F445483
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 445 | 256 | 442 | 364 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10028899|Ga0105240_100288996 |
| Length | 434 |
| Sequence | VANCRALWISGRFRQVTALQLCGQGGVHGVGCNAASNGLDLERNAPRQPSRTCRNRFGSVTIKTRPFFLSAMTQANDERVRALLATVIDPHTGQDLVAGGALKGVGVDGGNVAVDIALGYPAQTFAPVLAEQVRAALRADPAIADASVNVTSRVRAHKVQKELMPLPNVKNIIAVASGKGGVGKSTTAVNLALALVAEGAQVGVLDADIYGPSIPRMLGVSGKPDTKDGQHLEPKLAHGVQAMSIGFMIEEDTPMIWRGPMVTQALTQLLNETNWVDLDYLIIDLPPGTGDIQLTLCQRVPVSGALIVTTPQDIALLDAKKALKMFEKVEVPVLGIIENMALHTCSHCGHTEHIFGSGGGEKMATQYGVPLLGSLPLDIHIREQADGGAPSVAADPSSAVAASYREIARKAAAQLSLHARSKSIQFPKIVIQNT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 2 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 3 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 94 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 157 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 163 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 168 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 186 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 193 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 194 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 195 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 196 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 197 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 198 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 199 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 200 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 201 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 202 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 203 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 204 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 205 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 206 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 207 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 223 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 224 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 225 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 226 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 227 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 250 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 251 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 252 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 253 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 254 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.53 |
| Metatranscriptomes | 1.8 |
| Isolates | 0.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.89 |
| Nodule | 0 |
| Rhizoplane | 1.12 |
| Rhizosphere | 82.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1001112 | 3300002737 | Bacteria | 16257 |
| 2 | JGI25157J39369_1000362 | 3300002741 | Bacteria | 31445 |
| 3 | JGI25157J39369_1002018 | 3300002741 | Bacteria | 5884 |
| 4 | JGI25157J39369_1002330 | 3300002741 | Bacteria | 4926 |
| 5 | JGI25164J39214_1000331 | 3300002772 | Bacteria | 30265 |
| 6 | JGI25165J46597_1000158 | 3300003214 | Bacteria | 108257 |
| 7 | Ga0055539_1002649 | 3300003752 | Bacteria | 2669 |
| 8 | Ga0055533_1007117 | 3300003756 | Bacteria | 1558 |
| 9 | Ga0055525_1000346 | 3300003759 | Bacteria | 33587 |
| 10 | Ga0055527_1000149 | 3300003760 | Bacteria | 49224 |
| 11 | Ga0055535_1000395 | 3300003761 | Bacteria | 41210 |
| 12 | Ga0055535_1000657 | 3300003761 | Bacteria | 27351 |
| 13 | Ga0055535_1000819 | 3300003761 | Bacteria | 22334 |
| 14 | Ga0055535_1001546 | 3300003761 | Bacteria | 11242 |
| 15 | Ga0055542_1000167 | 3300003762 | Bacteria | 83068 |
| 16 | Ga0055542_1000364 | 3300003762 | Bacteria | 47003 |
| 17 | Ga0055542_1000657 | 3300003762 | Bacteria | 28386 |
| 18 | Ga0055529_1000468 | 3300003763 | Bacteria | 39125 |
| 19 | Ga0055529_1000593 | 3300003763 | Bacteria | 28386 |
| 20 | Ga0055529_1000706 | 3300003763 | Bacteria | 22334 |
| 21 | Ga0055529_1001113 | 3300003763 | Bacteria | 11820 |
| 22 | Ga0070676_10048315 | 3300005328 | Bacteria | 2487 |
| 23 | Ga0070683_100044026 | 3300005329 | Bacteria | 4115 |
| 24 | Ga0070670_100070420 | 3300005331 | Bacteria | 3002 |
| 25 | Ga0070677_10031429 | 3300005333 | Bacteria | 2029 |
| 26 | Ga0070666_10000331 | 3300005335 | Bacteria | 29851 |
| 27 | Ga0070666_10003401 | 3300005335 | Bacteria | 9642 |
| 28 | Ga0068868_100311836 | 3300005338 | Bacteria | 1338 |
| 29 | Ga0070661_100033794 | 3300005344 | Bacteria | 3707 |
| 30 | Ga0070661_100048393 | 3300005344 | Bacteria | 3112 |
| 31 | Ga0070668_100011687 | 3300005347 | Bacteria | 6536 |
| 32 | Ga0070668_100243472 | 3300005347 | Bacteria | 1491 |
| 33 | Ga0070671_100247558 | 3300005355 | Bacteria | 1514 |
| 34 | Ga0070674_100070248 | 3300005356 | Bacteria | 2473 |
| 35 | Ga0070688_100141531 | 3300005365 | Bacteria | 1634 |
| 36 | Ga0070688_100150663 | 3300005365 | Bacteria | 1590 |
| 37 | Ga0070659_100119535 | 3300005366 | Bacteria | 2133 |
| 38 | Ga0070667_100019757 | 3300005367 | Bacteria | 5590 |
| 39 | Ga0070667_100120085 | 3300005367 | Bacteria | 2286 |
| 40 | Ga0070667_100137125 | 3300005367 | Bacteria | 2140 |
| 41 | Ga0070667_100265338 | 3300005367 | Bacteria | 1538 |
| 42 | Ga0070714_100002426 | 3300005435 | Bacteria | 13730 |
| 43 | Ga0070713_100123526 | 3300005436 | Bacteria | 2274 |
| 44 | Ga0070708_100000191 | 3300005445 | Bacteria | 44404 |
| 45 | Ga0070663_100026426 | 3300005455 | Bacteria | 3933 |
| 46 | Ga0070663_100061685 | 3300005455 | Bacteria | 2700 |
| 47 | Ga0070663_100065075 | 3300005455 | Bacteria | 2637 |
| 48 | Ga0070663_100066966 | 3300005455 | Bacteria | 2604 |
| 49 | Ga0070678_100051708 | 3300005456 | Bacteria | 2980 |
| 50 | Ga0070678_100099894 | 3300005456 | Bacteria | 2246 |
| 51 | Ga0070662_100240512 | 3300005457 | Bacteria | 1452 |
| 52 | Ga0070681_10363842 | 3300005458 | Bacteria | 1357 |
| 53 | Ga0070685_10000727 | 3300005466 | Bacteria | 17936 |
| 54 | Ga0070685_10046814 | 3300005466 | Bacteria | 2484 |
| 55 | Ga0070684_100026965 | 3300005535 | Bacteria | 4844 |
| 56 | Ga0068853_100239510 | 3300005539 | Bacteria | 1662 |
| 57 | Ga0070672_100044477 | 3300005543 | Bacteria | 3430 |
| 58 | Ga0070696_100003358 | 3300005546 | Bacteria | 10677 |
| 59 | Ga0070693_100007586 | 3300005547 | Bacteria | 5309 |
| 60 | Ga0070665_100000172 | 3300005548 | Bacteria | 115040 |
| 61 | Ga0070665_100000525 | 3300005548 | Bacteria | 54632 |
| 62 | Ga0070665_100016842 | 3300005548 | Bacteria | 7329 |
| 63 | Ga0070665_100270647 | 3300005548 | Bacteria | 1700 |
| 64 | Ga0070665_100366709 | 3300005548 | Bacteria | 1447 |
| 65 | Ga0068855_100003763 | 3300005563 | Bacteria | 18547 |
| 66 | Ga0068855_100052236 | 3300005563 | Bacteria | 4812 |
| 67 | Ga0070664_100006469 | 3300005564 | Bacteria | 9443 |
| 68 | Ga0068857_100052530 | 3300005577 | Bacteria | 3616 |
| 69 | Ga0068857_100304573 | 3300005577 | Bacteria | 1469 |
| 70 | Ga0068854_100003005 | 3300005578 | Bacteria | 10470 |
| 71 | Ga0068854_100034071 | 3300005578 | Bacteria | 3554 |
| 72 | Ga0068854_100053862 | 3300005578 | Bacteria | 2891 |
| 73 | Ga0068854_100250181 | 3300005578 | Bacteria | 1415 |
| 74 | Ga0068856_100001479 | 3300005614 | Bacteria | 24602 |
| 75 | Ga0068856_100008501 | 3300005614 | Bacteria | 9985 |
| 76 | Ga0068856_100010470 | 3300005614 | Bacteria | 9003 |
| 77 | Ga0068852_100018137 | 3300005616 | Bacteria | 5540 |
| 78 | Ga0068859_100000125 | 3300005617 | Bacteria | 72938 |
| 79 | Ga0068864_100014993 | 3300005618 | Bacteria | 6443 |
| 80 | Ga0068866_10057890 | 3300005718 | Bacteria | 1999 |
| 81 | Ga0068851_10010702 | 3300005834 | Bacteria | 4286 |
| 82 | Ga0068851_10013705 | 3300005834 | Bacteria | 3838 |
| 83 | Ga0068851_10055966 | 3300005834 | Bacteria | 2010 |
| 84 | Ga0068863_100010558 | 3300005841 | Bacteria | 8966 |
| 85 | Ga0068863_100069437 | 3300005841 | Bacteria | 3331 |
| 86 | Ga0068858_100004776 | 3300005842 | Bacteria | 13274 |
