11 Ga0055535_1000395 3300003761 Bacteria 41210
12 Ga0055535_1000657 3300003761 Bacteria 27351
13 Ga0055535_1000819 3300003761 Bacteria 22334
14 Ga0055535_1001546 3300003761 Bacteria 11242
15 Ga0055542_1000167 3300003762 Bacteria 83068
16 Ga0055542_1000364 3300003762 Bacteria 47003
17 Ga0055542_1000657 3300003762 Bacteria 28386
18 Ga0055529_1000468 3300003763 Bacteria 39125
19 Ga0055529_1000593 3300003763 Bacteria 28386
20 Ga0055529_1000706 3300003763 Bacteria 22334
21 Ga0055529_1001113 3300003763 Bacteria 11820
22 Ga0070676_10048315 3300005328 Bacteria 2487
23 Ga0070683_100044026 3300005329 Bacteria 4115
24 Ga0070670_100070420 3300005331 Bacteria 3002
25 Ga0070677_10031429 3300005333 Bacteria 2029
26 Ga0070666_10000331 3300005335 Bacteria 29851
27 Ga0070666_10003401 3300005335 Bacteria 9642
28 Ga0068868_100311836 3300005338 Bacteria 1338
29 Ga0070661_100033794 3300005344 Bacteria 3707
30 Ga0070661_100048393 3300005344 Bacteria 3112
31 Ga0070668_100011687 3300005347 Bacteria 6536
32 Ga0070668_100243472 3300005347 Bacteria 1491
33 Ga0070671_100247558 3300005355 Bacteria 1514
34 Ga0070674_100070248 3300005356 Bacteria 2473
35 Ga0070688_100141531 3300005365 Bacteria 1634
36 Ga0070688_100150663 3300005365 Bacteria 1590
37 Ga0070659_100119535 3300005366 Bacteria 2133
38 Ga0070667_100019757 3300005367 Bacteria 5590
39 Ga0070667_100120085 3300005367 Bacteria 2286
40 Ga0070667_100137125 3300005367 Bacteria 2140
41 Ga0070667_100265338 3300005367 Bacteria 1538
42 Ga0070714_100002426 3300005435 Bacteria 13730
43 Ga0070713_100123526 3300005436 Bacteria 2274
44 Ga0070708_100000191 3300005445 Bacteria 44404
45 Ga0070663_100026426 3300005455 Bacteria 3933
46 Ga0070663_100061685 3300005455 Bacteria 2700
47 Ga0070663_100065075 3300005455 Bacteria 2637
48 Ga0070663_100066966 3300005455 Bacteria 2604
49 Ga0070678_100051708 3300005456 Bacteria 2980
50 Ga0070678_100099894 3300005456 Bacteria 2246
51 Ga0070662_100240512 3300005457 Bacteria 1452
52 Ga0070681_10363842 3300005458 Bacteria 1357
53 Ga0070685_10000727 3300005466 Bacteria 17936
54 Ga0070685_10046814 3300005466 Bacteria 2484
55 Ga0070684_100026965 3300005535 Bacteria 4844
56 Ga0068853_100239510 3300005539 Bacteria 1662
57 Ga0070672_100044477 3300005543 Bacteria 3430
58 Ga0070696_100003358 3300005546 Bacteria 10677
59 Ga0070693_100007586 3300005547 Bacteria 5309
60 Ga0070665_100000172 3300005548 Bacteria 115040
61 Ga0070665_100000525 3300005548 Bacteria 54632
62 Ga0070665_100016842 3300005548 Bacteria 7329
63 Ga0070665_100270647 3300005548 Bacteria 1700
64 Ga0070665_100366709 3300005548 Bacteria 1447
65 Ga0068855_100003763 3300005563 Bacteria 18547
66 Ga0068855_100052236 3300005563 Bacteria 4812
67 Ga0070664_100006469 3300005564 Bacteria 9443
68 Ga0068857_100052530 3300005577 Bacteria 3616
69 Ga0068857_100304573 3300005577 Bacteria 1469
70 Ga0068854_100003005 3300005578 Bacteria 10470
71 Ga0068854_100034071 3300005578 Bacteria 3554
72 Ga0068854_100053862 3300005578 Bacteria 2891
73 Ga0068854_100250181 3300005578 Bacteria 1415
74 Ga0068856_100001479 3300005614 Bacteria 24602
75 Ga0068856_100008501 3300005614 Bacteria 9985
76 Ga0068856_100010470 3300005614 Bacteria 9003
77 Ga0068852_100018137 3300005616 Bacteria 5540
78 Ga0068859_100000125 3300005617 Bacteria 72938
79 Ga0068864_100014993 3300005618 Bacteria 6443
80 Ga0068866_10057890 3300005718 Bacteria 1999
81 Ga0068851_10010702 3300005834 Bacteria 4286
82 Ga0068851_10013705 3300005834 Bacteria 3838
83 Ga0068851_10055966 3300005834 Bacteria 2010
84 Ga0068863_100010558 3300005841 Bacteria 8966
85 Ga0068863_100069437 3300005841 Bacteria 3331
86 Ga0068858_100004776 3300005842 Bacteria 13274
87 Ga0068858_100238798 3300005842 Bacteria 1724
88 Ga0068860_100013373 3300005843 Bacteria 8046
89 Ga0068860_100056925 3300005843 Bacteria 3716
90 Ga0068862_100001848 3300005844 Bacteria 19196
91 Ga0081539_10000188 3300005985 Bacteria 143987
92 Ga0075365_10074845 3300006038 Bacteria 2284
93 Ga0075364_10040523 3300006051 Bacteria 3021
94 Ga0097621_100215355 3300006237 Bacteria 1672
95 Ga0097621_100254930 3300006237 Bacteria 1538
96 Ga0068871_100178412 3300006358 Bacteria 1824
97 Ga0075433_10204625 3300006852 Bacteria 1755
98 Ga0075434_100000459 3300006871 Bacteria 30427
99 Ga0068865_100199942 3300006881 Bacteria 1551
100 Ga0075436_100042689 3300006914 Bacteria 3128
101 Ga0097620_100000125 3300006931 Bacteria 72938
102 Ga0075435_100003755 3300007076 Bacteria 10346
103 Ga0105240_10001191 3300009093 Bacteria 45336
104 Ga0105240_10018544 3300009093 Bacteria 9340
105 Ga0105240_10028899 3300009093 Bacteria 7232
106 Ga0105240_10056802 3300009093 Bacteria 4895
107 Ga0105240_10494082 3300009093 Bacteria 1362
108 Ga0105245_10084017 3300009098 Bacteria 2915
109 Ga0105245_10330245 3300009098 Bacteria 1505
110 Ga0105241_10002547 3300009174 Bacteria 13684
111 Ga0105241_10004069 3300009174 Bacteria 10805
112 Ga0105241_10006875 3300009174 Bacteria 8370
113 Ga0105241_10008749 3300009174 Bacteria 7438
114 Ga0105241_10184885 3300009174 Bacteria 1731
115 Ga0105248_10231129 3300009177 Bacteria 2082
116 Ga0105248_10310971 3300009177 Bacteria 1774
117 Ga0105248_10440017 3300009177 Bacteria 1469
118 Ga0105237_10003573 3300009545 Bacteria 18410
119 Ga0105237_10010758 3300009545 Bacteria 9710
120 Ga0105237_10033402 3300009545 Bacteria 5212
121 Ga0105237_10045787 3300009545 Bacteria 4401
122 Ga0105237_10073581 3300009545 Bacteria 3409
123 Ga0105238_10000279 3300009551 Bacteria 56624
124 Ga0105238_10000543 3300009551 Bacteria 39418
125 Ga0105238_10002402 3300009551 Bacteria 18777
126 Ga0105238_10032943 3300009551 Bacteria 5274
127 Ga0105238_10290735 3300009551 Bacteria 1616
128 Ga0105249_10002587 3300009553 Bacteria 15661
129 Ga0105239_10006672 3300010375 Bacteria 13334
130 Ga0105239_10008912 3300010375 Bacteria 11352
131 Ga0105239_10010432 3300010375 Bacteria 10388
132 Ga0105246_10049389 3300011119 Bacteria 2881
133 Ga0157370_10053829 3300013104 Bacteria 3837
134 Ga0157370_10299876 3300013104 Bacteria 1484
135 Ga0157369_10000148 3300013105 Bacteria 100073
136 Ga0157369_10001162 3300013105 Bacteria 32848
137 Ga0157369_10047426 3300013105 Bacteria 4665
138 Ga0157369_10123759 3300013105 Bacteria 2743
139 Ga0157374_10033606 3300013296 Bacteria 4681
140 Ga0157378_10001845 3300013297 Bacteria 19027
141 Ga0157378_10120018 3300013297 Bacteria 2422
142 Ga0163162_10000007 3300013306 Bacteria 368084
143 Ga0163162_10007109 3300013306 Bacteria 10860
144 Ga0163162_10008886 3300013306 Bacteria 9771
145 Ga0157372_10002301 3300013307 Bacteria 20714
146 Ga0157372_10034832 3300013307 Bacteria 5539
147 Ga0157372_10222364 3300013307 Bacteria 2188
148 Ga0157372_10265759 3300013307 Bacteria 1992
149 Ga0157375_10092470 3300013308 Bacteria 3089
150 Ga0157375_10126484 3300013308 Bacteria 2671
151 Ga0163163_10000453 3300014325 Bacteria 37388
152 Ga0163163_10003784 3300014325 Bacteria 12887
153 Ga0163163_10257533 3300014325 Bacteria 1796