| 87 | Ga0068858_100238798 | 3300005842 | Bacteria | 1724 |
| 88 | Ga0068860_100013373 | 3300005843 | Bacteria | 8046 |
| 89 | Ga0068860_100056925 | 3300005843 | Bacteria | 3716 |
| 90 | Ga0068862_100001848 | 3300005844 | Bacteria | 19196 |
| 91 | Ga0081539_10000188 | 3300005985 | Bacteria | 143987 |
| 92 | Ga0075365_10074845 | 3300006038 | Bacteria | 2284 |
| 93 | Ga0075364_10040523 | 3300006051 | Bacteria | 3021 |
| 94 | Ga0097621_100215355 | 3300006237 | Bacteria | 1672 |
| 95 | Ga0097621_100254930 | 3300006237 | Bacteria | 1538 |
| 96 | Ga0068871_100178412 | 3300006358 | Bacteria | 1824 |
| 97 | Ga0075433_10204625 | 3300006852 | Bacteria | 1755 |
| 98 | Ga0075434_100000459 | 3300006871 | Bacteria | 30427 |
| 99 | Ga0068865_100199942 | 3300006881 | Bacteria | 1551 |
| 100 | Ga0075436_100042689 | 3300006914 | Bacteria | 3128 |
| 101 | Ga0097620_100000125 | 3300006931 | Bacteria | 72938 |
| 102 | Ga0075435_100003755 | 3300007076 | Bacteria | 10346 |
| 103 | Ga0105240_10001191 | 3300009093 | Bacteria | 45336 |
| 104 | Ga0105240_10018544 | 3300009093 | Bacteria | 9340 |
| 105 | Ga0105240_10028899 | 3300009093 | Bacteria | 7232 |
| 106 | Ga0105240_10056802 | 3300009093 | Bacteria | 4895 |
| 107 | Ga0105240_10494082 | 3300009093 | Bacteria | 1362 |
| 108 | Ga0105245_10084017 | 3300009098 | Bacteria | 2915 |
| 109 | Ga0105245_10330245 | 3300009098 | Bacteria | 1505 |
| 110 | Ga0105241_10002547 | 3300009174 | Bacteria | 13684 |
| 111 | Ga0105241_10004069 | 3300009174 | Bacteria | 10805 |
| 112 | Ga0105241_10006875 | 3300009174 | Bacteria | 8370 |
| 113 | Ga0105241_10008749 | 3300009174 | Bacteria | 7438 |
| 114 | Ga0105241_10184885 | 3300009174 | Bacteria | 1731 |
| 115 | Ga0105248_10231129 | 3300009177 | Bacteria | 2082 |
| 116 | Ga0105248_10310971 | 3300009177 | Bacteria | 1774 |
| 117 | Ga0105248_10440017 | 3300009177 | Bacteria | 1469 |
| 118 | Ga0105237_10003573 | 3300009545 | Bacteria | 18410 |
| 119 | Ga0105237_10010758 | 3300009545 | Bacteria | 9710 |
| 120 | Ga0105237_10033402 | 3300009545 | Bacteria | 5212 |
| 121 | Ga0105237_10045787 | 3300009545 | Bacteria | 4401 |
| 122 | Ga0105237_10073581 | 3300009545 | Bacteria | 3409 |
| 123 | Ga0105238_10000279 | 3300009551 | Bacteria | 56624 |
| 124 | Ga0105238_10000543 | 3300009551 | Bacteria | 39418 |
| 125 | Ga0105238_10002402 | 3300009551 | Bacteria | 18777 |
| 126 | Ga0105238_10032943 | 3300009551 | Bacteria | 5274 |
| 127 | Ga0105238_10290735 | 3300009551 | Bacteria | 1616 |
| 128 | Ga0105249_10002587 | 3300009553 | Bacteria | 15661 |
| 129 | Ga0105239_10006672 | 3300010375 | Bacteria | 13334 |
| 130 | Ga0105239_10008912 | 3300010375 | Bacteria | 11352 |
| 131 | Ga0105239_10010432 | 3300010375 | Bacteria | 10388 |
| 132 | Ga0105246_10049389 | 3300011119 | Bacteria | 2881 |
| 133 | Ga0157370_10053829 | 3300013104 | Bacteria | 3837 |
| 134 | Ga0157370_10299876 | 3300013104 | Bacteria | 1484 |
| 135 | Ga0157369_10000148 | 3300013105 | Bacteria | 100073 |
| 136 | Ga0157369_10001162 | 3300013105 | Bacteria | 32848 |
| 137 | Ga0157369_10047426 | 3300013105 | Bacteria | 4665 |
| 138 | Ga0157369_10123759 | 3300013105 | Bacteria | 2743 |
| 139 | Ga0157374_10033606 | 3300013296 | Bacteria | 4681 |
| 140 | Ga0157378_10001845 | 3300013297 | Bacteria | 19027 |
| 141 | Ga0157378_10120018 | 3300013297 | Bacteria | 2422 |
| 142 | Ga0163162_10000007 | 3300013306 | Bacteria | 368084 |
| 143 | Ga0163162_10007109 | 3300013306 | Bacteria | 10860 |
| 144 | Ga0163162_10008886 | 3300013306 | Bacteria | 9771 |
| 145 | Ga0157372_10002301 | 3300013307 | Bacteria | 20714 |
| 146 | Ga0157372_10034832 | 3300013307 | Bacteria | 5539 |
| 147 | Ga0157372_10222364 | 3300013307 | Bacteria | 2188 |
| 148 | Ga0157372_10265759 | 3300013307 | Bacteria | 1992 |
| 149 | Ga0157375_10092470 | 3300013308 | Bacteria | 3089 |
| 150 | Ga0157375_10126484 | 3300013308 | Bacteria | 2671 |
| 151 | Ga0163163_10000453 | 3300014325 | Bacteria | 37388 |
| 152 | Ga0163163_10003784 | 3300014325 | Bacteria | 12887 |
| 153 | Ga0163163_10257533 | 3300014325 | Bacteria | 1796 |
| 154 | Ga0157379_10006295 | 3300014968 | Bacteria | 10221 |
| 155 | Ga0157376_10002904 | 3300014969 | Bacteria | 11749 |
| 156 | Ga0157376_10009502 | 3300014969 | Bacteria | 7066 |
| 157 | Ga0157376_10016809 | 3300014969 | Bacteria | 5565 |
| 158 | Ga0163161_10173435 | 3300017792 | Bacteria | 1650 |
| 159 | Ga0213876_10061615 | 3300021384 | Bacteria | 1980 |
| 160 | Ga0209674_100202 | 3300025226 | Bacteria | 61028 |
| 161 | Ga0209672_100018 | 3300025228 | Bacteria | 432924 |
| 162 | Ga0209672_100198 | 3300025228 | Bacteria | 47906 |
| 163 | Ga0209672_101705 | 3300025228 | Bacteria | 7065 |
| 164 | Ga0207427_100036 | 3300025231 | Bacteria | 309540 |
| 165 | Ga0209437_100127 | 3300025233 | Bacteria | 190741 |
| 166 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 167 | Ga0209258_100035 | 3300025242 | Bacteria | 430864 |
| 168 | Ga0209258_100256 | 3300025242 | Bacteria | 93548 |
| 169 | Ga0209646_1002938 | 3300025246 | Bacteria | 3548 |
| 170 | Ga0209026_1000056 | 3300025250 | Bacteria | 236450 |
| 171 | Ga0209026_1001174 | 3300025250 | Bacteria | 12151 |
| 172 | Ga0209677_101847 | 3300025253 | Bacteria | 8619 |
| 173 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 174 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 175 | Ga0209148_1000048 | 3300025254 | Bacteria | 430913 |
| 176 | Ga0209759_1000166 | 3300025256 | Bacteria | 113080 |
| 177 | Ga0209759_1000670 | 3300025256 | Bacteria | 31566 |
| 178 | Ga0209233_1000101 | 3300025261 | Bacteria | 286063 |
| 179 | Ga0209233_1001860 | 3300025261 | Bacteria | 8113 |
| 180 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 181 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 182 | Ga0209455_1006982 | 3300025272 | Bacteria | 3255 |
| 183 | Ga0207656_10073875 | 3300025321 | Bacteria | 1520 |
| 184 | Ga0207682_10003801 | 3300025893 | Bacteria | 6481 |
| 185 | Ga0207680_10000602 | 3300025903 | Bacteria | 16967 |
| 186 | Ga0207680_10004192 | 3300025903 | Bacteria | 6824 |
| 187 | Ga0207680_10009486 | 3300025903 | Bacteria | 4829 |
| 188 | Ga0207680_10076371 | 3300025903 | Bacteria | 2092 |
| 189 | Ga0207647_10020648 | 3300025904 | Bacteria | 4413 |
| 190 | Ga0207699_10018557 | 3300025906 | Bacteria | 3688 |
| 191 | Ga0207645_10091424 | 3300025907 | Bacteria | 1957 |
| 192 | Ga0207654_10002062 | 3300025911 | Bacteria | 10307 |
| 193 | Ga0207654_10003310 | 3300025911 | Bacteria | 8149 |
| 194 | Ga0207654_10106644 | 3300025911 | Bacteria | 1736 |
| 195 | Ga0207654_10246511 | 3300025911 | Bacteria | 1196 |
| 196 | Ga0207707_10032425 | 3300025912 | Bacteria | 4572 |
| 197 | Ga0207695_10000033 | 3300025913 | Bacteria | 507477 |
| 198 | Ga0207695_10001009 | 3300025913 | Bacteria | 49724 |
| 199 | Ga0207695_10003620 | 3300025913 | Bacteria | 21611 |
| 200 | Ga0207695_10015316 | 3300025913 | Bacteria | 9034 |
| 201 | Ga0207695_10026788 | 3300025913 | Bacteria | 6429 |
| 202 | Ga0207695_10149908 | 3300025913 | Bacteria | 2272 |
| 203 | Ga0207671_10002084 | 3300025914 | Bacteria | 21880 |
| 204 | Ga0207671_10005445 | 3300025914 | Bacteria | 11717 |
| 205 | Ga0207671_10005815 | 3300025914 | Bacteria | 11207 |
| 206 | Ga0207671_10245817 | 3300025914 | Bacteria | 1406 |
| 207 | Ga0207663_10002698 | 3300025916 | Bacteria | 8564 |
| 208 | Ga0207663_10178548 | 3300025916 | Bacteria | 1514 |
| 209 | Ga0207660_10100650 | 3300025917 | Bacteria | 2158 |
| 210 | Ga0207657_10001542 | 3300025919 | Bacteria | 24681 |
| 211 | Ga0207657_10004253 | 3300025919 | Bacteria | 15168 |
| 212 | Ga0207649_10058315 | 3300025920 | Bacteria | 2417 |
| 213 | Ga0207652_10136453 | 3300025921 | Bacteria | 2191 |
| 214 | Ga0207694_10000518 | 3300025924 | Bacteria | 34921 |
| 215 | Ga0207694_10001353 | 3300025924 | Bacteria | 21121 |
| 216 | Ga0207694_10001468 | 3300025924 | Bacteria | 20156 |
| 217 | Ga0207694_10037008 | 3300025924 | Bacteria | 3746 |
| 218 | Ga0207694_10096388 | 3300025924 | Bacteria | 2339 |
| 219 | Ga0207694_10151840 | 3300025924 | Bacteria | 1866 |
| 220 | Ga0207650_10135549 | 3300025925 | Bacteria | 1931 |
| 221 | Ga0207650_10158287 | 3300025925 | Bacteria | 1793 |
| 222 | Ga0207659_10230283 | 3300025926 | Bacteria | 1494 |
| 223 | Ga0207687_10047577 | 3300025927 | Bacteria | 2973 |
| 224 | Ga0207700_10105016 | 3300025928 | Bacteria | 2261 |
| 225 | Ga0207664_10002312 | 3300025929 | Bacteria | 12582 |
| 226 | Ga0207664_10185750 | 3300025929 | Bacteria | 1787 |
| 227 | Ga0207644_10299241 | 3300025931 | Bacteria | 1296 |
| 228 | Ga0207690_10262928 | 3300025932 | Bacteria | 1337 |
| 229 | Ga0207706_10065731 | 3300025933 | Bacteria | 3193 |
| 230 | Ga0207704_10017563 | 3300025938 | Bacteria | 3713 |
| 231 | Ga0207691_10016974 | 3300025940 | Bacteria | 6909 |
| 232 | Ga0207691_10094011 | 3300025940 | Bacteria | 2683 |
| 233 | Ga0207691_10129292 | 3300025940 | Bacteria | 2232 |
| 234 | Ga0207689_10028856 | 3300025942 | Bacteria | 4639 |
| 235 | Ga0207689_10082603 | 3300025942 | Bacteria | 2641 |
| 236 | Ga0207689_10128871 | 3300025942 | Bacteria | 2082 |
| 237 | Ga0207661_10137117 | 3300025944 | Bacteria | 2102 |
| 238 | Ga0207679_10112280 | 3300025945 | Bacteria | 2153 |
| 239 | Ga0207679_10156206 | 3300025945 | Bacteria | 1863 |
| 240 | Ga0207667_10004923 | 3300025949 | Bacteria | 16313 |
| 241 | Ga0207667_10013899 | 3300025949 | Bacteria | 9196 |
| 242 | Ga0207667_10047285 | 3300025949 | Bacteria | 4554 |
| 243 | Ga0207651_10092396 | 3300025960 | Bacteria | 2219 |
| 244 | Ga0207712_10000466 | 3300025961 | Bacteria | 34075 |
| 245 | Ga0207668_10048019 | 3300025972 | Bacteria | 2927 |
| 246 | Ga0207640_10010263 | 3300025981 | Bacteria | 5270 |
| 247 | Ga0207677_10246814 | 3300026023 | Bacteria | 1448 |
| 248 | Ga0207703_10000759 | 3300026035 | Bacteria | 31818 |
| 249 | Ga0207703_10110012 | 3300026035 | Bacteria | 2350 |
| 250 | Ga0207703_10362900 | 3300026035 | Bacteria | 1336 |
| 251 | Ga0207639_10000364 | 3300026041 | Bacteria | 31337 |
| 252 | Ga0207639_10045732 | 3300026041 | Bacteria | 3299 |
| 253 | Ga0207639_10096503 | 3300026041 | Bacteria | 2378 |
| 254 | Ga0207639_10224897 | 3300026041 | Bacteria | 1623 |
| 255 | Ga0207678_10008650 | 3300026067 | Bacteria | 8971 |
| 256 | Ga0207678_10014385 | 3300026067 | Bacteria | 6958 |
| 257 | Ga0207708_10134386 | 3300026075 | Bacteria | 1936 |
| 258 | Ga0207702_10001263 | 3300026078 | Bacteria | 25504 |
| 259 | Ga0207702_10014535 | 3300026078 | Bacteria | 6533 |
| 260 | Ga0207702_10125154 | 3300026078 | Bacteria | 2306 |
| 261 | Ga0207702_10166321 | 3300026078 | Bacteria | 2018 |
| 262 | Ga0207641_10128924 | 3300026088 | Bacteria | 2269 |
| 263 | Ga0207641_10200077 | 3300026088 | Bacteria | 1841 |
| 264 | Ga0207641_10235557 | 3300026088 | Bacteria | 1703 |
| 265 | Ga0207648_10016001 | 3300026089 | Bacteria | 6873 |
| 266 | Ga0207676_10008618 | 3300026095 | Bacteria | 7248 |
| 267 | Ga0207674_10001959 | 3300026116 | Bacteria | 26075 |
| 268 | Ga0207674_10010039 | 3300026116 | Bacteria | 10770 |
| 269 | Ga0207674_10060159 | 3300026116 | Bacteria | 3842 |
| 270 | Ga0207675_100102020 | 3300026118 | Bacteria | 2703 |
| 271 | Ga0207675_100204416 | 3300026118 | Bacteria | 1898 |
| 272 | Ga0207683_10076353 | 3300026121 | Bacteria | 2966 |
| 273 | Ga0207698_10014241 | 3300026142 | Bacteria | 5280 |
| 274 | Ga0207698_10211237 | 3300026142 | Bacteria | 1746 |
| 275 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 276 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 277 | Ga0268266_10371286 | 3300028379 | Bacteria | 1347 |
| 278 | Ga0268265_10000664 | 3300028380 | Bacteria | 34105 |
| 279 | Ga0268264_10008844 | 3300028381 | Bacteria | 8347 |
| 280 | Ga0268264_10148789 | 3300028381 | Bacteria | 2097 |
| 281 | Ga0265319_1009457 | 3300028563 | Bacteria | 4148 |
| 282 | Ga0265334_10000674 | 3300028573 | Bacteria | 17142 |
| 283 | Ga0265332_10007285 | 3300031238 | Bacteria | 5003 |
| 284 | Ga0265328_10015741 | 3300031239 | Bacteria | 2957 |
| 285 | Ga0265325_10003111 | 3300031241 | Bacteria | 10948 |
| 286 | Ga0265325_10005872 | 3300031241 | Bacteria | 7522 |
| 287 | Ga0265329_10004586 | 3300031242 | Bacteria | 5713 |
| 288 | Ga0265340_10000794 | 3300031247 | Bacteria | 17926 |
| 289 | Ga0265339_10005299 | 3300031249 | Bacteria | 8598 |
| 290 | Ga0265331_10032485 | 3300031250 | Bacteria | 2586 |
| 291 | Ga0265316_10039478 | 3300031344 | Bacteria | 3790 |
| 292 | Ga0265313_10000371 | 3300031595 | Bacteria | 48762 |
| 293 | Ga0265314_10000512 | 3300031711 | Bacteria | 50069 |
| 294 | Ga0265314_10005701 | 3300031711 | Bacteria | 11172 |
| 295 | Ga0316576_10108206 | 3300031727 | Bacteria | 2083 |
| 296 | Ga0307516_10036822 | 3300031730 | Bacteria | 4894 |
| 297 | Ga0307413_10003648 | 3300031824 | Bacteria | 6536 |
| 298 | Ga0307407_10004814 | 3300031903 | Bacteria | 5784 |
| 299 | Ga0307411_10112649 | 3300032005 | Bacteria | 1950 |
| 300 | Ga0316583_10010814 | 3300032133 | Bacteria | 3288 |
| 301 | Ga0316593_10056754 | 3300032168 | Bacteria | 1332 |
| 302 | Ga0316593_10059370 | 3300032168 | Bacteria | 1305 |
| 303 | Ga0316593_10070287 | 3300032168 | Bacteria | 1210 |
| 304 | Ga0316586_1005399 | 3300033527 | Bacteria | 1795 |
| 305 | Ga0316588_1025538 | 3300033528 | Bacteria | 1365 |
| 306 | Ga0316588_1032652 | 3300033528 | Bacteria | 1225 |
| 307 | Ga0316587_1005688 | 3300033529 | Bacteria | 1879 |
| 308 | Ga0316596_1031007 | 3300033541 | Bacteria | 1387 |
| 309 | Ga0373934_0000137 | 3300035086 | Bacteria | 26986 |
| 310 | Ga0373944_0007726 | 3300035089 | Bacteria | 2888 |
| 311 | Ga0373953_0018085 | 3300035117 | Bacteria | 2602 |
| 312 | Ga0373956_0000018 | 3300035119 | Bacteria | 50671 |
| 313 | Ga0373956_0075706 | 3300035119 | Bacteria | 1540 |
| 314 | Ga0373957_0039682 | 3300035120 | Bacteria | 1767 |
| 315 | Ga0373946_0010327 | 3300035171 | Bacteria | 3453 |
| 316 | Ga0373955_0020468 | 3300035172 | Bacteria | 3326 |
| 317 | Ga0373955_0052312 | 3300035172 | Bacteria | 2228 |
| 318 | Ga0373942_0017556 | 3300035207 | Bacteria | 1765 |
| 319 | Ga0316574_0008541 | 3300035398 | Bacteria | 5693 |
| 320 | Ga0316574_0022837 | 3300035398 | Bacteria | 3730 |
| 321 | Ga0316574_0076148 | 3300035398 | Bacteria | 2125 |
| 322 | Ga0373933_0000035 | 3300035724 | Bacteria | 82702 |
| 323 | Ga0373947_0171089 | 3300035725 | Bacteria | 1410 |
| 324 | Ga0373937_0001322 | 3300036401 | Bacteria | 20734 |
| 325 | Ga0373937_0114236 | 3300036401 | Bacteria | 2513 |
| 326 | Ga0316582_0094391 | 3300036647 | Bacteria | 1973 |
| 327 | Ga0316584_0052178 | 3300036712 | Bacteria | 3059 |
| 328 | Ga0316584_0068488 | 3300036712 | Bacteria | 2660 |
| 329 | Ga0395899_0000119 | 3300037312 | Bacteria | 127184 |
| 330 | Ga0395899_0015223 | 3300037312 | Bacteria | 5864 |
| 331 | Ga0395900_0000107 | 3300037418 | Bacteria | 149024 |
| 332 | Ga0395900_0199239 | 3300037418 | Bacteria | 2027 |
| 333 | Ga0395898_0000078 | 3300037466 | Bacteria | 244514 |
| 334 | Ga0395898_0000211 | 3300037466 | Bacteria | 149301 |
| 335 | Ga0316581_0049292 | 3300037588 | Bacteria | 1289 |
| 336 | Ga0395901_0072978 | 3300038443 | Bacteria | 3578 |
| 337 | Ga0400490_20921 | 3300038726 | Bacteria | 35909 |
| 338 | Ga0400485_13101 | 3300038735 | Bacteria | 31485 |
| 339 | Ga0400486_18851 | 3300038742 | Bacteria | 47783 |
| 340 | Ga0400483_138703 | 3300039062 | Bacteria | 1830 |
| 341 | Ga0400483_139389 | 3300039062 | Bacteria | 5544 |
| 342 | Ga0400483_190057 | 3300039062 | Bacteria | 41427 |
| 343 | Ga0400483_238315 | 3300039062 | Bacteria | 22298 |
| 344 | Ga0400483_288087 | 3300039062 | Bacteria | 26272 |
| 345 | Ga0400487_38243 | 3300039110 | Bacteria | 71080 |
| 346 | Ga0400487_49718 | 3300039110 | Bacteria | 5740 |
| 347 | Ga0436365_1656463 | 3300039437 | Bacteria | 2166 |
| 348 | Ga0451853_1659196 | 3300041512 | Bacteria | 2268 |
| 349 | Ga0439449_0001643 | 3300042007 | Bacteria | 8766 |
| 350 | Ga0439449_0004713 | 3300042007 | Bacteria | 5264 |