154 Ga0157379_10006295 3300014968 Bacteria 10221
155 Ga0157376_10002904 3300014969 Bacteria 11749
156 Ga0157376_10009502 3300014969 Bacteria 7066
157 Ga0157376_10016809 3300014969 Bacteria 5565
158 Ga0163161_10173435 3300017792 Bacteria 1650
159 Ga0213876_10061615 3300021384 Bacteria 1980
160 Ga0209674_100202 3300025226 Bacteria 61028
161 Ga0209672_100018 3300025228 Bacteria 432924
162 Ga0209672_100198 3300025228 Bacteria 47906
163 Ga0209672_101705 3300025228 Bacteria 7065
164 Ga0207427_100036 3300025231 Bacteria 309540
165 Ga0209437_100127 3300025233 Bacteria 190741
166 Ga0209258_100024 3300025242 Bacteria 542096
167 Ga0209258_100035 3300025242 Bacteria 430864
168 Ga0209258_100256 3300025242 Bacteria 93548
169 Ga0209646_1002938 3300025246 Bacteria 3548
170 Ga0209026_1000056 3300025250 Bacteria 236450
171 Ga0209026_1001174 3300025250 Bacteria 12151
172 Ga0209677_101847 3300025253 Bacteria 8619
173 Ga0209148_1000009 3300025254 Bacteria 1395625
174 Ga0209148_1000045 3300025254 Bacteria 448076
175 Ga0209148_1000048 3300025254 Bacteria 430913
176 Ga0209759_1000166 3300025256 Bacteria 113080
177 Ga0209759_1000670 3300025256 Bacteria 31566
178 Ga0209233_1000101 3300025261 Bacteria 286063
179 Ga0209233_1001860 3300025261 Bacteria 8113
180 Ga0209455_1000029 3300025272 Bacteria 542096
181 Ga0209455_1000035 3300025272 Bacteria 479071
182 Ga0209455_1006982 3300025272 Bacteria 3255
183 Ga0207656_10073875 3300025321 Bacteria 1520
184 Ga0207682_10003801 3300025893 Bacteria 6481
185 Ga0207680_10000602 3300025903 Bacteria 16967
186 Ga0207680_10004192 3300025903 Bacteria 6824
187 Ga0207680_10009486 3300025903 Bacteria 4829
188 Ga0207680_10076371 3300025903 Bacteria 2092
189 Ga0207647_10020648 3300025904 Bacteria 4413
190 Ga0207699_10018557 3300025906 Bacteria 3688
191 Ga0207645_10091424 3300025907 Bacteria 1957
192 Ga0207654_10002062 3300025911 Bacteria 10307
193 Ga0207654_10003310 3300025911 Bacteria 8149
194 Ga0207654_10106644 3300025911 Bacteria 1736
195 Ga0207654_10246511 3300025911 Bacteria 1196
196 Ga0207707_10032425 3300025912 Bacteria 4572
197 Ga0207695_10000033 3300025913 Bacteria 507477
198 Ga0207695_10001009 3300025913 Bacteria 49724
199 Ga0207695_10003620 3300025913 Bacteria 21611
200 Ga0207695_10015316 3300025913 Bacteria 9034
201 Ga0207695_10026788 3300025913 Bacteria 6429
202 Ga0207695_10149908 3300025913 Bacteria 2272
203 Ga0207671_10002084 3300025914 Bacteria 21880
204 Ga0207671_10005445 3300025914 Bacteria 11717
205 Ga0207671_10005815 3300025914 Bacteria 11207
206 Ga0207671_10245817 3300025914 Bacteria 1406
207 Ga0207663_10002698 3300025916 Bacteria 8564
208 Ga0207663_10178548 3300025916 Bacteria 1514
209 Ga0207660_10100650 3300025917 Bacteria 2158
210 Ga0207657_10001542 3300025919 Bacteria 24681
211 Ga0207657_10004253 3300025919 Bacteria 15168
212 Ga0207649_10058315 3300025920 Bacteria 2417
213 Ga0207652_10136453 3300025921 Bacteria 2191
214 Ga0207694_10000518 3300025924 Bacteria 34921
215 Ga0207694_10001353 3300025924 Bacteria 21121
216 Ga0207694_10001468 3300025924 Bacteria 20156
217 Ga0207694_10037008 3300025924 Bacteria 3746
218 Ga0207694_10096388 3300025924 Bacteria 2339
219 Ga0207694_10151840 3300025924 Bacteria 1866
220 Ga0207650_10135549 3300025925 Bacteria 1931
221 Ga0207650_10158287 3300025925 Bacteria 1793
222 Ga0207659_10230283 3300025926 Bacteria 1494
223 Ga0207687_10047577 3300025927 Bacteria 2973
224 Ga0207700_10105016 3300025928 Bacteria 2261
225 Ga0207664_10002312 3300025929 Bacteria 12582
226 Ga0207664_10185750 3300025929 Bacteria 1787
227 Ga0207644_10299241 3300025931 Bacteria 1296
228 Ga0207690_10262928 3300025932 Bacteria 1337
229 Ga0207706_10065731 3300025933 Bacteria 3193
230 Ga0207704_10017563 3300025938 Bacteria 3713
231 Ga0207691_10016974 3300025940 Bacteria 6909
232 Ga0207691_10094011 3300025940 Bacteria 2683
233 Ga0207691_10129292 3300025940 Bacteria 2232
234 Ga0207689_10028856 3300025942 Bacteria 4639
235 Ga0207689_10082603 3300025942 Bacteria 2641
236 Ga0207689_10128871 3300025942 Bacteria 2082
237 Ga0207661_10137117 3300025944 Bacteria 2102
238 Ga0207679_10112280 3300025945 Bacteria 2153
239 Ga0207679_10156206 3300025945 Bacteria 1863
240 Ga0207667_10004923 3300025949 Bacteria 16313
241 Ga0207667_10013899 3300025949 Bacteria 9196
242 Ga0207667_10047285 3300025949 Bacteria 4554
243 Ga0207651_10092396 3300025960 Bacteria 2219
244 Ga0207712_10000466 3300025961 Bacteria 34075
245 Ga0207668_10048019 3300025972 Bacteria 2927
246 Ga0207640_10010263 3300025981 Bacteria 5270
247 Ga0207677_10246814 3300026023 Bacteria 1448
248 Ga0207703_10000759 3300026035 Bacteria 31818
249 Ga0207703_10110012 3300026035 Bacteria 2350
250 Ga0207703_10362900 3300026035 Bacteria 1336
251 Ga0207639_10000364 3300026041 Bacteria 31337
252 Ga0207639_10045732 3300026041 Bacteria 3299
253 Ga0207639_10096503 3300026041 Bacteria 2378
254 Ga0207639_10224897 3300026041 Bacteria 1623
255 Ga0207678_10008650 3300026067 Bacteria 8971
256 Ga0207678_10014385 3300026067 Bacteria 6958
257 Ga0207708_10134386 3300026075 Bacteria 1936
258 Ga0207702_10001263 3300026078 Bacteria 25504
259 Ga0207702_10014535 3300026078 Bacteria 6533
260 Ga0207702_10125154 3300026078 Bacteria 2306
261 Ga0207702_10166321 3300026078 Bacteria 2018
262 Ga0207641_10128924 3300026088 Bacteria 2269
263 Ga0207641_10200077 3300026088 Bacteria 1841
264 Ga0207641_10235557 3300026088 Bacteria 1703
265 Ga0207648_10016001 3300026089 Bacteria 6873
266 Ga0207676_10008618 3300026095 Bacteria 7248
267 Ga0207674_10001959 3300026116 Bacteria 26075
268 Ga0207674_10010039 3300026116 Bacteria 10770
269 Ga0207674_10060159 3300026116 Bacteria 3842
270 Ga0207675_100102020 3300026118 Bacteria 2703
271 Ga0207675_100204416 3300026118 Bacteria 1898
272 Ga0207683_10076353 3300026121 Bacteria 2966
273 Ga0207698_10014241 3300026142 Bacteria 5280
274 Ga0207698_10211237 3300026142 Bacteria 1746
275 Ga0268266_10000001 3300028379 Bacteria 4040580
276 Ga0268266_10000006 3300028379 Bacteria 1410021
277 Ga0268266_10371286 3300028379 Bacteria 1347
278 Ga0268265_10000664 3300028380 Bacteria 34105
279 Ga0268264_10008844 3300028381 Bacteria 8347
280 Ga0268264_10148789 3300028381 Bacteria 2097
281 Ga0265319_1009457 3300028563 Bacteria 4148
282 Ga0265334_10000674 3300028573 Bacteria 17142
283 Ga0265332_10007285 3300031238 Bacteria 5003
284 Ga0265328_10015741 3300031239 Bacteria 2957
285 Ga0265325_10003111 3300031241 Bacteria 10948
286 Ga0265325_10005872 3300031241 Bacteria 7522
287 Ga0265329_10004586 3300031242 Bacteria 5713
288 Ga0265340_10000794 3300031247 Bacteria 17926
289 Ga0265339_10005299 3300031249 Bacteria 8598
290 Ga0265331_10032485 3300031250 Bacteria 2586
291 Ga0265316_10039478 3300031344 Bacteria 3790
292 Ga0265313_10000371 3300031595 Bacteria 48762
293 Ga0265314_10000512 3300031711 Bacteria 50069
294 Ga0265314_10005701 3300031711 Bacteria 11172
295 Ga0316576_10108206 3300031727 Bacteria 2083
296 Ga0307516_10036822 3300031730 Bacteria 4894