| 351 | Ga0439462_0009780 | 3300042015 | Bacteria | 2425 |
| 352 | Ga0451577_0040351 | 3300042876 | Bacteria | 4191 |
| 353 | Ga0451577_0130137 | 3300042876 | Bacteria | 2257 |
| 354 | Ga0466969_0050242 | 3300044656 | Bacteria | 2055 |
| 355 | Ga0466966_0050915 | 3300044684 | Bacteria | 2634 |
| 356 | Ga0466961_0002581 | 3300044693 | Bacteria | 11230 |
| 357 | Ga0466961_0002840 | 3300044693 | Bacteria | 10751 |
| 358 | Ga0466961_0010232 | 3300044693 | Bacteria | 5975 |
| 359 | Ga0466961_0031115 | 3300044693 | Bacteria | 3430 |
| 360 | Ga0453684_0000298 | 3300044712 | Bacteria | 209777 |
| 361 | Ga0453684_0009060 | 3300044712 | Bacteria | 17564 |
| 362 | Ga0453684_0047807 | 3300044712 | Bacteria | 5668 |
| 363 | Ga0466971_0007954 | 3300044719 | Bacteria | 4620 |
| 364 | Ga0466970_0007214 | 3300044765 | Bacteria | 5566 |
| 365 | Ga0466957_0039121 | 3300044842 | Bacteria | 2860 |
| 366 | Ga0466957_0115012 | 3300044842 | Bacteria | 1710 |
| 367 | Ga0466959_0000110 | 3300045049 | Bacteria | 52740 |
| 368 | Ga0466959_0018905 | 3300045049 | Bacteria | 5062 |
| 369 | Ga0466959_0037720 | 3300045049 | Bacteria | 3572 |
| 370 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 371 | Ga0451576_0671953 | 3300045051 | Bacteria | 1088 |
| 372 | Ga0466958_0001437 | 3300045836 | Bacteria | 11290 |
| 373 | Ga0466958_0027721 | 3300045836 | Bacteria | 3353 |
| 374 | Ga0466967_0321074 | 3300045976 | Bacteria | 1493 |
| 375 | Ga0495638_0007919 | 3300046460 | Bacteria | 7578 |
| 376 | Ga0495638_0063025 | 3300046460 | Bacteria | 2287 |
| 377 | Ga0495651_0004232 | 3300046462 | Bacteria | 10995 |
| 378 | Ga0495663_0025299 | 3300046525 | Bacteria | 1730 |
| 379 | Ga0495586_0027998 | 3300046535 | Bacteria | 3016 |
| 380 | Ga0496103_0132042 | 3300048906 | Bacteria | 1595 |
| 381 | Ga0496104_0000011 | 3300048907 | Bacteria | 459358 |
| 382 | Ga0496105_0000014 | 3300048908 | Bacteria | 220911 |
| 383 | Ga0496114_0242025 | 3300048917 | Bacteria | 1587 |
| 384 | Ga0496115_0000869 | 3300048918 | Bacteria | 21982 |
| 385 | Ga0496117_0061693 | 3300048920 | Bacteria | 2575 |
| 386 | Ga0496118_0000848 | 3300048921 | Bacteria | 48534 |
| 387 | Ga0496118_0030098 | 3300048921 | Bacteria | 4540 |
| 388 | Ga0496119_0078933 | 3300048922 | Bacteria | 1902 |
| 389 | Ga0496120_0001713 | 3300048923 | Bacteria | 25017 |
| 390 | Ga0496126_0000033 | 3300048929 | Bacteria | 368851 |
| 391 | Ga0496126_0115285 | 3300048929 | Bacteria | 2336 |
| 392 | Ga0501031_0054651 | 3300049568 | Bacteria | 2601 |
| 393 | Ga0501032_0005005 | 3300049569 | Bacteria | 9910 |
| 394 | Ga0501032_0033850 | 3300049569 | Bacteria | 3500 |
| 395 | Ga0501033_0003490 | 3300049570 | Bacteria | 12895 |
| 396 | Ga0501033_0127584 | 3300049570 | Bacteria | 1844 |
| 397 | Ga0501034_0001149 | 3300049571 | Bacteria | 36697 |
| 398 | Ga0501034_0001308 | 3300049571 | Bacteria | 33715 |
| 399 | Ga0501034_0037280 | 3300049571 | Bacteria | 4922 |
| 400 | Ga0501036_0006509 | 3300049572 | Bacteria | 9491 |
| 401 | Ga0501036_0035164 | 3300049572 | Bacteria | 4239 |
| 402 | Ga0501037_0054306 | 3300049573 | Bacteria | 2929 |
| 403 | Ga0501038_0006089 | 3300049574 | Bacteria | 11161 |
| 404 | Ga0501039_0041672 | 3300049575 | Bacteria | 3547 |
| 405 | Ga0501043_0003408 | 3300049579 | Bacteria | 13069 |
| 406 | Ga0501043_0030195 | 3300049579 | Bacteria | 4258 |
| 407 | Ga0501043_0133743 | 3300049579 | Bacteria | 1943 |
| 408 | Ga0501046_0059398 | 3300049580 | Bacteria | 2996 |
| 409 | Ga0501046_0124056 | 3300049580 | Bacteria | 1963 |
| 410 | Ga0501047_0000533 | 3300049581 | Bacteria | 41217 |
| 411 | Ga0501047_0019293 | 3300049581 | Bacteria | 6541 |
| 412 | Ga0501067_0000432 | 3300049583 | Bacteria | 22916 |
| 413 | Ga0501068_0001942 | 3300049584 | Bacteria | 10993 |
| 414 | Ga0501070_0102498 | 3300049586 | Bacteria | 2367 |
| 415 | Ga0501070_0179909 | 3300049586 | Bacteria | 1740 |
| 416 | Ga0501072_0000355 | 3300049588 | Bacteria | 32657 |
| 417 | Ga0501073_0014862 | 3300049589 | Bacteria | 5649 |
| 418 | Ga0501073_0069779 | 3300049589 | Bacteria | 2448 |
| 419 | Ga0501074_0005295 | 3300049590 | Bacteria | 9290 |
| 420 | Ga0501074_0006478 | 3300049590 | Bacteria | 8456 |
| 421 | Ga0501079_0013806 | 3300049741 | Bacteria | 6159 |
| 422 | Ga0501079_0119141 | 3300049741 | Bacteria | 2052 |
| 423 | Ga0501080_0000308 | 3300049742 | Bacteria | 37426 |
| 424 | Ga0501080_0002988 | 3300049742 | Bacteria | 14897 |
| 425 | Ga0501080_0121820 | 3300049742 | Bacteria | 2416 |
| 426 | Ga0501080_0207273 | 3300049742 | Bacteria | 1797 |
| 427 | Ga0501080_0282875 | 3300049742 | Bacteria | 1507 |
| 428 | Ga0501035_0184940 | 3300049822 | Bacteria | 1794 |
| 429 | Ga0501035_0327710 | 3300049822 | Bacteria | 1285 |
| 430 | Ga0501044_0004912 | 3300049823 | Bacteria | 14943 |
| 431 | Ga0501044_0015147 | 3300049823 | Bacteria | 8310 |
| 432 | nmdc:mga0n895_500_c1 | 3300050512 | Bacteria | 26537 |
| 433 | Ga0500610_0002178 | 3300053079 | Bacteria | 7076 |
| 434 | Ga0500583_0077471 | 3300053092 | Bacteria | 1600 |
| 435 | Ga0500651_0001544 | 3300053093 | Bacteria | 11671 |
| 436 | Ga0500651_0020977 | 3300053093 | Bacteria | 4070 |
| 437 | Ga0500641_0056902 | 3300053096 | Bacteria | 1621 |
| 438 | Ga0500562_021765 | 3300053108 | Bacteria | 1670 |
| 439 | Ga0501084_0283442 | 3300054114 | Bacteria | 1399 |
| 440 | Ga0501084_0404153 | 3300054114 | Bacteria | 1154 |
| 441 | Ga0501082_0170795 | 3300060353 | Bacteria | 1890 |
| 442 | Ga0466962_0005991 | 3300061719 | Bacteria | 5842 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045051 | Ga0451576_0671953 | Ga0451576_0671953_141_1076 | 281 |
| 2 | 3300039062 | Ga0400483_190057 | Ga0400483_190057_40025_41227 | 319 |
| 3 | 3300039062 | Ga0400483_139389 | Ga0400483_139389_1503_2696 | 339 |
| 4 | 3300039062 | Ga0400483_238315 | Ga0400483_238315_20527_21720 | 339 |
| 5 | 3300053092 | Ga0500583_0077471 | Ga0500583_0077471_68_1165 | 344 |
| 6 | 3300053096 | Ga0500641_0056902 | Ga0500641_0056902_138_1235 | 344 |
| 7 | 3300028563 | Ga0265319_1009457 | Ga0265319_10094573 | 345 |
| 8 | 3300028573 | Ga0265334_10000674 | Ga0265334_1000067412 | 345 |
| 9 | 3300031238 | Ga0265332_10007285 | Ga0265332_100072854 | 345 |
| 10 | 3300031239 | Ga0265328_10015741 | Ga0265328_100157412 | 345 |
| 11 | 3300031241 | Ga0265325_10005872 | Ga0265325_100058723 | 345 |
| 12 | 3300031242 | Ga0265329_10004586 | Ga0265329_100045862 | 345 |
| 13 | 3300031711 | Ga0265314_10005701 | Ga0265314_100057018 | 345 |
| 14 | 3300031250 | Ga0265331_10032485 | Ga0265331_100324852 | 346 |
| 15 | 3300035171 | Ga0373946_0010327 | Ga0373946_0010327_1988_3115 | 347 |
| 16 | 3300005455 | Ga0070663_100061685 | Ga0070663_1000616852 | 349 |
| 17 | 3300025932 | Ga0207690_10262928 | Ga0207690_102629281 | 349 |
| 18 | 3300045049 | Ga0466959_0037720 | Ga0466959_0037720_1716_2807 | 349 |
| 19 | 3300048921 | Ga0496118_0000848 | Ga0496118_0000848_37997_39208 | 349 |
| 20 | 3300054114 | Ga0501084_0283442 | Ga0501084_0283442_327_1382 | 349 |
| 21 | 3300005435 | Ga0070714_100002426 | Ga0070714_10000242616 | 352 |
| 22 | 3300025929 | Ga0207664_10002312 | Ga0207664_100023122 | 352 |
| 23 | 3300049571 | Ga0501034_0001149 | Ga0501034_0001149_33454_34542 | 352 |
| 24 | 3300046460 | Ga0495638_0007919 | Ga0495638_0007919_1085_2242 | 353 |
| 25 | 3300046460 | Ga0495638_0063025 | Ga0495638_0063025_757_1911 | 353 |
| 26 | 3300031247 | Ga0265340_10000794 | Ga0265340_1000079411 | 354 |
| 27 | 3300031249 | Ga0265339_10005299 | Ga0265339_100052992 | 354 |
| 28 | 3300031344 | Ga0265316_10039478 | Ga0265316_100394782 | 354 |
| 29 | 3300031595 | Ga0265313_10000371 | Ga0265313_1000037129 | 354 |
| 30 | 3300003759 | Ga0055525_1000346 | Ga0055525_100034626 | 355 |
| 31 | 3300003763 | Ga0055529_1001113 | Ga0055529_10011133 | 355 |
| 32 | 3300005328 | Ga0070676_10048315 | Ga0070676_100483152 | 355 |
| 33 | 3300005333 | Ga0070677_10031429 | Ga0070677_100314292 | 355 |
| 34 | 3300005365 | Ga0070688_100150663 | Ga0070688_1001506631 | 355 |