297 Ga0307413_10003648 3300031824 Bacteria 6536
298 Ga0307407_10004814 3300031903 Bacteria 5784
299 Ga0307411_10112649 3300032005 Bacteria 1950
300 Ga0316583_10010814 3300032133 Bacteria 3288
301 Ga0316593_10056754 3300032168 Bacteria 1332
302 Ga0316593_10059370 3300032168 Bacteria 1305
303 Ga0316593_10070287 3300032168 Bacteria 1210
304 Ga0316586_1005399 3300033527 Bacteria 1795
305 Ga0316588_1025538 3300033528 Bacteria 1365
306 Ga0316588_1032652 3300033528 Bacteria 1225
307 Ga0316587_1005688 3300033529 Bacteria 1879
308 Ga0316596_1031007 3300033541 Bacteria 1387
309 Ga0373934_0000137 3300035086 Bacteria 26986
310 Ga0373944_0007726 3300035089 Bacteria 2888
311 Ga0373953_0018085 3300035117 Bacteria 2602
312 Ga0373956_0000018 3300035119 Bacteria 50671
313 Ga0373956_0075706 3300035119 Bacteria 1540
314 Ga0373957_0039682 3300035120 Bacteria 1767
315 Ga0373946_0010327 3300035171 Bacteria 3453
316 Ga0373955_0020468 3300035172 Bacteria 3326
317 Ga0373955_0052312 3300035172 Bacteria 2228
318 Ga0373942_0017556 3300035207 Bacteria 1765
319 Ga0316574_0008541 3300035398 Bacteria 5693
320 Ga0316574_0022837 3300035398 Bacteria 3730
321 Ga0316574_0076148 3300035398 Bacteria 2125
322 Ga0373933_0000035 3300035724 Bacteria 82702
323 Ga0373947_0171089 3300035725 Bacteria 1410
324 Ga0373937_0001322 3300036401 Bacteria 20734
325 Ga0373937_0114236 3300036401 Bacteria 2513
326 Ga0316582_0094391 3300036647 Bacteria 1973
327 Ga0316584_0052178 3300036712 Bacteria 3059
328 Ga0316584_0068488 3300036712 Bacteria 2660
329 Ga0395899_0000119 3300037312 Bacteria 127184
330 Ga0395899_0015223 3300037312 Bacteria 5864
331 Ga0395900_0000107 3300037418 Bacteria 149024
332 Ga0395900_0199239 3300037418 Bacteria 2027
333 Ga0395898_0000078 3300037466 Bacteria 244514
334 Ga0395898_0000211 3300037466 Bacteria 149301
335 Ga0316581_0049292 3300037588 Bacteria 1289
336 Ga0395901_0072978 3300038443 Bacteria 3578
337 Ga0400490_20921 3300038726 Bacteria 35909
338 Ga0400485_13101 3300038735 Bacteria 31485
339 Ga0400486_18851 3300038742 Bacteria 47783
340 Ga0400483_138703 3300039062 Bacteria 1830
341 Ga0400483_139389 3300039062 Bacteria 5544
342 Ga0400483_190057 3300039062 Bacteria 41427
343 Ga0400483_238315 3300039062 Bacteria 22298
344 Ga0400483_288087 3300039062 Bacteria 26272
345 Ga0400487_38243 3300039110 Bacteria 71080
346 Ga0400487_49718 3300039110 Bacteria 5740
347 Ga0436365_1656463 3300039437 Bacteria 2166
348 Ga0451853_1659196 3300041512 Bacteria 2268
349 Ga0439449_0001643 3300042007 Bacteria 8766
350 Ga0439449_0004713 3300042007 Bacteria 5264
351 Ga0439462_0009780 3300042015 Bacteria 2425
352 Ga0451577_0040351 3300042876 Bacteria 4191
353 Ga0451577_0130137 3300042876 Bacteria 2257
354 Ga0466969_0050242 3300044656 Bacteria 2055
355 Ga0466966_0050915 3300044684 Bacteria 2634
356 Ga0466961_0002581 3300044693 Bacteria 11230
357 Ga0466961_0002840 3300044693 Bacteria 10751
358 Ga0466961_0010232 3300044693 Bacteria 5975
359 Ga0466961_0031115 3300044693 Bacteria 3430
360 Ga0453684_0000298 3300044712 Bacteria 209777
361 Ga0453684_0009060 3300044712 Bacteria 17564
362 Ga0453684_0047807 3300044712 Bacteria 5668
363 Ga0466971_0007954 3300044719 Bacteria 4620
364 Ga0466970_0007214 3300044765 Bacteria 5566
365 Ga0466957_0039121 3300044842 Bacteria 2860
366 Ga0466957_0115012 3300044842 Bacteria 1710
367 Ga0466959_0000110 3300045049 Bacteria 52740
368 Ga0466959_0018905 3300045049 Bacteria 5062
369 Ga0466959_0037720 3300045049 Bacteria 3572
370 Ga0451576_0000033 3300045051 Bacteria 393131
371 Ga0451576_0671953 3300045051 Bacteria 1088
372 Ga0466958_0001437 3300045836 Bacteria 11290
373 Ga0466958_0027721 3300045836 Bacteria 3353
374 Ga0466967_0321074 3300045976 Bacteria 1493
375 Ga0495638_0007919 3300046460 Bacteria 7578
376 Ga0495638_0063025 3300046460 Bacteria 2287
377 Ga0495651_0004232 3300046462 Bacteria 10995
378 Ga0495663_0025299 3300046525 Bacteria 1730
379 Ga0495586_0027998 3300046535 Bacteria 3016
380 Ga0496103_0132042 3300048906 Bacteria 1595
381 Ga0496104_0000011 3300048907 Bacteria 459358
382 Ga0496105_0000014 3300048908 Bacteria 220911
383 Ga0496114_0242025 3300048917 Bacteria 1587
384 Ga0496115_0000869 3300048918 Bacteria 21982
385 Ga0496117_0061693 3300048920 Bacteria 2575
386 Ga0496118_0000848 3300048921 Bacteria 48534
387 Ga0496118_0030098 3300048921 Bacteria 4540
388 Ga0496119_0078933 3300048922 Bacteria 1902
389 Ga0496120_0001713 3300048923 Bacteria 25017
390 Ga0496126_0000033 3300048929 Bacteria 368851
391 Ga0496126_0115285 3300048929 Bacteria 2336
392 Ga0501031_0054651 3300049568 Bacteria 2601
393 Ga0501032_0005005 3300049569 Bacteria 9910
394 Ga0501032_0033850 3300049569 Bacteria 3500
395 Ga0501033_0003490 3300049570 Bacteria 12895
396 Ga0501033_0127584 3300049570 Bacteria 1844
397 Ga0501034_0001149 3300049571 Bacteria 36697
398 Ga0501034_0001308 3300049571 Bacteria 33715
399 Ga0501034_0037280 3300049571 Bacteria 4922
400 Ga0501036_0006509 3300049572 Bacteria 9491
401 Ga0501036_0035164 3300049572 Bacteria 4239
402 Ga0501037_0054306 3300049573 Bacteria 2929
403 Ga0501038_0006089 3300049574 Bacteria 11161
404 Ga0501039_0041672 3300049575 Bacteria 3547
405 Ga0501043_0003408 3300049579 Bacteria 13069
406 Ga0501043_0030195 3300049579 Bacteria 4258
407 Ga0501043_0133743 3300049579 Bacteria 1943
408 Ga0501046_0059398 3300049580 Bacteria 2996
409 Ga0501046_0124056 3300049580 Bacteria 1963
410 Ga0501047_0000533 3300049581 Bacteria 41217
411 Ga0501047_0019293 3300049581 Bacteria 6541
412 Ga0501067_0000432 3300049583 Bacteria 22916
413 Ga0501068_0001942 3300049584 Bacteria 10993
414 Ga0501070_0102498 3300049586 Bacteria 2367
415 Ga0501070_0179909 3300049586 Bacteria 1740
416 Ga0501072_0000355 3300049588 Bacteria 32657
417 Ga0501073_0014862 3300049589 Bacteria 5649
418 Ga0501073_0069779 3300049589 Bacteria 2448
419 Ga0501074_0005295 3300049590 Bacteria 9290
420 Ga0501074_0006478 3300049590 Bacteria 8456
421 Ga0501079_0013806 3300049741 Bacteria 6159
422 Ga0501079_0119141 3300049741 Bacteria 2052
423 Ga0501080_0000308 3300049742 Bacteria 37426
424 Ga0501080_0002988 3300049742 Bacteria 14897
425 Ga0501080_0121820 3300049742 Bacteria 2416
426 Ga0501080_0207273 3300049742 Bacteria 1797
427 Ga0501080_0282875 3300049742 Bacteria 1507
428 Ga0501035_0184940 3300049822 Bacteria 1794
429 Ga0501035_0327710 3300049822 Bacteria 1285
430 Ga0501044_0004912 3300049823 Bacteria 14943
431 Ga0501044_0015147 3300049823 Bacteria 8310
432 nmdc:mga0n895_500_c1 3300050512 Bacteria 26537
433 Ga0500610_0002178 3300053079 Bacteria 7076
434 Ga0500583_0077471 3300053092 Bacteria 1600
435 Ga0500651_0001544 3300053093 Bacteria 11671
436 Ga0500651_0020977 3300053093 Bacteria 4070
437 Ga0500641_0056902 3300053096 Bacteria 1621
438 Ga0500562_021765 3300053108 Bacteria 1670
439 Ga0501084_0283442 3300054114 Bacteria 1399
440 Ga0501084_0404153 3300054114 Bacteria 1154
441 Ga0501082_0170795 3300060353 Bacteria 1890
442 Ga0466962_0005991 3300061719 Bacteria 5842

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0671953 Ga0451576_0671953_141_1076 281
2 3300039062 Ga0400483_190057 Ga0400483_190057_40025_41227 319
3 3300039062 Ga0400483_139389 Ga0400483_139389_1503_2696 339
4 3300039062 Ga0400483_238315 Ga0400483_238315_20527_21720 339
5 3300053092 Ga0500583_0077471 Ga0500583_0077471_68_1165 344
6 3300053096 Ga0500641_0056902 Ga0500641_0056902_138_1235 344
7 3300028563 Ga0265319_1009457 Ga0265319_10094573 345
8 3300028573 Ga0265334_10000674 Ga0265334_1000067412 345
9 3300031238 Ga0265332_10007285 Ga0265332_100072854 345
10 3300031239 Ga0265328_10015741 Ga0265328_100157412 345
11 3300031241 Ga0265325_10005872 Ga0265325_100058723 345
12 3300031242 Ga0265329_10004586 Ga0265329_100045862 345
13 3300031711 Ga0265314_10005701 Ga0265314_100057018 345
14 3300031250 Ga0265331_10032485 Ga0265331_100324852 346
15 3300035171 Ga0373946_0010327 Ga0373946_0010327_1988_3115 347
16 3300005455 Ga0070663_100061685 Ga0070663_1000616852 349
17 3300025932 Ga0207690_10262928 Ga0207690_102629281 349
18 3300045049 Ga0466959_0037720 Ga0466959_0037720_1716_2807 349
19 3300048921 Ga0496118_0000848 Ga0496118_0000848_37997_39208 349
20 3300054114 Ga0501084_0283442 Ga0501084_0283442_327_1382 349
21 3300005435 Ga0070714_100002426 Ga0070714_10000242616 352
22 3300025929 Ga0207664_10002312 Ga0207664_100023122 352
23 3300049571 Ga0501034_0001149 Ga0501034_0001149_33454_34542 352
24 3300046460 Ga0495638_0007919 Ga0495638_0007919_1085_2242 353
25 3300046460 Ga0495638_0063025 Ga0495638_0063025_757_1911 353
26 3300031247 Ga0265340_10000794 Ga0265340_1000079411 354
27 3300031249 Ga0265339_10005299 Ga0265339_100052992 354
28 3300031344 Ga0265316_10039478 Ga0265316_100394782 354
29 3300031595 Ga0265313_10000371 Ga0265313_1000037129 354
30 3300003759 Ga0055525_1000346 Ga0055525_100034626 355
31 3300003763 Ga0055529_1001113 Ga0055529_10011133 355
32 3300005328 Ga0070676_10048315 Ga0070676_100483152 355
33 3300005333 Ga0070677_10031429 Ga0070677_100314292 355
34 3300005365 Ga0070688_100150663 Ga0070688_1001506631 355
35 3300005466 Ga0070685_10046814 Ga0070685_100468142 355
36 3300006881 Ga0068865_100199942 Ga0068865_1001999421 355
37 3300013308 Ga0157375_10126484 Ga0157375_101264842 355
38 3300025893 Ga0207682_10003801 Ga0207682_100038011 355
39 3300025907 Ga0207645_10091424 Ga0207645_100914242 355
40 3300025940 Ga0207691_10016974 Ga0207691_100169745 355
41 3300026075 Ga0207708_10134386 Ga0207708_101343862 355
42 3300026118 Ga0207675_100102020 Ga0207675_1001020203 355
43 3300044693 Ga0466961_0002581 Ga0466961_0002581_6794_7888 355
44 3300044712 Ga0453684_0009060 Ga0453684_0009060_210_1301 355
45 3300046525 Ga0495663_0025299 Ga0495663_0025299_163_1293 355
46 3300006038 Ga0075365_10074845 Ga0075365_100748453 356
47 iso_pu_bacteria 2524614729 2525555810 356
48 iso_pu_bacteria 2627854209 2630650824 356
49 3300002741 JGI25157J39369_1002018 JGI25157J39369_10020185 357
50 3300042007 Ga0439449_0001643 Ga0439449_0001643_6688_7785 357
51 3300042007 Ga0439449_0004713 Ga0439449_0004713_255_1352 357
52 3300042015 Ga0439462_0009780 Ga0439462_0009780_239_1336 357
53 3300006051 Ga0075364_10040523 Ga0075364_100405233 358
54 3300005985 Ga0081539_10000188 Ga0081539_10000188144 359
55 3300006852 Ga0075433_10204625 Ga0075433_102046251 359
56 3300006871 Ga0075434_100000459 Ga0075434_1000004598 359
57 3300006914 Ga0075436_100042689 Ga0075436_1000426892 359
58 3300007076 Ga0075435_100003755 Ga0075435_1000037552 359
59 3300035207 Ga0373942_0017556 Ga0373942_0017556_21_1106 359
60 3300050512 nmdc:mga0n895_500_c1 nmdc:mga0n895_500_c1_5365_6450 359
61 3300005329 Ga0070683_100044026 Ga0070683_1000440263 360
62 3300005344 Ga0070661_100033794 Ga0070661_1000337943 360
63 3300005367 Ga0070667_100120085 Ga0070667_1001200853 360
64 3300005436 Ga0070713_100123526 Ga0070713_1001235263 360
65 3300005445 Ga0070708_100000191 Ga0070708_10000019133 360
66 3300005455 Ga0070663_100066966 Ga0070663_1000669661 360
67 3300005535 Ga0070684_100026965 Ga0070684_1000269653 360
68 3300005546 Ga0070696_100003358 Ga0070696_1000033584 360
69 3300005564 Ga0070664_100006469 Ga0070664_1000064693 360
70 3300005577 Ga0068857_100304573 Ga0068857_1003045731 360
71 3300005578 Ga0068854_100003005 Ga0068854_1000030053 360
72 3300005614 Ga0068856_100010470 Ga0068856_1000104704 360
73 3300005834 Ga0068851_10013705 Ga0068851_100137052 360
74 3300009098 Ga0105245_10084017 Ga0105245_100840172 360
75 3300009174 Ga0105241_10006875 Ga0105241_100068756 360
76 3300009174 Ga0105241_10008749 Ga0105241_100087493 360
77 3300013104 Ga0157370_10053829 Ga0157370_100538292 360
78 3300013104 Ga0157370_10299876 Ga0157370_102998762 360
79 3300013297 Ga0157378_10120018 Ga0157378_101200183 360
80 3300013307 Ga0157372_10222364 Ga0157372_102223642 360
81 3300014325 Ga0163163_10000453 Ga0163163_1000045341 360
82 3300025906 Ga0207699_10018557 Ga0207699_100185572 360
83 3300025911 Ga0207654_10002062 Ga0207654_100020625 360
84 3300025911 Ga0207654_10246511 Ga0207654_102465111 360
85 3300025912 Ga0207707_10032425 Ga0207707_100324253 360
86 3300025913 Ga0207695_10026788 Ga0207695_100267884 360
87 3300025916 Ga0207663_10002698 Ga0207663_1000269811 360
88 3300025917 Ga0207660_10100650 Ga0207660_101006503 360
89 3300025919 Ga0207657_10001542 Ga0207657_100015424 360
90 3300025920 Ga0207649_10058315 Ga0207649_100583152 360
91 3300025924 Ga0207694_10096388 Ga0207694_100963881 360
92 3300025927 Ga0207687_10047577 Ga0207687_100475775 360
93 3300025928 Ga0207700_10105016 Ga0207700_101050164 360
94 3300025929 Ga0207664_10185750 Ga0207664_101857502 360
95 3300025931 Ga0207644_10299241 Ga0207644_102992411 360
96 3300025945 Ga0207679_10156206 Ga0207679_101562062 360
97 3300025949 Ga0207667_10013899 Ga0207667_100138994 360
98 3300025981 Ga0207640_10010263 Ga0207640_100102633 360
99 3300026041 Ga0207639_10096503 Ga0207639_100965032 360
100 3300026041 Ga0207639_10224897 Ga0207639_102248972 360
101 3300026067 Ga0207678_10008650 Ga0207678_100086504 360
102 3300026078 Ga0207702_10125154 Ga0207702_101251542 360
103 3300026116 Ga0207674_10001959 Ga0207674_1000195915 360
104 3300026142 Ga0207698_10211237 Ga0207698_102112371 360
105 3300031241 Ga0265325_10003111 Ga0265325_100031118 360
106 3300031711 Ga0265314_10000512 Ga0265314_100005123 360
107 3300031727 Ga0316576_10108206 Ga0316576_101082062 360
108 3300031730 Ga0307516_10036822 Ga0307516_100368225 360
109 3300035398 Ga0316574_0076148 Ga0316574_0076148_199_1287 360
110 3300037418 Ga0395900_0199239 Ga0395900_0199239_319_1407 360
111 3300042876 Ga0451577_0040351 Ga0451577_0040351_993_2084 360
112 3300049569 Ga0501032_0033850 Ga0501032_0033850_1998_3086 360
113 3300049570 Ga0501033_0127584 Ga0501033_0127584_521_1609 360