| 35 | 3300005466 | Ga0070685_10046814 | Ga0070685_100468142 | 355 |
| 36 | 3300006881 | Ga0068865_100199942 | Ga0068865_1001999421 | 355 |
| 37 | 3300013308 | Ga0157375_10126484 | Ga0157375_101264842 | 355 |
| 38 | 3300025893 | Ga0207682_10003801 | Ga0207682_100038011 | 355 |
| 39 | 3300025907 | Ga0207645_10091424 | Ga0207645_100914242 | 355 |
| 40 | 3300025940 | Ga0207691_10016974 | Ga0207691_100169745 | 355 |
| 41 | 3300026075 | Ga0207708_10134386 | Ga0207708_101343862 | 355 |
| 42 | 3300026118 | Ga0207675_100102020 | Ga0207675_1001020203 | 355 |
| 43 | 3300044693 | Ga0466961_0002581 | Ga0466961_0002581_6794_7888 | 355 |
| 44 | 3300044712 | Ga0453684_0009060 | Ga0453684_0009060_210_1301 | 355 |
| 45 | 3300046525 | Ga0495663_0025299 | Ga0495663_0025299_163_1293 | 355 |
| 46 | 3300006038 | Ga0075365_10074845 | Ga0075365_100748453 | 356 |
| 47 | iso_pu_bacteria | 2524614729 | 2525555810 | 356 |
| 48 | iso_pu_bacteria | 2627854209 | 2630650824 | 356 |
| 49 | 3300002741 | JGI25157J39369_1002018 | JGI25157J39369_10020185 | 357 |
| 50 | 3300042007 | Ga0439449_0001643 | Ga0439449_0001643_6688_7785 | 357 |
| 51 | 3300042007 | Ga0439449_0004713 | Ga0439449_0004713_255_1352 | 357 |
| 52 | 3300042015 | Ga0439462_0009780 | Ga0439462_0009780_239_1336 | 357 |
| 53 | 3300006051 | Ga0075364_10040523 | Ga0075364_100405233 | 358 |
| 54 | 3300005985 | Ga0081539_10000188 | Ga0081539_10000188144 | 359 |
| 55 | 3300006852 | Ga0075433_10204625 | Ga0075433_102046251 | 359 |
| 56 | 3300006871 | Ga0075434_100000459 | Ga0075434_1000004598 | 359 |
| 57 | 3300006914 | Ga0075436_100042689 | Ga0075436_1000426892 | 359 |
| 58 | 3300007076 | Ga0075435_100003755 | Ga0075435_1000037552 | 359 |
| 59 | 3300035207 | Ga0373942_0017556 | Ga0373942_0017556_21_1106 | 359 |
| 60 | 3300050512 | nmdc:mga0n895_500_c1 | nmdc:mga0n895_500_c1_5365_6450 | 359 |
| 61 | 3300005329 | Ga0070683_100044026 | Ga0070683_1000440263 | 360 |
| 62 | 3300005344 | Ga0070661_100033794 | Ga0070661_1000337943 | 360 |
| 63 | 3300005367 | Ga0070667_100120085 | Ga0070667_1001200853 | 360 |
| 64 | 3300005436 | Ga0070713_100123526 | Ga0070713_1001235263 | 360 |
| 65 | 3300005445 | Ga0070708_100000191 | Ga0070708_10000019133 | 360 |
| 66 | 3300005455 | Ga0070663_100066966 | Ga0070663_1000669661 | 360 |
| 67 | 3300005535 | Ga0070684_100026965 | Ga0070684_1000269653 | 360 |
| 68 | 3300005546 | Ga0070696_100003358 | Ga0070696_1000033584 | 360 |
| 69 | 3300005564 | Ga0070664_100006469 | Ga0070664_1000064693 | 360 |
| 70 | 3300005577 | Ga0068857_100304573 | Ga0068857_1003045731 | 360 |
| 71 | 3300005578 | Ga0068854_100003005 | Ga0068854_1000030053 | 360 |
| 72 | 3300005614 | Ga0068856_100010470 | Ga0068856_1000104704 | 360 |
| 73 | 3300005834 | Ga0068851_10013705 | Ga0068851_100137052 | 360 |
| 74 | 3300009098 | Ga0105245_10084017 | Ga0105245_100840172 | 360 |
| 75 | 3300009174 | Ga0105241_10006875 | Ga0105241_100068756 | 360 |
| 76 | 3300009174 | Ga0105241_10008749 | Ga0105241_100087493 | 360 |
| 77 | 3300013104 | Ga0157370_10053829 | Ga0157370_100538292 | 360 |
| 78 | 3300013104 | Ga0157370_10299876 | Ga0157370_102998762 | 360 |
| 79 | 3300013297 | Ga0157378_10120018 | Ga0157378_101200183 | 360 |
| 80 | 3300013307 | Ga0157372_10222364 | Ga0157372_102223642 | 360 |
| 81 | 3300014325 | Ga0163163_10000453 | Ga0163163_1000045341 | 360 |
| 82 | 3300025906 | Ga0207699_10018557 | Ga0207699_100185572 | 360 |
| 83 | 3300025911 | Ga0207654_10002062 | Ga0207654_100020625 | 360 |
| 84 | 3300025911 | Ga0207654_10246511 | Ga0207654_102465111 | 360 |
| 85 | 3300025912 | Ga0207707_10032425 | Ga0207707_100324253 | 360 |
| 86 | 3300025913 | Ga0207695_10026788 | Ga0207695_100267884 | 360 |
| 87 | 3300025916 | Ga0207663_10002698 | Ga0207663_1000269811 | 360 |
| 88 | 3300025917 | Ga0207660_10100650 | Ga0207660_101006503 | 360 |
| 89 | 3300025919 | Ga0207657_10001542 | Ga0207657_100015424 | 360 |
| 90 | 3300025920 | Ga0207649_10058315 | Ga0207649_100583152 | 360 |
| 91 | 3300025924 | Ga0207694_10096388 | Ga0207694_100963881 | 360 |
| 92 | 3300025927 | Ga0207687_10047577 | Ga0207687_100475775 | 360 |
| 93 | 3300025928 | Ga0207700_10105016 | Ga0207700_101050164 | 360 |
| 94 | 3300025929 | Ga0207664_10185750 | Ga0207664_101857502 | 360 |
| 95 | 3300025931 | Ga0207644_10299241 | Ga0207644_102992411 | 360 |
| 96 | 3300025945 | Ga0207679_10156206 | Ga0207679_101562062 | 360 |
| 97 | 3300025949 | Ga0207667_10013899 | Ga0207667_100138994 | 360 |
| 98 | 3300025981 | Ga0207640_10010263 | Ga0207640_100102633 | 360 |
| 99 | 3300026041 | Ga0207639_10096503 | Ga0207639_100965032 | 360 |
| 100 | 3300026041 | Ga0207639_10224897 | Ga0207639_102248972 | 360 |
| 101 | 3300026067 | Ga0207678_10008650 | Ga0207678_100086504 | 360 |
| 102 | 3300026078 | Ga0207702_10125154 | Ga0207702_101251542 | 360 |
| 103 | 3300026116 | Ga0207674_10001959 | Ga0207674_1000195915 | 360 |
| 104 | 3300026142 | Ga0207698_10211237 | Ga0207698_102112371 | 360 |
| 105 | 3300031241 | Ga0265325_10003111 | Ga0265325_100031118 | 360 |
| 106 | 3300031711 | Ga0265314_10000512 | Ga0265314_100005123 | 360 |
| 107 | 3300031727 | Ga0316576_10108206 | Ga0316576_101082062 | 360 |
| 108 | 3300031730 | Ga0307516_10036822 | Ga0307516_100368225 | 360 |
| 109 | 3300035398 | Ga0316574_0076148 | Ga0316574_0076148_199_1287 | 360 |
| 110 | 3300037418 | Ga0395900_0199239 | Ga0395900_0199239_319_1407 | 360 |
| 111 | 3300042876 | Ga0451577_0040351 | Ga0451577_0040351_993_2084 | 360 |
| 112 | 3300049569 | Ga0501032_0033850 | Ga0501032_0033850_1998_3086 | 360 |
| 113 | 3300049570 | Ga0501033_0127584 | Ga0501033_0127584_521_1609 | 360 |
| 114 | 3300049571 | Ga0501034_0001308 | Ga0501034_0001308_26165_27253 | 360 |
| 115 | 3300049571 | Ga0501034_0037280 | Ga0501034_0037280_1588_2709 | 360 |
| 116 | 3300049572 | Ga0501036_0035164 | Ga0501036_0035164_323_1411 | 360 |
| 117 | 3300049574 | Ga0501038_0006089 | Ga0501038_0006089_504_1592 | 360 |
| 118 | 3300049579 | Ga0501043_0030195 | Ga0501043_0030195_2369_3490 | 360 |
| 119 | 3300049579 | Ga0501043_0133743 | Ga0501043_0133743_698_1816 | 360 |
| 120 | 3300049580 | Ga0501046_0059398 | Ga0501046_0059398_1390_2511 | 360 |
| 121 | 3300049581 | Ga0501047_0000533 | Ga0501047_0000533_20809_21897 | 360 |
| 122 | 3300049581 | Ga0501047_0019293 | Ga0501047_0019293_2334_3455 | 360 |
| 123 | 3300049583 | Ga0501067_0000432 | Ga0501067_0000432_5108_6196 | 360 |
| 124 | 3300049584 | Ga0501068_0001942 | Ga0501068_0001942_9511_10599 | 360 |
| 125 | 3300049586 | Ga0501070_0102498 | Ga0501070_0102498_769_1887 | 360 |
| 126 | 3300049586 | Ga0501070_0179909 | Ga0501070_0179909_347_1435 | 360 |
| 127 | 3300049588 | Ga0501072_0000355 | Ga0501072_0000355_4208_5296 | 360 |
| 128 | 3300049589 | Ga0501073_0069779 | Ga0501073_0069779_1213_2334 | 360 |
| 129 | 3300049590 | Ga0501074_0006478 | Ga0501074_0006478_6809_7930 | 360 |
| 130 | 3300049742 | Ga0501080_0000308 | Ga0501080_0000308_3870_4988 | 360 |
| 131 | 3300049742 | Ga0501080_0002988 | Ga0501080_0002988_11053_12141 | 360 |
| 132 | 3300049742 | Ga0501080_0207273 | Ga0501080_0207273_241_1329 | 360 |
| 133 | 3300049742 | Ga0501080_0282875 | Ga0501080_0282875_314_1402 | 360 |
| 134 | 3300049822 | Ga0501035_0184940 | Ga0501035_0184940_428_1549 | 360 |
| 135 | 3300049823 | Ga0501044_0015147 | Ga0501044_0015147_3644_4765 | 360 |
| 136 | 3300053108 | Ga0500562_021765 | Ga0500562_021765_299_1387 | 360 |
| 137 | 3300054114 | Ga0501084_0404153 | Ga0501084_0404153_17_1105 | 360 |
| 138 | iso_pu_bacteria | 2895395659 | 2895398840 | 360 |
| 139 | 3300005331 | Ga0070670_100070420 | Ga0070670_1000704201 | 361 |
| 140 | 3300005335 | Ga0070666_10000331 | Ga0070666_1000033120 | 361 |
| 141 | 3300005335 | Ga0070666_10003401 | Ga0070666_100034017 | 361 |
| 142 | 3300005338 | Ga0068868_100311836 | Ga0068868_1003118361 | 361 |
| 143 | 3300005344 | Ga0070661_100048393 | Ga0070661_1000483931 | 361 |
| 144 | 3300005347 | Ga0070668_100011687 | Ga0070668_1000116876 | 361 |
| 145 | 3300005347 | Ga0070668_100243472 | Ga0070668_1002434722 | 361 |
| 146 | 3300005355 | Ga0070671_100247558 | Ga0070671_1002475582 | 361 |
| 147 | 3300005356 | Ga0070674_100070248 | Ga0070674_1000702483 | 361 |
| 148 | 3300005365 | Ga0070688_100141531 | Ga0070688_1001415312 | 361 |
| 149 | 3300005367 | Ga0070667_100019757 | Ga0070667_1000197578 | 361 |
| 150 | 3300005367 | Ga0070667_100137125 | Ga0070667_1001371253 | 361 |
| 151 | 3300005367 | Ga0070667_100265338 | Ga0070667_1002653381 | 361 |
| 152 | 3300005455 | Ga0070663_100026426 | Ga0070663_1000264261 | 361 |
| 153 | 3300005455 | Ga0070663_100065075 | Ga0070663_1000650753 | 361 |
| 154 | 3300005456 | Ga0070678_100051708 | Ga0070678_1000517084 | 361 |
| 155 | 3300005456 | Ga0070678_100099894 | Ga0070678_1000998942 | 361 |
| 156 | 3300005457 | Ga0070662_100240512 | Ga0070662_1002405121 | 361 |
| 157 | 3300005458 | Ga0070681_10363842 | Ga0070681_103638421 | 361 |
| 158 | 3300005466 | Ga0070685_10000727 | Ga0070685_100007273 | 361 |
| 159 | 3300005539 | Ga0068853_100239510 | Ga0068853_1002395102 | 361 |
| 160 | 3300005543 | Ga0070672_100044477 | Ga0070672_1000444773 | 361 |
| 161 | 3300005548 | Ga0070665_100000172 | Ga0070665_100000172105 | 361 |
| 162 | 3300005548 | Ga0070665_100000525 | Ga0070665_10000052514 | 361 |
| 163 | 3300005548 | Ga0070665_100016842 | Ga0070665_1000168428 | 361 |
| 164 | 3300005548 | Ga0070665_100270647 | Ga0070665_1002706472 | 361 |
| 165 | 3300005548 | Ga0070665_100366709 | Ga0070665_1003667091 | 361 |
| 166 | 3300005563 | Ga0068855_100003763 | Ga0068855_10000376312 | 361 |
| 167 | 3300005563 | Ga0068855_100052236 | Ga0068855_1000522362 | 361 |
| 168 | 3300005578 | Ga0068854_100034071 | Ga0068854_1000340714 | 361 |
| 169 | 3300005578 | Ga0068854_100053862 | Ga0068854_1000538623 | 361 |
| 170 | 3300005578 | Ga0068854_100250181 | Ga0068854_1002501811 | 361 |
| 171 | 3300005614 | Ga0068856_100008501 | Ga0068856_1000085014 | 361 |
| 172 | 3300005616 | Ga0068852_100018137 | Ga0068852_1000181377 | 361 |
| 173 | 3300005617 | Ga0068859_100000125 | Ga0068859_10000012546 | 361 |
| 174 | 3300005618 | Ga0068864_100014993 | Ga0068864_1000149938 | 361 |
| 175 | 3300005718 | Ga0068866_10057890 | Ga0068866_100578903 | 361 |
| 176 | 3300005834 | Ga0068851_10010702 | Ga0068851_100107025 | 361 |
| 177 | 3300005834 | Ga0068851_10055966 | Ga0068851_100559662 | 361 |
| 178 | 3300005841 | Ga0068863_100010558 | Ga0068863_1000105587 | 361 |
| 179 | 3300005841 | Ga0068863_100069437 | Ga0068863_1000694372 | 361 |
| 180 | 3300005842 | Ga0068858_100004776 | Ga0068858_1000047766 | 361 |
| 181 | 3300005842 | Ga0068858_100238798 | Ga0068858_1002387982 | 361 |
| 182 | 3300005843 | Ga0068860_100013373 | Ga0068860_1000133736 | 361 |
| 183 | 3300005843 | Ga0068860_100056925 | Ga0068860_1000569253 | 361 |
| 184 | 3300005844 | Ga0068862_100001848 | Ga0068862_1000018483 | 361 |
| 185 | 3300006237 | Ga0097621_100215355 | Ga0097621_1002153551 | 361 |
| 186 | 3300006237 | Ga0097621_100254930 | Ga0097621_1002549302 | 361 |
| 187 | 3300006358 | Ga0068871_100178412 | Ga0068871_1001784122 | 361 |
| 188 | 3300006931 | Ga0097620_100000125 | Ga0097620_10000012546 | 361 |
| 189 | 3300009093 | Ga0105240_10001191 | Ga0105240_100011915 | 361 |
| 190 | 3300009093 | Ga0105240_10018544 | Ga0105240_100185449 | 361 |
| 191 | 3300009093 | Ga0105240_10028899 | Ga0105240_100288996 | 361 |
| 192 | 3300009093 | Ga0105240_10056802 | Ga0105240_100568024 | 361 |
| 193 | 3300009093 | Ga0105240_10494082 | Ga0105240_104940821 | 361 |
| 194 | 3300009098 | Ga0105245_10330245 | Ga0105245_103302451 | 361 |
| 195 | 3300009174 | Ga0105241_10002547 | Ga0105241_100025478 | 361 |
| 196 | 3300009174 | Ga0105241_10004069 | Ga0105241_100040696 | 361 |
| 197 | 3300009174 | Ga0105241_10184885 | Ga0105241_101848852 | 361 |
| 198 | 3300009177 | Ga0105248_10231129 | Ga0105248_102311292 | 361 |
| 199 | 3300009177 | Ga0105248_10310971 | Ga0105248_103109711 | 361 |
| 200 | 3300009177 | Ga0105248_10440017 | Ga0105248_104400171 | 361 |
| 201 | 3300009545 | Ga0105237_10003573 | Ga0105237_1000357312 | 361 |
| 202 | 3300009545 | Ga0105237_10010758 | Ga0105237_100107585 | 361 |
| 203 | 3300009545 | Ga0105237_10033402 | Ga0105237_100334025 | 361 |
| 204 | 3300009545 | Ga0105237_10045787 | Ga0105237_100457872 | 361 |
| 205 | 3300009545 | Ga0105237_10073581 | Ga0105237_100735812 | 361 |
| 206 | 3300009551 | Ga0105238_10000279 | Ga0105238_1000027935 | 361 |
| 207 | 3300009551 | Ga0105238_10000543 | Ga0105238_100005436 | 361 |
| 208 | 3300009551 | Ga0105238_10002402 | Ga0105238_1000240212 | 361 |
| 209 | 3300009551 | Ga0105238_10032943 | Ga0105238_100329434 | 361 |
| 210 | 3300009551 | Ga0105238_10290735 | Ga0105238_102907352 | 361 |
| 211 | 3300009553 | Ga0105249_10002587 | Ga0105249_1000258712 | 361 |
| 212 | 3300010375 | Ga0105239_10006672 | Ga0105239_100066723 | 361 |
| 213 | 3300010375 | Ga0105239_10008912 | Ga0105239_100089128 | 361 |
| 214 | 3300010375 | Ga0105239_10010432 | Ga0105239_100104325 | 361 |
| 215 | 3300011119 | Ga0105246_10049389 | Ga0105246_100493892 | 361 |
| 216 | 3300013105 | Ga0157369_10000148 | Ga0157369_1000014856 | 361 |
| 217 | 3300013105 | Ga0157369_10001162 | Ga0157369_100011623 | 361 |
| 218 | 3300013105 | Ga0157369_10047426 | Ga0157369_100474262 | 361 |
| 219 | 3300013105 | Ga0157369_10123759 | Ga0157369_101237593 | 361 |
| 220 | 3300013296 | Ga0157374_10033606 | Ga0157374_100336065 | 361 |
| 221 | 3300013297 | Ga0157378_10001845 | Ga0157378_1000184515 | 361 |
| 222 | 3300013306 | Ga0163162_10000007 | Ga0163162_1000000742 | 361 |
| 223 | 3300013306 | Ga0163162_10007109 | Ga0163162_100071097 | 361 |
| 224 | 3300013306 | Ga0163162_10008886 | Ga0163162_100088867 | 361 |
| 225 | 3300013307 | Ga0157372_10002301 | Ga0157372_1000230121 | 361 |
| 226 | 3300013307 | Ga0157372_10034832 | Ga0157372_100348324 | 361 |
| 227 | 3300013307 | Ga0157372_10265759 | Ga0157372_102657593 | 361 |
| 228 | 3300013308 | Ga0157375_10092470 | Ga0157375_100924702 | 361 |
| 229 | 3300014325 | Ga0163163_10003784 | Ga0163163_1000378410 | 361 |
| 230 | 3300014325 | Ga0163163_10257533 | Ga0163163_102575332 | 361 |
| 231 | 3300014968 | Ga0157379_10006295 | Ga0157379_100062957 | 361 |
| 232 | 3300014969 | Ga0157376_10002904 | Ga0157376_100029047 | 361 |
| 233 | 3300014969 | Ga0157376_10009502 | Ga0157376_100095027 | 361 |
| 234 | 3300014969 | Ga0157376_10016809 | Ga0157376_100168094 | 361 |
| 235 | 3300017792 | Ga0163161_10173435 | Ga0163161_101734352 | 361 |
| 236 | 3300021384 | Ga0213876_10061615 | Ga0213876_100616152 | 361 |
| 237 | 3300025261 | Ga0209233_1001860 | Ga0209233_10018601 | 361 |
| 238 | 3300025321 | Ga0207656_10073875 | Ga0207656_100738752 | 361 |
| 239 | 3300025903 | Ga0207680_10000602 | Ga0207680_1000060213 | 361 |
| 240 | 3300025903 | Ga0207680_10004192 | Ga0207680_100041927 | 361 |
| 241 | 3300025903 | Ga0207680_10009486 | Ga0207680_100094861 | 361 |
| 242 | 3300025903 | Ga0207680_10076371 | Ga0207680_100763711 | 361 |
| 243 | 3300025904 | Ga0207647_10020648 | Ga0207647_100206484 | 361 |
| 244 | 3300025911 | Ga0207654_10003310 | Ga0207654_100033103 | 361 |
| 245 | 3300025911 | Ga0207654_10106644 | Ga0207654_101066442 | 361 |
| 246 | 3300025913 | Ga0207695_10000033 | Ga0207695_10000033285 | 361 |
| 247 | 3300025913 | Ga0207695_10001009 | Ga0207695_1000100922 | 361 |
| 248 | 3300025913 | Ga0207695_10003620 | Ga0207695_1000362017 | 361 |
| 249 | 3300025913 | Ga0207695_10015316 | Ga0207695_100153169 | 361 |
| 250 | 3300025913 | Ga0207695_10149908 | Ga0207695_101499083 | 361 |
| 251 | 3300025914 | Ga0207671_10002084 | Ga0207671_1000208419 | 361 |
| 252 | 3300025914 | Ga0207671_10005445 | Ga0207671_100054459 | 361 |
| 253 | 3300025914 | Ga0207671_10005815 | Ga0207671_100058156 | 361 |
| 254 | 3300025914 | Ga0207671_10245817 | Ga0207671_102458171 | 361 |
| 255 | 3300025916 | Ga0207663_10178548 | Ga0207663_101785481 | 361 |
| 256 | 3300025919 | Ga0207657_10004253 | Ga0207657_1000425313 | 361 |