114 3300049571 Ga0501034_0001308 Ga0501034_0001308_26165_27253 360
115 3300049571 Ga0501034_0037280 Ga0501034_0037280_1588_2709 360
116 3300049572 Ga0501036_0035164 Ga0501036_0035164_323_1411 360
117 3300049574 Ga0501038_0006089 Ga0501038_0006089_504_1592 360
118 3300049579 Ga0501043_0030195 Ga0501043_0030195_2369_3490 360
119 3300049579 Ga0501043_0133743 Ga0501043_0133743_698_1816 360
120 3300049580 Ga0501046_0059398 Ga0501046_0059398_1390_2511 360
121 3300049581 Ga0501047_0000533 Ga0501047_0000533_20809_21897 360
122 3300049581 Ga0501047_0019293 Ga0501047_0019293_2334_3455 360
123 3300049583 Ga0501067_0000432 Ga0501067_0000432_5108_6196 360
124 3300049584 Ga0501068_0001942 Ga0501068_0001942_9511_10599 360
125 3300049586 Ga0501070_0102498 Ga0501070_0102498_769_1887 360
126 3300049586 Ga0501070_0179909 Ga0501070_0179909_347_1435 360
127 3300049588 Ga0501072_0000355 Ga0501072_0000355_4208_5296 360
128 3300049589 Ga0501073_0069779 Ga0501073_0069779_1213_2334 360
129 3300049590 Ga0501074_0006478 Ga0501074_0006478_6809_7930 360
130 3300049742 Ga0501080_0000308 Ga0501080_0000308_3870_4988 360
131 3300049742 Ga0501080_0002988 Ga0501080_0002988_11053_12141 360
132 3300049742 Ga0501080_0207273 Ga0501080_0207273_241_1329 360
133 3300049742 Ga0501080_0282875 Ga0501080_0282875_314_1402 360
134 3300049822 Ga0501035_0184940 Ga0501035_0184940_428_1549 360
135 3300049823 Ga0501044_0015147 Ga0501044_0015147_3644_4765 360
136 3300053108 Ga0500562_021765 Ga0500562_021765_299_1387 360
137 3300054114 Ga0501084_0404153 Ga0501084_0404153_17_1105 360
138 iso_pu_bacteria 2895395659 2895398840 360
139 3300005331 Ga0070670_100070420 Ga0070670_1000704201 361
140 3300005335 Ga0070666_10000331 Ga0070666_1000033120 361
141 3300005335 Ga0070666_10003401 Ga0070666_100034017 361
142 3300005338 Ga0068868_100311836 Ga0068868_1003118361 361
143 3300005344 Ga0070661_100048393 Ga0070661_1000483931 361
144 3300005347 Ga0070668_100011687 Ga0070668_1000116876 361
145 3300005347 Ga0070668_100243472 Ga0070668_1002434722 361
146 3300005355 Ga0070671_100247558 Ga0070671_1002475582 361
147 3300005356 Ga0070674_100070248 Ga0070674_1000702483 361
148 3300005365 Ga0070688_100141531 Ga0070688_1001415312 361
149 3300005367 Ga0070667_100019757 Ga0070667_1000197578 361
150 3300005367 Ga0070667_100137125 Ga0070667_1001371253 361
151 3300005367 Ga0070667_100265338 Ga0070667_1002653381 361
152 3300005455 Ga0070663_100026426 Ga0070663_1000264261 361
153 3300005455 Ga0070663_100065075 Ga0070663_1000650753 361
154 3300005456 Ga0070678_100051708 Ga0070678_1000517084 361
155 3300005456 Ga0070678_100099894 Ga0070678_1000998942 361
156 3300005457 Ga0070662_100240512 Ga0070662_1002405121 361
157 3300005458 Ga0070681_10363842 Ga0070681_103638421 361
158 3300005466 Ga0070685_10000727 Ga0070685_100007273 361
159 3300005539 Ga0068853_100239510 Ga0068853_1002395102 361
160 3300005543 Ga0070672_100044477 Ga0070672_1000444773 361
161 3300005548 Ga0070665_100000172 Ga0070665_100000172105 361
162 3300005548 Ga0070665_100000525 Ga0070665_10000052514 361
163 3300005548 Ga0070665_100016842 Ga0070665_1000168428 361
164 3300005548 Ga0070665_100270647 Ga0070665_1002706472 361
165 3300005548 Ga0070665_100366709 Ga0070665_1003667091 361
166 3300005563 Ga0068855_100003763 Ga0068855_10000376312 361
167 3300005563 Ga0068855_100052236 Ga0068855_1000522362 361
168 3300005578 Ga0068854_100034071 Ga0068854_1000340714 361
169 3300005578 Ga0068854_100053862 Ga0068854_1000538623 361
170 3300005578 Ga0068854_100250181 Ga0068854_1002501811 361
171 3300005614 Ga0068856_100008501 Ga0068856_1000085014 361
172 3300005616 Ga0068852_100018137 Ga0068852_1000181377 361
173 3300005617 Ga0068859_100000125 Ga0068859_10000012546 361
174 3300005618 Ga0068864_100014993 Ga0068864_1000149938 361
175 3300005718 Ga0068866_10057890 Ga0068866_100578903 361
176 3300005834 Ga0068851_10010702 Ga0068851_100107025 361
177 3300005834 Ga0068851_10055966 Ga0068851_100559662 361
178 3300005841 Ga0068863_100010558 Ga0068863_1000105587 361
179 3300005841 Ga0068863_100069437 Ga0068863_1000694372 361
180 3300005842 Ga0068858_100004776 Ga0068858_1000047766 361
181 3300005842 Ga0068858_100238798 Ga0068858_1002387982 361
182 3300005843 Ga0068860_100013373 Ga0068860_1000133736 361
183 3300005843 Ga0068860_100056925 Ga0068860_1000569253 361
184 3300005844 Ga0068862_100001848 Ga0068862_1000018483 361
185 3300006237 Ga0097621_100215355 Ga0097621_1002153551 361
186 3300006237 Ga0097621_100254930 Ga0097621_1002549302 361
187 3300006358 Ga0068871_100178412 Ga0068871_1001784122 361
188 3300006931 Ga0097620_100000125 Ga0097620_10000012546 361
189 3300009093 Ga0105240_10001191 Ga0105240_100011915 361
190 3300009093 Ga0105240_10018544 Ga0105240_100185449 361
191 3300009093 Ga0105240_10028899 Ga0105240_100288996 361
192 3300009093 Ga0105240_10056802 Ga0105240_100568024 361
193 3300009093 Ga0105240_10494082 Ga0105240_104940821 361
194 3300009098 Ga0105245_10330245 Ga0105245_103302451 361
195 3300009174 Ga0105241_10002547 Ga0105241_100025478 361
196 3300009174 Ga0105241_10004069 Ga0105241_100040696 361
197 3300009174 Ga0105241_10184885 Ga0105241_101848852 361
198 3300009177 Ga0105248_10231129 Ga0105248_102311292 361
199 3300009177 Ga0105248_10310971 Ga0105248_103109711 361
200 3300009177 Ga0105248_10440017 Ga0105248_104400171 361
201 3300009545 Ga0105237_10003573 Ga0105237_1000357312 361
202 3300009545 Ga0105237_10010758 Ga0105237_100107585 361
203 3300009545 Ga0105237_10033402 Ga0105237_100334025 361
204 3300009545 Ga0105237_10045787 Ga0105237_100457872 361
205 3300009545 Ga0105237_10073581 Ga0105237_100735812 361
206 3300009551 Ga0105238_10000279 Ga0105238_1000027935 361
207 3300009551 Ga0105238_10000543 Ga0105238_100005436 361
208 3300009551 Ga0105238_10002402 Ga0105238_1000240212 361
209 3300009551 Ga0105238_10032943 Ga0105238_100329434 361
210 3300009551 Ga0105238_10290735 Ga0105238_102907352 361
211 3300009553 Ga0105249_10002587 Ga0105249_1000258712 361
212 3300010375 Ga0105239_10006672 Ga0105239_100066723 361
213 3300010375 Ga0105239_10008912 Ga0105239_100089128 361
214 3300010375 Ga0105239_10010432 Ga0105239_100104325 361
215 3300011119 Ga0105246_10049389 Ga0105246_100493892 361
216 3300013105 Ga0157369_10000148 Ga0157369_1000014856 361
217 3300013105 Ga0157369_10001162 Ga0157369_100011623 361
218 3300013105 Ga0157369_10047426 Ga0157369_100474262 361
219 3300013105 Ga0157369_10123759 Ga0157369_101237593 361
220 3300013296 Ga0157374_10033606 Ga0157374_100336065 361
221 3300013297 Ga0157378_10001845 Ga0157378_1000184515 361
222 3300013306 Ga0163162_10000007 Ga0163162_1000000742 361
223 3300013306 Ga0163162_10007109 Ga0163162_100071097 361
224 3300013306 Ga0163162_10008886 Ga0163162_100088867 361
225 3300013307 Ga0157372_10002301 Ga0157372_1000230121 361
226 3300013307 Ga0157372_10034832 Ga0157372_100348324 361
227 3300013307 Ga0157372_10265759 Ga0157372_102657593 361
228 3300013308 Ga0157375_10092470 Ga0157375_100924702 361
229 3300014325 Ga0163163_10003784 Ga0163163_1000378410 361
230 3300014325 Ga0163163_10257533 Ga0163163_102575332 361
231 3300014968 Ga0157379_10006295 Ga0157379_100062957 361
232 3300014969 Ga0157376_10002904 Ga0157376_100029047 361
233 3300014969 Ga0157376_10009502 Ga0157376_100095027 361
234 3300014969 Ga0157376_10016809 Ga0157376_100168094 361
235 3300017792 Ga0163161_10173435 Ga0163161_101734352 361
236 3300021384 Ga0213876_10061615 Ga0213876_100616152 361
237 3300025261 Ga0209233_1001860 Ga0209233_10018601 361
238 3300025321 Ga0207656_10073875 Ga0207656_100738752 361
239 3300025903 Ga0207680_10000602 Ga0207680_1000060213 361
240 3300025903 Ga0207680_10004192 Ga0207680_100041927 361
241 3300025903 Ga0207680_10009486 Ga0207680_100094861 361
242 3300025903 Ga0207680_10076371 Ga0207680_100763711 361
243 3300025904 Ga0207647_10020648 Ga0207647_100206484 361
244 3300025911 Ga0207654_10003310 Ga0207654_100033103 361
245 3300025911 Ga0207654_10106644 Ga0207654_101066442 361
246 3300025913 Ga0207695_10000033 Ga0207695_10000033285 361
247 3300025913 Ga0207695_10001009 Ga0207695_1000100922 361
248 3300025913 Ga0207695_10003620 Ga0207695_1000362017 361
249 3300025913 Ga0207695_10015316 Ga0207695_100153169 361
250 3300025913 Ga0207695_10149908 Ga0207695_101499083 361
251 3300025914 Ga0207671_10002084 Ga0207671_1000208419 361
252 3300025914 Ga0207671_10005445 Ga0207671_100054459 361
253 3300025914 Ga0207671_10005815 Ga0207671_100058156 361
254 3300025914 Ga0207671_10245817 Ga0207671_102458171 361
255 3300025916 Ga0207663_10178548 Ga0207663_101785481 361
256 3300025919 Ga0207657_10004253 Ga0207657_1000425313 361
257 3300025921 Ga0207652_10136453 Ga0207652_101364533 361
258 3300025924 Ga0207694_10000518 Ga0207694_100005186 361
259 3300025924 Ga0207694_10001353 Ga0207694_1000135318 361
260 3300025924 Ga0207694_10001468 Ga0207694_100014688 361
261 3300025924 Ga0207694_10037008 Ga0207694_100370085 361
262 3300025924 Ga0207694_10151840 Ga0207694_101518402 361
263 3300025925 Ga0207650_10135549 Ga0207650_101355492 361
264 3300025925 Ga0207650_10158287 Ga0207650_101582872 361
265 3300025926 Ga0207659_10230283 Ga0207659_102302831 361
266 3300025933 Ga0207706_10065731 Ga0207706_100657312 361
267 3300025938 Ga0207704_10017563 Ga0207704_100175634 361
268 3300025940 Ga0207691_10094011 Ga0207691_100940111 361
269 3300025940 Ga0207691_10129292 Ga0207691_101292923 361
270 3300025942 Ga0207689_10028856 Ga0207689_100288566 361
271 3300025942 Ga0207689_10082603 Ga0207689_100826032 361
272 3300025942 Ga0207689_10128871 Ga0207689_101288712 361
273 3300025944 Ga0207661_10137117 Ga0207661_101371172 361
274 3300025945 Ga0207679_10112280 Ga0207679_101122802 361
275 3300025949 Ga0207667_10004923 Ga0207667_1000492312 361
276 3300025949 Ga0207667_10047285 Ga0207667_100472853 361
277 3300025960 Ga0207651_10092396 Ga0207651_100923963 361
278 3300025961 Ga0207712_10000466 Ga0207712_1000046618 361
279 3300025972 Ga0207668_10048019 Ga0207668_100480192 361
280 3300026023 Ga0207677_10246814 Ga0207677_102468142 361
281 3300026035 Ga0207703_10000759 Ga0207703_1000075913 361
282 3300026035 Ga0207703_10110012 Ga0207703_101100122 361
283 3300026035 Ga0207703_10362900 Ga0207703_103629001 361
284 3300026041 Ga0207639_10000364 Ga0207639_1000036413 361
285 3300026041 Ga0207639_10045732 Ga0207639_100457325 361
286 3300026067 Ga0207678_10014385 Ga0207678_100143858 361
287 3300026078 Ga0207702_10014535 Ga0207702_100145358 361
288 3300026078 Ga0207702_10166321 Ga0207702_101663212 361
289 3300026088 Ga0207641_10128924 Ga0207641_101289241 361
290 3300026088 Ga0207641_10200077 Ga0207641_102000772 361
291 3300026088 Ga0207641_10235557 Ga0207641_102355571 361
292 3300026089 Ga0207648_10016001 Ga0207648_100160014 361
293 3300026095 Ga0207676_10008618 Ga0207676_100086182 361
294 3300026116 Ga0207674_10010039 Ga0207674_100100397 361
295 3300026118 Ga0207675_100204416 Ga0207675_1002044162 361
296 3300026121 Ga0207683_10076353 Ga0207683_100763534 361
297 3300026142 Ga0207698_10014241 Ga0207698_100142415 361
298 3300028379 Ga0268266_10000001 Ga0268266_100000011575 361
299 3300028379 Ga0268266_10000006 Ga0268266_10000006918 361
300 3300028379 Ga0268266_10371286 Ga0268266_103712861 361
301 3300028380 Ga0268265_10000664 Ga0268265_100006642 361
302 3300028381 Ga0268264_10008844 Ga0268264_100088446 361
303 3300028381 Ga0268264_10148789 Ga0268264_101487892 361
304 3300031824 Ga0307413_10003648 Ga0307413_100036485 361
305 3300031903 Ga0307407_10004814 Ga0307407_100048142 361
306 3300032005 Ga0307411_10112649 Ga0307411_101126492 361
307 3300032133 Ga0316583_10010814 Ga0316583_100108144 361
308 3300032168 Ga0316593_10056754 Ga0316593_100567541 361
309 3300032168 Ga0316593_10059370 Ga0316593_100593701 361
310 3300032168 Ga0316593_10070287 Ga0316593_100702871 361
311 3300033527 Ga0316586_1005399 Ga0316586_10053992 361
312 3300033528 Ga0316588_1025538 Ga0316588_10255381 361
313 3300033528 Ga0316588_1032652 Ga0316588_10326521 361
314 3300033529 Ga0316587_1005688 Ga0316587_10056881 361
315 3300033541 Ga0316596_1031007 Ga0316596_10310071 361
316 3300035086 Ga0373934_0000137 Ga0373934_0000137_8483_9574 361
317 3300035089 Ga0373944_0007726 Ga0373944_0007726_418_1509 361
318 3300035117 Ga0373953_0018085 Ga0373953_0018085_385_1476 361
319 3300035119 Ga0373956_0000018 Ga0373956_0000018_5384_6475 361
320 3300035119 Ga0373956_0075706 Ga0373956_0075706_360_1451 361
321 3300035120 Ga0373957_0039682 Ga0373957_0039682_226_1317 361
322 3300035172 Ga0373955_0020468 Ga0373955_0020468_1890_2981 361
323 3300035172 Ga0373955_0052312 Ga0373955_0052312_772_1863 361
324 3300035398 Ga0316574_0008541 Ga0316574_0008541_1340_2431 361
325 3300035398 Ga0316574_0022837 Ga0316574_0022837_893_1984 361
326 3300035724 Ga0373933_0000035 Ga0373933_0000035_7229_8320 361
327 3300035725 Ga0373947_0171089 Ga0373947_0171089_249_1340 361
328 3300036401 Ga0373937_0001322 Ga0373937_0001322_5615_6706 361
329 3300036401 Ga0373937_0114236 Ga0373937_0114236_766_1857 361
330 3300036647 Ga0316582_0094391 Ga0316582_0094391_759_1850 361
331 3300036712 Ga0316584_0052178 Ga0316584_0052178_273_1364 361
332 3300036712 Ga0316584_0068488 Ga0316584_0068488_98_1189 361
333 3300037588 Ga0316581_0049292 Ga0316581_0049292_67_1158 361
334 3300038726 Ga0400490_20921 Ga0400490_20921_7610_8701 361
335 3300038735 Ga0400485_13101 Ga0400485_13101_22887_23978 361
336 3300038742 Ga0400486_18851 Ga0400486_18851_33267_34358 361
337 3300039062 Ga0400483_138703 Ga0400483_138703_39_1145 361
338 3300039062 Ga0400483_288087 Ga0400483_288087_4871_5962 361