| 257 | 3300025921 | Ga0207652_10136453 | Ga0207652_101364533 | 361 |
| 258 | 3300025924 | Ga0207694_10000518 | Ga0207694_100005186 | 361 |
| 259 | 3300025924 | Ga0207694_10001353 | Ga0207694_1000135318 | 361 |
| 260 | 3300025924 | Ga0207694_10001468 | Ga0207694_100014688 | 361 |
| 261 | 3300025924 | Ga0207694_10037008 | Ga0207694_100370085 | 361 |
| 262 | 3300025924 | Ga0207694_10151840 | Ga0207694_101518402 | 361 |
| 263 | 3300025925 | Ga0207650_10135549 | Ga0207650_101355492 | 361 |
| 264 | 3300025925 | Ga0207650_10158287 | Ga0207650_101582872 | 361 |
| 265 | 3300025926 | Ga0207659_10230283 | Ga0207659_102302831 | 361 |
| 266 | 3300025933 | Ga0207706_10065731 | Ga0207706_100657312 | 361 |
| 267 | 3300025938 | Ga0207704_10017563 | Ga0207704_100175634 | 361 |
| 268 | 3300025940 | Ga0207691_10094011 | Ga0207691_100940111 | 361 |
| 269 | 3300025940 | Ga0207691_10129292 | Ga0207691_101292923 | 361 |
| 270 | 3300025942 | Ga0207689_10028856 | Ga0207689_100288566 | 361 |
| 271 | 3300025942 | Ga0207689_10082603 | Ga0207689_100826032 | 361 |
| 272 | 3300025942 | Ga0207689_10128871 | Ga0207689_101288712 | 361 |
| 273 | 3300025944 | Ga0207661_10137117 | Ga0207661_101371172 | 361 |
| 274 | 3300025945 | Ga0207679_10112280 | Ga0207679_101122802 | 361 |
| 275 | 3300025949 | Ga0207667_10004923 | Ga0207667_1000492312 | 361 |
| 276 | 3300025949 | Ga0207667_10047285 | Ga0207667_100472853 | 361 |
| 277 | 3300025960 | Ga0207651_10092396 | Ga0207651_100923963 | 361 |
| 278 | 3300025961 | Ga0207712_10000466 | Ga0207712_1000046618 | 361 |
| 279 | 3300025972 | Ga0207668_10048019 | Ga0207668_100480192 | 361 |
| 280 | 3300026023 | Ga0207677_10246814 | Ga0207677_102468142 | 361 |
| 281 | 3300026035 | Ga0207703_10000759 | Ga0207703_1000075913 | 361 |
| 282 | 3300026035 | Ga0207703_10110012 | Ga0207703_101100122 | 361 |
| 283 | 3300026035 | Ga0207703_10362900 | Ga0207703_103629001 | 361 |
| 284 | 3300026041 | Ga0207639_10000364 | Ga0207639_1000036413 | 361 |
| 285 | 3300026041 | Ga0207639_10045732 | Ga0207639_100457325 | 361 |
| 286 | 3300026067 | Ga0207678_10014385 | Ga0207678_100143858 | 361 |
| 287 | 3300026078 | Ga0207702_10014535 | Ga0207702_100145358 | 361 |
| 288 | 3300026078 | Ga0207702_10166321 | Ga0207702_101663212 | 361 |
| 289 | 3300026088 | Ga0207641_10128924 | Ga0207641_101289241 | 361 |
| 290 | 3300026088 | Ga0207641_10200077 | Ga0207641_102000772 | 361 |
| 291 | 3300026088 | Ga0207641_10235557 | Ga0207641_102355571 | 361 |
| 292 | 3300026089 | Ga0207648_10016001 | Ga0207648_100160014 | 361 |
| 293 | 3300026095 | Ga0207676_10008618 | Ga0207676_100086182 | 361 |
| 294 | 3300026116 | Ga0207674_10010039 | Ga0207674_100100397 | 361 |
| 295 | 3300026118 | Ga0207675_100204416 | Ga0207675_1002044162 | 361 |
| 296 | 3300026121 | Ga0207683_10076353 | Ga0207683_100763534 | 361 |
| 297 | 3300026142 | Ga0207698_10014241 | Ga0207698_100142415 | 361 |
| 298 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011575 | 361 |
| 299 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006918 | 361 |
| 300 | 3300028379 | Ga0268266_10371286 | Ga0268266_103712861 | 361 |
| 301 | 3300028380 | Ga0268265_10000664 | Ga0268265_100006642 | 361 |
| 302 | 3300028381 | Ga0268264_10008844 | Ga0268264_100088446 | 361 |
| 303 | 3300028381 | Ga0268264_10148789 | Ga0268264_101487892 | 361 |
| 304 | 3300031824 | Ga0307413_10003648 | Ga0307413_100036485 | 361 |
| 305 | 3300031903 | Ga0307407_10004814 | Ga0307407_100048142 | 361 |
| 306 | 3300032005 | Ga0307411_10112649 | Ga0307411_101126492 | 361 |
| 307 | 3300032133 | Ga0316583_10010814 | Ga0316583_100108144 | 361 |
| 308 | 3300032168 | Ga0316593_10056754 | Ga0316593_100567541 | 361 |
| 309 | 3300032168 | Ga0316593_10059370 | Ga0316593_100593701 | 361 |
| 310 | 3300032168 | Ga0316593_10070287 | Ga0316593_100702871 | 361 |
| 311 | 3300033527 | Ga0316586_1005399 | Ga0316586_10053992 | 361 |
| 312 | 3300033528 | Ga0316588_1025538 | Ga0316588_10255381 | 361 |
| 313 | 3300033528 | Ga0316588_1032652 | Ga0316588_10326521 | 361 |
| 314 | 3300033529 | Ga0316587_1005688 | Ga0316587_10056881 | 361 |
| 315 | 3300033541 | Ga0316596_1031007 | Ga0316596_10310071 | 361 |
| 316 | 3300035086 | Ga0373934_0000137 | Ga0373934_0000137_8483_9574 | 361 |
| 317 | 3300035089 | Ga0373944_0007726 | Ga0373944_0007726_418_1509 | 361 |
| 318 | 3300035117 | Ga0373953_0018085 | Ga0373953_0018085_385_1476 | 361 |
| 319 | 3300035119 | Ga0373956_0000018 | Ga0373956_0000018_5384_6475 | 361 |
| 320 | 3300035119 | Ga0373956_0075706 | Ga0373956_0075706_360_1451 | 361 |
| 321 | 3300035120 | Ga0373957_0039682 | Ga0373957_0039682_226_1317 | 361 |
| 322 | 3300035172 | Ga0373955_0020468 | Ga0373955_0020468_1890_2981 | 361 |
| 323 | 3300035172 | Ga0373955_0052312 | Ga0373955_0052312_772_1863 | 361 |
| 324 | 3300035398 | Ga0316574_0008541 | Ga0316574_0008541_1340_2431 | 361 |
| 325 | 3300035398 | Ga0316574_0022837 | Ga0316574_0022837_893_1984 | 361 |
| 326 | 3300035724 | Ga0373933_0000035 | Ga0373933_0000035_7229_8320 | 361 |
| 327 | 3300035725 | Ga0373947_0171089 | Ga0373947_0171089_249_1340 | 361 |
| 328 | 3300036401 | Ga0373937_0001322 | Ga0373937_0001322_5615_6706 | 361 |
| 329 | 3300036401 | Ga0373937_0114236 | Ga0373937_0114236_766_1857 | 361 |
| 330 | 3300036647 | Ga0316582_0094391 | Ga0316582_0094391_759_1850 | 361 |
| 331 | 3300036712 | Ga0316584_0052178 | Ga0316584_0052178_273_1364 | 361 |
| 332 | 3300036712 | Ga0316584_0068488 | Ga0316584_0068488_98_1189 | 361 |
| 333 | 3300037588 | Ga0316581_0049292 | Ga0316581_0049292_67_1158 | 361 |
| 334 | 3300038726 | Ga0400490_20921 | Ga0400490_20921_7610_8701 | 361 |
| 335 | 3300038735 | Ga0400485_13101 | Ga0400485_13101_22887_23978 | 361 |
| 336 | 3300038742 | Ga0400486_18851 | Ga0400486_18851_33267_34358 | 361 |
| 337 | 3300039062 | Ga0400483_138703 | Ga0400483_138703_39_1145 | 361 |
| 338 | 3300039062 | Ga0400483_288087 | Ga0400483_288087_4871_5962 | 361 |
| 339 | 3300039110 | Ga0400487_38243 | Ga0400487_38243_59713_60804 | 361 |
| 340 | 3300039110 | Ga0400487_49718 | Ga0400487_49718_3683_4774 | 361 |
| 341 | 3300039437 | Ga0436365_1656463 | Ga0436365_1656463_493_1734 | 361 |
| 342 | 3300041512 | Ga0451853_1659196 | Ga0451853_1659196_316_1407 | 361 |
| 343 | 3300042876 | Ga0451577_0130137 | Ga0451577_0130137_129_1220 | 361 |
| 344 | 3300044712 | Ga0453684_0000298 | Ga0453684_0000298_50005_51090 | 361 |
| 345 | 3300044712 | Ga0453684_0047807 | Ga0453684_0047807_2366_3460 | 361 |
| 346 | 3300045051 | Ga0451576_0000033 | Ga0451576_0000033_342042_343127 | 361 |
| 347 | 3300046462 | Ga0495651_0004232 | Ga0495651_0004232_3712_4803 | 361 |
| 348 | 3300046535 | Ga0495586_0027998 | Ga0495586_0027998_492_1583 | 361 |
| 349 | 3300048906 | Ga0496103_0132042 | Ga0496103_0132042_381_1544 | 361 |
| 350 | 3300048907 | Ga0496104_0000011 | Ga0496104_0000011_34187_35278 | 361 |
| 351 | 3300048908 | Ga0496105_0000014 | Ga0496105_0000014_34214_35305 | 361 |
| 352 | 3300048917 | Ga0496114_0242025 | Ga0496114_0242025_312_1403 | 361 |
| 353 | 3300048918 | Ga0496115_0000869 | Ga0496115_0000869_19867_20958 | 361 |
| 354 | 3300048920 | Ga0496117_0061693 | Ga0496117_0061693_27_1118 | 361 |
| 355 | 3300048921 | Ga0496118_0030098 | Ga0496118_0030098_2012_3103 | 361 |
| 356 | 3300048929 | Ga0496126_0000033 | Ga0496126_0000033_230916_232007 | 361 |
| 357 | 3300049568 | Ga0501031_0054651 | Ga0501031_0054651_388_1479 | 361 |
| 358 | 3300049569 | Ga0501032_0005005 | Ga0501032_0005005_4994_6085 | 361 |
| 359 | 3300049570 | Ga0501033_0003490 | Ga0501033_0003490_9703_10794 | 361 |
| 360 | 3300049572 | Ga0501036_0006509 | Ga0501036_0006509_7116_8207 | 361 |
| 361 | 3300049573 | Ga0501037_0054306 | Ga0501037_0054306_807_1898 | 361 |
| 362 | 3300049575 | Ga0501039_0041672 | Ga0501039_0041672_2286_3377 | 361 |
| 363 | 3300049579 | Ga0501043_0003408 | Ga0501043_0003408_5848_6939 | 361 |
| 364 | 3300049580 | Ga0501046_0124056 | Ga0501046_0124056_501_1592 | 361 |