339 3300039110 Ga0400487_38243 Ga0400487_38243_59713_60804 361
340 3300039110 Ga0400487_49718 Ga0400487_49718_3683_4774 361
341 3300039437 Ga0436365_1656463 Ga0436365_1656463_493_1734 361
342 3300041512 Ga0451853_1659196 Ga0451853_1659196_316_1407 361
343 3300042876 Ga0451577_0130137 Ga0451577_0130137_129_1220 361
344 3300044712 Ga0453684_0000298 Ga0453684_0000298_50005_51090 361
345 3300044712 Ga0453684_0047807 Ga0453684_0047807_2366_3460 361
346 3300045051 Ga0451576_0000033 Ga0451576_0000033_342042_343127 361
347 3300046462 Ga0495651_0004232 Ga0495651_0004232_3712_4803 361
348 3300046535 Ga0495586_0027998 Ga0495586_0027998_492_1583 361
349 3300048906 Ga0496103_0132042 Ga0496103_0132042_381_1544 361
350 3300048907 Ga0496104_0000011 Ga0496104_0000011_34187_35278 361
351 3300048908 Ga0496105_0000014 Ga0496105_0000014_34214_35305 361
352 3300048917 Ga0496114_0242025 Ga0496114_0242025_312_1403 361
353 3300048918 Ga0496115_0000869 Ga0496115_0000869_19867_20958 361
354 3300048920 Ga0496117_0061693 Ga0496117_0061693_27_1118 361
355 3300048921 Ga0496118_0030098 Ga0496118_0030098_2012_3103 361
356 3300048929 Ga0496126_0000033 Ga0496126_0000033_230916_232007 361
357 3300049568 Ga0501031_0054651 Ga0501031_0054651_388_1479 361
358 3300049569 Ga0501032_0005005 Ga0501032_0005005_4994_6085 361
359 3300049570 Ga0501033_0003490 Ga0501033_0003490_9703_10794 361
360 3300049572 Ga0501036_0006509 Ga0501036_0006509_7116_8207 361
361 3300049573 Ga0501037_0054306 Ga0501037_0054306_807_1898 361
362 3300049575 Ga0501039_0041672 Ga0501039_0041672_2286_3377 361
363 3300049579 Ga0501043_0003408 Ga0501043_0003408_5848_6939 361
364 3300049580 Ga0501046_0124056 Ga0501046_0124056_501_1592 361
365 3300049589 Ga0501073_0014862 Ga0501073_0014862_4445_5536 361
366 3300049590 Ga0501074_0005295 Ga0501074_0005295_5568_6659 361
367 3300049741 Ga0501079_0013806 Ga0501079_0013806_4751_5872 361
368 3300049741 Ga0501079_0119141 Ga0501079_0119141_635_1726 361
369 3300049742 Ga0501080_0121820 Ga0501080_0121820_1282_2373 361
370 3300049822 Ga0501035_0327710 Ga0501035_0327710_30_1121 361
371 3300049823 Ga0501044_0004912 Ga0501044_0004912_470_1561 361
372 3300053079 Ga0500610_0002178 Ga0500610_0002178_5292_6383 361
373 3300053093 Ga0500651_0001544 Ga0500651_0001544_3399_4490 361
374 3300053093 Ga0500651_0020977 Ga0500651_0020977_882_1973 361
375 3300060353 Ga0501082_0170795 Ga0501082_0170795_324_1415 361
376 3300005366 Ga0070659_100119535 Ga0070659_1001195353 362
377 3300005547 Ga0070693_100007586 Ga0070693_1000075863 362
378 3300002741 JGI25157J39369_1000362 JGI25157J39369_10003629 364
379 3300003752 Ga0055539_1002649 Ga0055539_10026493 364
380 3300003756 Ga0055533_1007117 Ga0055533_10071171 364
381 3300003760 Ga0055527_1000149 Ga0055527_100014918 364
382 3300003761 Ga0055535_1000395 Ga0055535_100039524 364
383 3300003761 Ga0055535_1000819 Ga0055535_10008193 364
384 3300003761 Ga0055535_1001546 Ga0055535_10015469 364
385 3300003762 Ga0055542_1000167 Ga0055542_100016720 364
386 3300003762 Ga0055542_1000364 Ga0055542_100036426 364
387 3300003763 Ga0055529_1000468 Ga0055529_100046819 364
388 3300003763 Ga0055529_1000706 Ga0055529_10007063 364
389 3300005577 Ga0068857_100052530 Ga0068857_1000525303 364
390 3300005614 Ga0068856_100001479 Ga0068856_1000014799 364
391 3300025226 Ga0209674_100202 Ga0209674_10020216 364
392 3300025228 Ga0209672_100018 Ga0209672_100018248 364
393 3300025228 Ga0209672_101705 Ga0209672_1017052 364
394 3300025242 Ga0209258_100024 Ga0209258_100024354 364
395 3300025242 Ga0209258_100035 Ga0209258_100035176 364
396 3300025250 Ga0209026_1000056 Ga0209026_1000056133 364
397 3300025253 Ga0209677_101847 Ga0209677_1018475 364
398 3300025254 Ga0209148_1000009 Ga0209148_1000009682 364
399 3300025254 Ga0209148_1000048 Ga0209148_1000048186 364
400 3300025256 Ga0209759_1000166 Ga0209759_100016614 364
401 3300025272 Ga0209455_1000029 Ga0209455_1000029354 364
402 3300025272 Ga0209455_1006982 Ga0209455_10069823 364
403 3300026078 Ga0207702_10001263 Ga0207702_100012632 364
404 3300026116 Ga0207674_10060159 Ga0207674_100601593 364
405 3300037312 Ga0395899_0000119 Ga0395899_0000119_118781_119875 364
406 3300037312 Ga0395899_0015223 Ga0395899_0015223_798_1892 364
407 3300037418 Ga0395900_0000107 Ga0395900_0000107_101170_102264 364
408 3300037466 Ga0395898_0000078 Ga0395898_0000078_62278_63372 364
409 3300037466 Ga0395898_0000211 Ga0395898_0000211_45820_46914 364
410 3300038443 Ga0395901_0072978 Ga0395901_0072978_581_1675 364
411 3300044656 Ga0466969_0050242 Ga0466969_0050242_791_1885 364
412 3300044684 Ga0466966_0050915 Ga0466966_0050915_791_1885 364
413 3300044693 Ga0466961_0002840 Ga0466961_0002840_3983_5077 364
414 3300044693 Ga0466961_0010232 Ga0466961_0010232_592_1686 364
415 3300044693 Ga0466961_0031115 Ga0466961_0031115_1338_2432 364
416 3300044719 Ga0466971_0007954 Ga0466971_0007954_1836_2930 364
417 3300044765 Ga0466970_0007214 Ga0466970_0007214_3023_4117 364
418 3300044842 Ga0466957_0039121 Ga0466957_0039121_737_1831 364
419 3300044842 Ga0466957_0115012 Ga0466957_0115012_564_1658 364
420 3300045049 Ga0466959_0000110 Ga0466959_0000110_46198_47292 364
421 3300045049 Ga0466959_0018905 Ga0466959_0018905_2776_3870 364
422 3300045836 Ga0466958_0001437 Ga0466958_0001437_8375_9469 364
423 3300045836 Ga0466958_0027721 Ga0466958_0027721_357_1451 364
424 3300045976 Ga0466967_0321074 Ga0466967_0321074_268_1362 364
425 3300048922 Ga0496119_0078933 Ga0496119_0078933_787_1881 364
426 3300048923 Ga0496120_0001713 Ga0496120_0001713_22835_23929 364
427 3300048929 Ga0496126_0115285 Ga0496126_0115285_620_1714 364
428 3300061719 Ga0466962_0005991 Ga0466962_0005991_766_1860 364
429 3300002737 JGI25162J39368_1001112 JGI25162J39368_10011128 365
430 3300002741 JGI25157J39369_1002330 JGI25157J39369_10023304 365
431 3300002772 JGI25164J39214_1000331 JGI25164J39214_10003318 365
432 3300003214 JGI25165J46597_1000158 JGI25165J46597_10001588 365
433 3300003761 Ga0055535_1000657 Ga0055535_100065719 365
434 3300003762 Ga0055542_1000657 Ga0055542_10006578 365
435 3300003763 Ga0055529_1000593 Ga0055529_100059319 365
436 3300025228 Ga0209672_100198 Ga0209672_10019821 365
437 3300025231 Ga0207427_100036 Ga0207427_100036227 365
438 3300025233 Ga0209437_100127 Ga0209437_100127170 365
439 3300025242 Ga0209258_100256 Ga0209258_1002568 365
440 3300025246 Ga0209646_1002938 Ga0209646_10029383 365
441 3300025250 Ga0209026_1001174 Ga0209026_10011743 365
442 3300025254 Ga0209148_1000045 Ga0209148_100004563 365
443 3300025256 Ga0209759_1000670 Ga0209759_100067024 365
444 3300025261 Ga0209233_1000101 Ga0209233_1000101227 365
445 3300025272 Ga0209455_1000035 Ga0209455_100003563 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

168

412

0.98

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

77

150

0.97

PF13614

AAA_31

AAA domain

170

222

0.95

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

173

391

0.87

PF09140

MipZ

ATPase MipZ

171

330

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
5aun-assembly1.cif.gz_B crystal structure of the hypab-ni complex 0.9068 94 338
6oby-assembly1.cif.gz_A the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus with co found by pixe. based on 3kb1. 0.8996 94 328
5auq-assembly2.cif.gz_E crystal structure of atpase-type hypb in the nucleotide free state 0.8931 94 338
5auq-assembly4.cif.gz_F crystal structure of atpase-type hypb in the nucleotide free state 0.8893 94 338
5auq-assembly1.cif.gz_H crystal structure of atpase-type hypb in the nucleotide free state 0.8882 94 338
ID Description Score Start End Superfamily
af_Q6DH61_70_326_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9754 93 344 3.40.50.300
af_A0A1D6KXI0_31_322_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9586 94 343 3.40.50.300
af_Q6DH61_70_326_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.953 93 344 3.40.50.300
af_Q9V9M8_34_292_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9486 93 338 3.40.50.300
af_Q57731_34_290_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.946 93 343 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3G9HYL5-F1-model_v4 Protein mrp 0.9878 206 343 GO:0005524
GO:0005829
GO:0016226
GO:0046872
GO:0051539
GO:0140663
AF-A0A7Z0QS16-F1-model_v4 Iron-sulfur cluster carrier protein 0.9837 83 349 GO:0005524
GO:0005829
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663
AF-A0A377ZC90-F1-model_v4 Iron-sulfur cluster carrier protein 0.9834 99 343 GO:0005524
GO:0005829
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663
AF-A0A4V1A8H0-F1-model_v4 deleted 0.9824 83 349
AF-A0A0R0AHM7-F1-model_v4 Iron-sulfur cluster carrier protein 0.9821 81 348 GO:0005524
GO:0005829
GO:0016226
GO:0016887
GO:0046872
GO:0051539
GO:0140663

Feature Viewer

pLDDT pTM Quality
89.4 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map