| 365 | 3300049589 | Ga0501073_0014862 | Ga0501073_0014862_4445_5536 | 361 |
| 366 | 3300049590 | Ga0501074_0005295 | Ga0501074_0005295_5568_6659 | 361 |
| 367 | 3300049741 | Ga0501079_0013806 | Ga0501079_0013806_4751_5872 | 361 |
| 368 | 3300049741 | Ga0501079_0119141 | Ga0501079_0119141_635_1726 | 361 |
| 369 | 3300049742 | Ga0501080_0121820 | Ga0501080_0121820_1282_2373 | 361 |
| 370 | 3300049822 | Ga0501035_0327710 | Ga0501035_0327710_30_1121 | 361 |
| 371 | 3300049823 | Ga0501044_0004912 | Ga0501044_0004912_470_1561 | 361 |
| 372 | 3300053079 | Ga0500610_0002178 | Ga0500610_0002178_5292_6383 | 361 |
| 373 | 3300053093 | Ga0500651_0001544 | Ga0500651_0001544_3399_4490 | 361 |
| 374 | 3300053093 | Ga0500651_0020977 | Ga0500651_0020977_882_1973 | 361 |
| 375 | 3300060353 | Ga0501082_0170795 | Ga0501082_0170795_324_1415 | 361 |
| 376 | 3300005366 | Ga0070659_100119535 | Ga0070659_1001195353 | 362 |
| 377 | 3300005547 | Ga0070693_100007586 | Ga0070693_1000075863 | 362 |
| 378 | 3300002741 | JGI25157J39369_1000362 | JGI25157J39369_10003629 | 364 |
| 379 | 3300003752 | Ga0055539_1002649 | Ga0055539_10026493 | 364 |
| 380 | 3300003756 | Ga0055533_1007117 | Ga0055533_10071171 | 364 |
| 381 | 3300003760 | Ga0055527_1000149 | Ga0055527_100014918 | 364 |
| 382 | 3300003761 | Ga0055535_1000395 | Ga0055535_100039524 | 364 |
| 383 | 3300003761 | Ga0055535_1000819 | Ga0055535_10008193 | 364 |
| 384 | 3300003761 | Ga0055535_1001546 | Ga0055535_10015469 | 364 |
| 385 | 3300003762 | Ga0055542_1000167 | Ga0055542_100016720 | 364 |
| 386 | 3300003762 | Ga0055542_1000364 | Ga0055542_100036426 | 364 |
| 387 | 3300003763 | Ga0055529_1000468 | Ga0055529_100046819 | 364 |
| 388 | 3300003763 | Ga0055529_1000706 | Ga0055529_10007063 | 364 |
| 389 | 3300005577 | Ga0068857_100052530 | Ga0068857_1000525303 | 364 |
| 390 | 3300005614 | Ga0068856_100001479 | Ga0068856_1000014799 | 364 |
| 391 | 3300025226 | Ga0209674_100202 | Ga0209674_10020216 | 364 |
| 392 | 3300025228 | Ga0209672_100018 | Ga0209672_100018248 | 364 |
| 393 | 3300025228 | Ga0209672_101705 | Ga0209672_1017052 | 364 |
| 394 | 3300025242 | Ga0209258_100024 | Ga0209258_100024354 | 364 |
| 395 | 3300025242 | Ga0209258_100035 | Ga0209258_100035176 | 364 |
| 396 | 3300025250 | Ga0209026_1000056 | Ga0209026_1000056133 | 364 |
| 397 | 3300025253 | Ga0209677_101847 | Ga0209677_1018475 | 364 |
| 398 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009682 | 364 |
| 399 | 3300025254 | Ga0209148_1000048 | Ga0209148_1000048186 | 364 |
| 400 | 3300025256 | Ga0209759_1000166 | Ga0209759_100016614 | 364 |
| 401 | 3300025272 | Ga0209455_1000029 | Ga0209455_1000029354 | 364 |
| 402 | 3300025272 | Ga0209455_1006982 | Ga0209455_10069823 | 364 |
| 403 | 3300026078 | Ga0207702_10001263 | Ga0207702_100012632 | 364 |
| 404 | 3300026116 | Ga0207674_10060159 | Ga0207674_100601593 | 364 |
| 405 | 3300037312 | Ga0395899_0000119 | Ga0395899_0000119_118781_119875 | 364 |
| 406 | 3300037312 | Ga0395899_0015223 | Ga0395899_0015223_798_1892 | 364 |
| 407 | 3300037418 | Ga0395900_0000107 | Ga0395900_0000107_101170_102264 | 364 |
| 408 | 3300037466 | Ga0395898_0000078 | Ga0395898_0000078_62278_63372 | 364 |
| 409 | 3300037466 | Ga0395898_0000211 | Ga0395898_0000211_45820_46914 | 364 |
| 410 | 3300038443 | Ga0395901_0072978 | Ga0395901_0072978_581_1675 | 364 |
| 411 | 3300044656 | Ga0466969_0050242 | Ga0466969_0050242_791_1885 | 364 |
| 412 | 3300044684 | Ga0466966_0050915 | Ga0466966_0050915_791_1885 | 364 |
| 413 | 3300044693 | Ga0466961_0002840 | Ga0466961_0002840_3983_5077 | 364 |
| 414 | 3300044693 | Ga0466961_0010232 | Ga0466961_0010232_592_1686 | 364 |
| 415 | 3300044693 | Ga0466961_0031115 | Ga0466961_0031115_1338_2432 | 364 |
| 416 | 3300044719 | Ga0466971_0007954 | Ga0466971_0007954_1836_2930 | 364 |
| 417 | 3300044765 | Ga0466970_0007214 | Ga0466970_0007214_3023_4117 | 364 |
| 418 | 3300044842 | Ga0466957_0039121 | Ga0466957_0039121_737_1831 | 364 |
| 419 | 3300044842 | Ga0466957_0115012 | Ga0466957_0115012_564_1658 | 364 |
| 420 | 3300045049 | Ga0466959_0000110 | Ga0466959_0000110_46198_47292 | 364 |
| 421 | 3300045049 | Ga0466959_0018905 | Ga0466959_0018905_2776_3870 | 364 |
| 422 | 3300045836 | Ga0466958_0001437 | Ga0466958_0001437_8375_9469 | 364 |
| 423 | 3300045836 | Ga0466958_0027721 | Ga0466958_0027721_357_1451 | 364 |
| 424 | 3300045976 | Ga0466967_0321074 | Ga0466967_0321074_268_1362 | 364 |
| 425 | 3300048922 | Ga0496119_0078933 | Ga0496119_0078933_787_1881 | 364 |
| 426 | 3300048923 | Ga0496120_0001713 | Ga0496120_0001713_22835_23929 | 364 |
| 427 | 3300048929 | Ga0496126_0115285 | Ga0496126_0115285_620_1714 | 364 |
| 428 | 3300061719 | Ga0466962_0005991 | Ga0466962_0005991_766_1860 | 364 |
| 429 | 3300002737 | JGI25162J39368_1001112 | JGI25162J39368_10011128 | 365 |
| 430 | 3300002741 | JGI25157J39369_1002330 | JGI25157J39369_10023304 | 365 |
| 431 | 3300002772 | JGI25164J39214_1000331 | JGI25164J39214_10003318 | 365 |
| 432 | 3300003214 | JGI25165J46597_1000158 | JGI25165J46597_10001588 | 365 |
| 433 | 3300003761 | Ga0055535_1000657 | Ga0055535_100065719 | 365 |
| 434 | 3300003762 | Ga0055542_1000657 | Ga0055542_10006578 | 365 |
| 435 | 3300003763 | Ga0055529_1000593 | Ga0055529_100059319 | 365 |
| 436 | 3300025228 | Ga0209672_100198 | Ga0209672_10019821 | 365 |
| 437 | 3300025231 | Ga0207427_100036 | Ga0207427_100036227 | 365 |
| 438 | 3300025233 | Ga0209437_100127 | Ga0209437_100127170 | 365 |
| 439 | 3300025242 | Ga0209258_100256 | Ga0209258_1002568 | 365 |
| 440 | 3300025246 | Ga0209646_1002938 | Ga0209646_10029383 | 365 |
| 441 | 3300025250 | Ga0209026_1001174 | Ga0209026_10011743 | 365 |
| 442 | 3300025254 | Ga0209148_1000045 | Ga0209148_100004563 | 365 |
| 443 | 3300025256 | Ga0209759_1000670 | Ga0209759_100067024 | 365 |
| 444 | 3300025261 | Ga0209233_1000101 | Ga0209233_1000101227 | 365 |
| 445 | 3300025272 | Ga0209455_1000035 | Ga0209455_100003563 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5aun-assembly1.cif.gz_B | crystal structure of the hypab-ni complex | 0.9068 | 94 | 338 |
| 6oby-assembly1.cif.gz_A | the nucleotide-binding protein af_226 in complex with adp from archaeoglobus fulgidus with co found by pixe. based on 3kb1. | 0.8996 | 94 | 328 |
| 5auq-assembly2.cif.gz_E | crystal structure of atpase-type hypb in the nucleotide free state | 0.8931 | 94 | 338 |
| 5auq-assembly4.cif.gz_F | crystal structure of atpase-type hypb in the nucleotide free state | 0.8893 | 94 | 338 |
| 5auq-assembly1.cif.gz_H | crystal structure of atpase-type hypb in the nucleotide free state | 0.8882 | 94 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6DH61_70_326_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9754 | 93 | 344 | 3.40.50.300 |
| af_A0A1D6KXI0_31_322_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9586 | 94 | 343 | 3.40.50.300 |
| af_Q6DH61_70_326_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.953 | 93 | 344 | 3.40.50.300 |
| af_Q9V9M8_34_292_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9486 | 93 | 338 | 3.40.50.300 |
| af_Q57731_34_290_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.946 | 93 | 343 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3G9HYL5-F1-model_v4 | Protein mrp | 0.9878 | 206 | 343 |
GO:0005524
GO:0005829 GO:0016226 GO:0046872 GO:0051539 GO:0140663 |
| AF-A0A7Z0QS16-F1-model_v4 | Iron-sulfur cluster carrier protein | 0.9837 | 83 | 349 |
GO:0005524
GO:0005829 GO:0016226 GO:0016887 GO:0046872 GO:0051539 GO:0140663 |
| AF-A0A377ZC90-F1-model_v4 | Iron-sulfur cluster carrier protein | 0.9834 | 99 | 343 |
GO:0005524
GO:0005829 GO:0016226 GO:0016887 GO:0046872 GO:0051539 GO:0140663 |
| AF-A0A4V1A8H0-F1-model_v4 | deleted | 0.9824 | 83 | 349 |
|
| AF-A0A0R0AHM7-F1-model_v4 | Iron-sulfur cluster carrier protein | 0.9821 | 81 | 348 |
GO:0005524
GO:0005829 GO:0016226 GO:0016887 GO:0046872 GO:0051539 GO:0140663 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar