F445479

General Info

Members Datasets Scaffolds Average Seq Length
445 289 387 195

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100322044|Ga0075435_1003220443
Length 208
Sequence MVAQKEQQTAEKASSEAGGPRPIPRLQQLYRETVMPSVIKEFALKNVHQAPRLVKVVVNAGVGKFLENQKLKPEIRDTVISTLSIISGQKPIIIMARKSVANFKVREGAPSSFMVTMRADRMWHFLDRLMNLAIPRIKDFRGVKDDSFDAMGNYSMGLSEQAVWPEINMANVNFLHGMHINIVFENSNPKMSRFVLQEMGMPFVRPEA

Samples

Sample ID Description Type Environment
1 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
2 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
3 2643221546 Microbacterium sp. Root53 Isolate Unclassified
4 2643221553 Microbacterium sp. Root553 Isolate Unclassified
5 2643221566 Microbacterium sp. Root166 Isolate Unclassified
6 2643221572 Leifsonia sp. Root60 Isolate Unclassified
7 2643221575 Microbacterium sp. Root61 Isolate Unclassified
8 2643221597 Microbacterium sp. Root180 Isolate Unclassified
9 2643221630 Microbacterium sp. Root322 Isolate Unclassified
10 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
11 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
12 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
13 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
14 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
15 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
16 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
17 2773857759 Microbacterium sp. 1294 Isolate Unclassified
18 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
19 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
20 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
21 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
22 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
23 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
24 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
25 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
26 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
27 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
28 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
29 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
30 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
31 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
32 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
33 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
34 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
35 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
36 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
37 2919069694 Microbacterium sp. 1154 Isolate Unclassified
38 2919395869 Microbacterium resistens 2980 Isolate Unclassified
39 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
40 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
41 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
42 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
43 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
44 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
45 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
46 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
47 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
48 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
49 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
50 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
51 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
52 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
53 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
56 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
57 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
58 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
59 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
60 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
61 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
64 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
154 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
155 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
156 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
161 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
249 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
254 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
255 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
285 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
286 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
287 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
288 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
289 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.28
Metatranscriptomes 11.69
Isolates 13.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 9.66
Nodule 0
Rhizoplane 6.07
Rhizosphere 60.22
Stem 0
Stem Tuber 0
Unclassified 23.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000460 3300001979 Bacteria 17440
2 JGI25154J39366_1001910 3300002738 Bacteria 6286
3 Ga0007427J51700_102557 3300003559 Bacteria 6979
4 Ga0006562J51391_1104523 3300003578 Bacteria 2975
5 Ga0006562J51391_1104526 3300003578 Bacteria 660
6 Ga0006780_1007001 3300003735 Bacteria 4772
7 Ga0065714_10067377 3300005288 Bacteria 5585
8 Ga0070658_10009122 3300005327 Bacteria 7974
9 Ga0070658_10080026 3300005327 Bacteria 2683
10 Ga0070677_10150767 3300005333 Bacteria 1082
11 Ga0070660_100036773 3300005339 Bacteria 3710
12 Ga0070660_100468720 3300005339 Bacteria 1046
13 Ga0070661_100018488 3300005344 Bacteria 4954
14 Ga0070668_100754380 3300005347 Bacteria 862
15 Ga0070671_100023253 3300005355 Bacteria 5071
16 Ga0070688_100546599 3300005365 Bacteria 880
17 Ga0070667_100085309 3300005367 Bacteria 2708
18 Ga0070709_10007508 3300005434 Bacteria 5982
19 Ga0070714_100171888 3300005435 Bacteria 1967
20 Ga0070710_10031075 3300005437 Bacteria 2879
21 Ga0070663_100680531 3300005455 Bacteria 873
22 Ga0070678_100463977 3300005456 Bacteria 1112
23 Ga0070679_100474979 3300005530 Bacteria 1195
24 Ga0068853_100010611 3300005539 Bacteria 7452
25 Ga0068853_100293807 3300005539 Bacteria 1500
26 Ga0068853_100793392 3300005539 Bacteria 907
27 Ga0070704_101139420 3300005549 Bacteria 710
28 Ga0068855_100128220 3300005563 Bacteria 2899
29 Ga0068855_100338933 3300005563 Bacteria 1658
30 Ga0068857_100852529 3300005577 Bacteria 872
31 Ga0068854_100212182 3300005578 Bacteria 1528
32 Ga0068856_100414380 3300005614 Bacteria 1367
33 Ga0068856_100482645 3300005614 Bacteria 1260
34 Ga0068856_100587047 3300005614 Bacteria 1135
35 Ga0068851_10000022 3300005834 Bacteria 129607
36 Ga0068858_100001116 3300005842 Bacteria 27809
37 Ga0081538_10140558 3300005981 Bacteria 1114
38 Ga0075365_10015615 3300006038 Bacteria 4597
39 Ga0075365_10029877 3300006038 Bacteria 3486
40 Ga0075365_10186113 3300006038 Bacteria 1452
41 Ga0075368_10016248 3300006042 Bacteria 2774
42 Ga0075363_100050849 3300006048 Bacteria 2208
43 Ga0075363_100094473 3300006048 Bacteria 1649
44 Ga0075363_100205748 3300006048 Bacteria 1125
45 Ga0075364_10021121 3300006051 Bacteria 4100
46 Ga0075364_10027461 3300006051 Bacteria 3636
47 Ga0075364_10077143 3300006051 Bacteria 2199
48 Ga0075364_10111899 3300006051 Bacteria 1823
49 Ga0075364_10172148 3300006051 Bacteria 1464
50 Ga0075367_10009009 3300006178 Bacteria 5197
51 Ga0075369_10037457 3300006186 Bacteria 2066
52 Ga0075369_10156965 3300006186 Bacteria 1042
53 Ga0075370_10015347 3300006353 Bacteria 4099
54 Ga0075370_10077989 3300006353 Bacteria 1901
55 Ga0075370_10246323 3300006353 Bacteria 1059
56 Ga0075428_100471418 3300006844 Bacteria 1344
57 Ga0075428_100663323 3300006844 Bacteria 1112
58 Ga0075435_100322044 3300007076 Bacteria 1323
59 Ga0105244_10004765 3300009036 Bacteria 9234
60 Ga0105244_10036504 3300009036 Bacteria 2574
61 Ga0105240_10070946 3300009093 Bacteria 4308
62 Ga0105240_10420138 3300009093 Bacteria 1502
63 Ga0111539_10306176 3300009094 Bacteria 1849
64 Ga0105245_10118013 3300009098 Bacteria 2475
65 Ga0105245_10438128 3300009098 Bacteria 1313
66 Ga0105243_10044746 3300009148 Bacteria 3475
67 Ga0105241_10734061 3300009174 Bacteria 904
68 Ga0105242_11419043 3300009176 Bacteria 722
69 Ga0105237_10031122 3300009545 Bacteria 5412
70 Ga0105237_10111613 3300009545 Bacteria 2726
71 Ga0105238_10045909 3300009551 Bacteria 4412
72 Ga0105239_10490888 3300010375 Bacteria 1396
73 Ga0105246_10170900 3300011119 Bacteria 1665
74 Ga0157371_10016523 3300013102 Bacteria 5505
75 Ga0157371_10024138 3300013102 Bacteria 4442
76 Ga0157370_10063693 3300013104 Bacteria 3492
77 Ga0157370_10135809 3300013104 Bacteria 2292
78 Ga0157369_10002930 3300013105 Bacteria 20411
79 Ga0157369_10084273 3300013105 Bacteria 3398
80 Ga0171462_1001 3300013250 Bacteria 1135406
81 Ga0163162_10211924 3300013306 Bacteria 2067
82 Ga0163162_10392412 3300013306 Bacteria 1520
83 Ga0163162_10730607 3300013306 Bacteria 1110
84 Ga0157372_10221913 3300013307 Bacteria 2191
85 Ga0157372_10227095 3300013307 Bacteria 2164
86 Ga0157375_10358632 3300013308 Bacteria 1624
87 Ga0157375_11118519 3300013308 Bacteria 922
88 Ga0163163_10076682 3300014325 Bacteria 3338
89 Ga0157380_10034018 3300014326 Bacteria 3929
90 Ga0157379_10092307 3300014968 Bacteria 2716
91 Ga0157376_10240121 3300014969 Bacteria 1688
92 Ga0163161_10058703 3300017792 Bacteria 2796
93 Ga0197907_11050670 3300020069 Bacteria 652
94 Ga0197907_11084650 3300020069 Bacteria 1570
95 Ga0209646_1000013 3300025246 Bacteria 565830
96 Ga0209646_1000014 3300025246 Bacteria 550484
97 Ga0207656_10000005 3300025321 Bacteria 490514
98 Ga0207655_1000386 3300025728 Bacteria 61740
99 Ga0207655_1107406 3300025728 Bacteria 949
100 Ga0207647_10033365 3300025904 Bacteria 3296
101 Ga0207647_10090900 3300025904 Bacteria 1820
102 Ga0207705_10000001 3300025909 Bacteria 2061880
103 Ga0207705_10035339 3300025909 Bacteria 3575
104 Ga0207705_10036550 3300025909 Bacteria 3514
105 Ga0207705_10207372 3300025909 Bacteria 1486
106 Ga0207654_10000001 3300025911 Bacteria 1816198
107 Ga0207695_10082467 3300025913 Bacteria 3251
108 Ga0207695_10418749 3300025913 Bacteria 1224
109 Ga0207671_10000016 3300025914 Bacteria 435413
110 Ga0207657_10005997 3300025919 Bacteria 12644
111 Ga0207657_10036712 3300025919 Bacteria 4384
112 Ga0207657_10399851 3300025919 Bacteria 1080
113 Ga0207649_10024394 3300025920 Bacteria 3514
114 Ga0207694_10000057 3300025924 Bacteria 146441
115 Ga0207687_10416254 3300025927 Bacteria 1108
116 Ga0207664_10169827 3300025929 Bacteria 1866
117 Ga0207644_10123828 3300025931 Bacteria 1971
118 Ga0207690_10003803 3300025932 Bacteria 8937
119 Ga0207709_10068641 3300025935 Bacteria 2241
120 Ga0207709_10254066 3300025935 Bacteria 1285
121 Ga0207669_10156012 3300025937 Bacteria 1606
122 Ga0207667_10035600 3300025949 Bacteria 5340
123 Ga0207667_10083110 3300025949 Bacteria 3316
124 Ga0207667_10282768 3300025949 Bacteria 1695
125 Ga0207668_10206525 3300025972 Bacteria 1568
126 Ga0207640_10037144 3300025981 Bacteria 3063
127 Ga0207658_10014981 3300025986 Bacteria 5316
128 Ga0207639_10071529 3300026041 Bacteria 2713
129 Ga0207639_10135861 3300026041 Bacteria 2042
130 Ga0207639_10524333 3300026041 Bacteria 1085
131 Ga0207678_10101275 3300026067 Bacteria 2460
132 Ga0207678_10320669 3300026067 Bacteria 1333
133 Ga0207678_10466078 3300026067 Bacteria 1099
134 Ga0207708_10303410 3300026075 Bacteria 1299
135 Ga0207702_10100567 3300026078 Bacteria 2551
136 Ga0207702_10848092 3300026078 Bacteria 904
137 Ga0207683_10062314 3300026121 Bacteria 3284
138 Ga0207698_10019872 3300026142 Bacteria 4610
139 Ga0307515_10291079 3300028794 Bacteria 1329
140 Ga0307408_100193935 3300031548 Bacteria 1639
141 Ga0307413_10083111 3300031824 Bacteria 2059
142 Ga0307413_10244917 3300031824 Bacteria 1326
143 Ga0307410_10200263 3300031852 Bacteria 1524
144 Ga0307406_10000938 3300031901 Bacteria 16294
145 Ga0307406_10032617 3300031901 Bacteria 3182
146 Ga0307406_10094564 3300031901 Bacteria 2020
147 Ga0307412_10231849 3300031911 Bacteria 1422
148 Ga0307409_101251406 3300031995 Bacteria 766
149 Ga0307414_10101924 3300032004 Bacteria 2162
150 Ga0316584_0299687 3300036712 Bacteria 1164
151 Ga0395900_1316066 3300037418 Bacteria 636
152 Ga0395901_0085307 3300038443 Bacteria 3301
153 Ga0451789_1294910 3300041443 Bacteria 943
154 Ga0451795_0674751 3300041456 Bacteria 1054
155 Ga0451804_0498327 3300041463 Bacteria 776
156 Ga0451833_0383288 3300041491 Bacteria 704
157 Ga0451841_1105200 3300041498 Bacteria 981
158 Ga0451843_1544020 3300041509 Bacteria 767
159 Ga0451853_2207870 3300041512 Bacteria 890
160 Ga0439431_0146776 3300041997 Bacteria 669
161 Ga0466965_0005434 3300044683 Bacteria 5740
162 Ga0466965_0045670 3300044683 Bacteria 2167
163 Ga0466966_0511554 3300044684 Bacteria 722
164 Ga0466961_0101351 3300044693 Bacteria 1814
165 Ga0466971_0048616 3300044719 Bacteria 1907
166 Ga0466968_0014966 3300044735 Bacteria 3071
167 Ga0466970_0000027 3300044765 Bacteria 56103
168 Ga0466970_0035231 3300044765 Bacteria 2652
169 Ga0466970_0040814 3300044765 Bacteria 2464
170 Ga0466960_0008733 3300044901 Bacteria 4158
171 Ga0466960_0056630 3300044901 Bacteria 1909
172 Ga0466960_0267565 3300044901 Bacteria 954
173 Ga0495627_001687 3300046453 Bacteria 12164
174 Ga0495603_0245202 3300046455 Bacteria 1032
175 Ga0495590_0000902 3300046457 Bacteria 13285
176 Ga0495650_0060302 3300046471 Bacteria 1524
177 Ga0495650_0070523 3300046471 Bacteria 1372
178 Ga0495620_0029591 3300046515 Bacteria 2532
179 Ga0495620_0194160 3300046515 Bacteria 782
180 Ga0495654_0116540 3300046530 Bacteria 1213
181 Ga0495633_0146107 3300046558 Bacteria 1093
182 Ga0495656_0148392 3300046615 Bacteria 1130
183 Ga0495625_0157617 3300046660 Bacteria 1523
184 Ga0495671_0046748 3300046692 Bacteria 2164
185 Ga0495672_0030252 3300047320 Bacteria 3400
186 Ga0495672_0031256 3300047320 Bacteria 3326
187 Ga0495615_0104415 3300048090 Bacteria 804
188 Ga0496101_0002898 3300048904 Bacteria 10559
189 Ga0496101_0187846 3300048904 Bacteria 1594
190 Ga0496102_0196778 3300048905 Bacteria 1900
191 Ga0496103_0005136 3300048906 Bacteria 7881
192 Ga0496104_0044706 3300048907 Bacteria 4161
193 Ga0496104_0757270 3300048907 Bacteria 878
194 Ga0496105_0009192 3300048908 Bacteria 7715
195 Ga0496105_0185075 3300048908 Bacteria 1704
196 Ga0496105_0191704 3300048908 Bacteria 1671
197 Ga0496107_0001328 3300048910 Bacteria 15168
198 Ga0496108_0141305 3300048911 Bacteria 2074
199 Ga0496109_0016841 3300048912 Bacteria 6396
200 Ga0496109_0071948 3300048912 Bacteria 3175
201 Ga0496110_0036804 3300048913 Bacteria 4251
202 Ga0496111_0039015 3300048914 Bacteria 3403
203 Ga0496112_0020079 3300048915 Bacteria 6325
204 Ga0496112_0271824 3300048915 Bacteria 1643
205 Ga0496113_0005620 3300048916 Bacteria 7845
206 Ga0496113_0563403 3300048916 Bacteria 913
207 Ga0496114_0066335 3300048917 Bacteria 3025
208 Ga0496114_0088508 3300048917 Bacteria 2626
209 Ga0496114_0140938 3300048917 Bacteria 2087
210 Ga0496114_0979233 3300048917 Bacteria 728
211 Ga0496115_0002702 3300048918 Bacteria 12733
212 Ga0496117_0000362 3300048920 Bacteria 79224
213 Ga0496117_0003610 3300048920 Bacteria 17825
214 Ga0496117_0004032 3300048920 Bacteria 16539
215 Ga0496117_0006530 3300048920 Bacteria 11750
216 Ga0496117_0009885 3300048920 Bacteria 8783
217 Ga0496117_0028132 3300048920 Bacteria 4358
218 Ga0496117_0031402 3300048920 Bacteria 4055
219 Ga0496117_0070709 3300048920 Bacteria 2342
220 Ga0496117_0115251 3300048920 Bacteria 1664
221 Ga0496117_0137662 3300048920 Bacteria 1468
222 Ga0496118_0002856 3300048921 Bacteria 22535
223 Ga0496118_0006345 3300048921 Bacteria 13050
224 Ga0496118_0008749 3300048921 Bacteria 10383
225 Ga0496118_0040002 3300048921 Bacteria 3733
226 Ga0496118_0056469 3300048921 Bacteria 2951
227 Ga0496118_0068984 3300048921 Bacteria 2564
228 Ga0496119_0000720 3300048922 Bacteria 44520
229 Ga0496119_0003034 3300048922 Bacteria 17774
230 Ga0496119_0023416 3300048922 Bacteria 4380
231 Ga0496119_0025618 3300048922 Bacteria 4113
232 Ga0496119_0054042 3300048922 Bacteria 2448
233 Ga0496119_0307111 3300048922 Bacteria 780
234 Ga0496120_0015932 3300048923 Bacteria 4934
235 Ga0496120_0037279 3300048923 Bacteria 2886
236 Ga0496120_0052780 3300048923 Bacteria 2313
237 Ga0496120_0081010 3300048923 Bacteria 1757
238 Ga0496120_0099767 3300048923 Bacteria 1536
239 Ga0496120_0129031 3300048923 Bacteria 1297
240 Ga0496121_0000497 3300048924 Bacteria 75061
241 Ga0496121_0210207 3300048924 Bacteria 1379
242 Ga0496122_0000022 3300048925 Bacteria 388704
243 Ga0496122_0000799 3300048925 Bacteria 60347
244 Ga0496122_0003594 3300048925 Bacteria 20199
245 Ga0496122_0010341 3300048925 Bacteria 9645
246 Ga0496122_0090523 3300048925 Bacteria 2087
247 Ga0496122_0180178 3300048925 Bacteria 1261
248 Ga0496123_0000009 3300048926 Bacteria 509486
249 Ga0496123_0000016 3300048926 Bacteria 424330
250 Ga0496123_0004251 3300048926 Bacteria 15248
251 Ga0496123_0182613 3300048926 Bacteria 1094
252 Ga0496124_0002766 3300048927 Bacteria 22302
253 Ga0496124_0006965 3300048927 Bacteria 12143
254 Ga0496124_0029307 3300048927 Bacteria 4907
255 Ga0496124_0036040 3300048927 Bacteria 4320
256 Ga0496124_0085327 3300048927 Bacteria 2588
257 Ga0496124_0213967 3300048927 Bacteria 1456
258 Ga0496124_0327918 3300048927 Bacteria 1093
259 Ga0496125_0002082 3300048928 Bacteria 26957
260 Ga0496125_0002578 3300048928 Bacteria 23316
261 Ga0496125_0005769 3300048928 Bacteria 13604
262 Ga0496125_0029529 3300048928 Bacteria 4925
263 Ga0496125_0043499 3300048928 Bacteria 3810
264 Ga0496125_0073122 3300048928 Bacteria 2667
265 Ga0496126_0002077 3300048929 Bacteria 28059
266 Ga0496126_0002563 3300048929 Bacteria 24311
267 Ga0496126_0015145 3300048929 Bacteria 7768
268 Ga0496126_0052186 3300048929 Bacteria 3717
269 Ga0496126_0103173 3300048929 Bacteria 2492
270 Ga0496126_0108175 3300048929 Bacteria 2424
271 Ga0496126_0697241 3300048929 Bacteria 789
272 Ga0501306_009073 3300049127 Bacteria 1226
273 Ga0501308_030330 3300049128 Bacteria 722
274 Ga0501309_014803 3300049129 Bacteria 1050
275 Ga0501310_009305 3300049130 Bacteria 1081
276 Ga0501304_004362 3300049160 Bacteria 1073
277 Ga0501305_007464 3300049161 Bacteria 1390
278 Ga0501307_002229 3300049162 Bacteria 1778
279 Ga0501307_005288 3300049162 Bacteria 1356
280 Ga0501312_014195 3300049528 Bacteria 1117
281 Ga0501317_001118 3300049533 Bacteria 2219
282 Ga0501318_003086 3300049534 Bacteria 1501
283 Ga0501319_000191 3300049535 Bacteria 2497
284 Ga0501320_004361 3300049536 Bacteria 1246
285 Ga0501322_002862 3300049538 Bacteria 1085
286 Ga0501323_002830 3300049539 Bacteria 1721
287 Ga0501323_011339 3300049539 Bacteria 1075
288 Ga0501325_000709 3300049541 Bacteria 1746
289 Ga0501338_00589 3300049554 Bacteria 1698
290 Ga0501031_0025920 3300049568 Bacteria 3824
291 Ga0501032_0001225 3300049569 Bacteria 20568
292 Ga0501032_0205594 3300049569 Bacteria 1284
293 Ga0501032_0256550 3300049569 Bacteria 1134
294 Ga0501034_0002490 3300049571 Bacteria 22119
295 Ga0501034_0012335 3300049571 Bacteria 8829
296 Ga0501034_0023372 3300049571 Bacteria 6298
297 Ga0501034_0032413 3300049571 Bacteria 5306
298 Ga0501034_0037011 3300049571 Bacteria 4941
299 Ga0501034_0040057 3300049571 Bacteria 4744
300 Ga0501034_0055806 3300049571 Bacteria 3975
301 Ga0501036_0106410 3300049572 Bacteria 2372
302 Ga0501037_0357545 3300049573 Bacteria 1006
303 Ga0501038_0000144 3300049574 Bacteria 61149
304 Ga0501038_0020229 3300049574 Bacteria 5988
305 Ga0501038_0370516 3300049574 Bacteria 1112
306 Ga0501039_0069542 3300049575 Bacteria 2734
307 Ga0501043_0037575 3300049579 Bacteria 3808
308 Ga0501043_0087089 3300049579 Bacteria 2454
309 Ga0501043_0254659 3300049579 Bacteria 1351
310 Ga0501046_0092613 3300049580 Bacteria 2323
311 Ga0501047_0011785 3300049581 Bacteria 8268
312 Ga0501047_0028559 3300049581 Bacteria 5380
313 Ga0501067_0042653 3300049583 Bacteria 2519
314 Ga0501067_0567317 3300049583 Bacteria 636
315 Ga0501069_0203378 3300049585 Bacteria 1148
316 Ga0501070_0000874 3300049586 Bacteria 27417
317 Ga0501070_0040019 3300049586 Bacteria 3910
318 Ga0501070_0054412 3300049586 Bacteria 3319
319 Ga0501070_0068175 3300049586 Bacteria 2945
320 Ga0501072_0062259 3300049588 Bacteria 2943
321 Ga0501073_0000030 3300049589 Bacteria 115949
322 Ga0501073_0069543 3300049589 Bacteria 2453
323 Ga0501073_0397237 3300049589 Bacteria 952
324 Ga0501074_0294104 3300049590 Bacteria 1154
325 Ga0501079_0304883 3300049741 Bacteria 1246
326 Ga0501080_0000208 3300049742 Bacteria 43436
327 Ga0501083_0000921 3300049744 Bacteria 19506
328 Ga0501035_0004487 3300049822 Bacteria 13250
329 Ga0501035_0215772 3300049822 Bacteria 1640
330 Ga0501044_0001222 3300049823 Bacteria 30539
331 Ga0501044_0024266 3300049823 Bacteria 6441
332 nmdc:mga03n38_279311_c1 3300050490 Bacteria 891
333 nmdc:mga03n38_33332_c1 3300050490 Bacteria 2190
334 nmdc:mga00v17_105512_c1 3300050491 Bacteria 1783
335 nmdc:mga00v17_34172_c1 3300050491 Bacteria 3018
336 nmdc:mga00v17_8123_c1 3300050491 Bacteria 5634
337 nmdc:mga00v17_99131_c1 3300050491 Bacteria 1838
338 nmdc:mga0yw44_277_c1 3300050492 Bacteria 17596
339 nmdc:mga0yw44_436589_c1 3300050492 Bacteria 887
340 nmdc:mga0yw44_5399_c1 3300050492 Bacteria 6031
341 nmdc:mga06z11_11796_c1 3300050494 Bacteria 3780
342 nmdc:mga07m45_203437_c1 3300050496 Bacteria 1152
343 nmdc:mga07m45_24923_c1 3300050496 Bacteria 3279
344 nmdc:mga0sz30_6222_c2 3300050516 Bacteria 3757
345 Ga0500562_001347 3300053108 Bacteria 6058
346 Ga0500592_049954 3300053116 Bacteria 679
347 Ga0500593_052144 3300053117 Bacteria 1813
348 Ga0500568_0018835 3300053139 Bacteria 3011
349 Ga0500568_0125044 3300053139 Bacteria 957
350 Ga0500590_058221 3300053148 Bacteria 1947
351 Ga0500616_0000027 3300053153 Bacteria 441053
352 Ga0500616_0000117 3300053153 Bacteria 145655
353 Ga0500616_0002723 3300053153 Bacteria 14334
354 Ga0500620_000519 3300053155 Bacteria 6752
355 Ga0500645_080478 3300053730 Bacteria 930
356 Ga0500587_024472 3300053739 Bacteria 802
357 Ga0501084_0082056 3300054114 Bacteria 2705
358 Ga0501084_0776060 3300054114 Bacteria 807
359 Ga0587084_000004 3300059477 Bacteria 10690
360 Ga0587070_000783 3300059491 Bacteria 2928
361 Ga0587070_056946 3300059491 Bacteria 797
362 Ga0587073_0035398 3300059492 Bacteria 1058
363 Ga0587073_0104386 3300059492 Bacteria 741
364 Ga0587077_001116 3300059493 Bacteria 2744
365 Ga0587083_0014219 3300059505 Bacteria 1368
366 Ga0587085_001114 3300059506 Bacteria 2368
367 Ga0587086_000329 3300059507 Bacteria 3204
368 Ga0587088_020892 3300059508 Bacteria 1090
369 Ga0587090_001053 3300059510 Bacteria 2661
370 Ga0587091_000453 3300059511 Bacteria 3511
371 Ga0587092_000723 3300059512 Bacteria 2857
372 Ga0587094_000376 3300059513 Bacteria 3298
373 Ga0587095_000117 3300059514 Bacteria 3212
374 Ga0587097_01194 3300059603 Bacteria 901
375 Ga0587098_000885 3300059604 Bacteria 2088
376 Ga0587125_000594 3300059607 Bacteria 2220
377 Ga0587101_000011 3300059623 Bacteria 8540
378 Ga0587115_000267 3300059626 Bacteria 3477
379 Ga0587130_008048 3300059631 Bacteria 992
380 Ga0587069_006866 3300059642 Bacteria 1385
381 Ga0587100_000081 3300059648 Bacteria 3481
382 Ga0587105_003189 3300059651 Bacteria 982
383 Ga0587107_052222 3300059652 Bacteria 697
384 Ga0587120_004840 3300059659 Bacteria 1016
385 Ga0587124_000269 3300059660 Bacteria 2596
386 Ga0587111_0000761 3300060346 Bacteria 3397
387 Ga0501082_0014801 3300060353 Bacteria 6718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049160 Ga0501304_004362 Ga0501304_004362_553_1062 164
2 3300049583 Ga0501067_0567317 Ga0501067_0567317_127_624 165
3 3300036712 Ga0316584_0299687 Ga0316584_0299687_21_563 180
4 3300049533 Ga0501317_001118 Ga0501317_001118_155_715 185
5 3300049534 Ga0501318_003086 Ga0501318_003086_43_609 187
6 3300048923 Ga0496120_0081010 Ga0496120_0081010_689_1258 188
7 3300005981 Ga0081538_10140558 Ga0081538_101405581 189
8 3300009176 Ga0105242_11419043 Ga0105242_114190431 189
9 3300049568 Ga0501031_0025920 Ga0501031_0025920_2618_3187 189
10 3300049569 Ga0501032_0001225 Ga0501032_0001225_16108_16677 189
11 3300049571 Ga0501034_0055806 Ga0501034_0055806_1014_1583 189
12 3300049572 Ga0501036_0106410 Ga0501036_0106410_1638_2207 189
13 3300049574 Ga0501038_0000144 Ga0501038_0000144_41786_42355 189
14 3300049579 Ga0501043_0037575 Ga0501043_0037575_2397_2966 189
15 3300049581 Ga0501047_0011785 Ga0501047_0011785_757_1326 189
16 3300049586 Ga0501070_0054412 Ga0501070_0054412_803_1372 189
17 3300049744 Ga0501083_0000921 Ga0501083_0000921_18531_19100 189
18 3300049822 Ga0501035_0004487 Ga0501035_0004487_3079_3648 189
19 3300049823 Ga0501044_0024266 Ga0501044_0024266_2210_2779 189
20 3300054114 Ga0501084_0082056 Ga0501084_0082056_242_811 189
21 3300060353 Ga0501082_0014801 Ga0501082_0014801_5743_6312 189
22 3300005434 Ga0070709_10007508 Ga0070709_100075089 190
23 3300005539 Ga0068853_100010611 Ga0068853_1000106111 190
24 3300014326 Ga0157380_10034018 Ga0157380_100340184 190
25 iso_pu_bacteria 2857729791 2857730655 190
26 iso_pu_bacteria 2928121344 2928121461 190
27 3300005549 Ga0070704_101139420 Ga0070704_1011394201 191
28 3300006844 Ga0075428_100663323 Ga0075428_1006633232 191
29 3300049535 Ga0501319_000191 Ga0501319_000191_1750_2325 191
30 3300049541 Ga0501325_000709 Ga0501325_000709_305_880 191
31 3300059492 Ga0587073_0104386 Ga0587073_0104386_24_605 191
32 3300059604 Ga0587098_000885 Ga0587098_000885_1259_1852 191
33 3300059652 Ga0587107_052222 Ga0587107_052222_109_687 191
34 iso_pu_bacteria 2585428157 2588107955 191
35 iso_pu_bacteria 2643221546 2643753720 191
36 iso_pu_bacteria 2643221572 2643876441 191
37 iso_pu_bacteria 2643221635 2644197857 191
38 iso_pu_bacteria 2643221669 2644383496 191
39 iso_pu_bacteria 2808606368 2808884772 191
40 iso_pu_bacteria 2895660088 2895660616 191
41 iso_pu_bacteria 8057345674 8057347412 191
42 3300005455 Ga0070663_100680531 Ga0070663_1006805311 192
43 3300009094 Ga0111539_10306176 Ga0111539_103061765 192
44 3300026067 Ga0207678_10466078 Ga0207678_104660782 192
45 3300041491 Ga0451833_0383288 Ga0451833_0383288_55_636 192
46 3300046615 Ga0495656_0148392 Ga0495656_0148392_123_719 192
47 3300049554 Ga0501338_00589 Ga0501338_00589_115_693 192
48 3300049569 Ga0501032_0205594 Ga0501032_0205594_111_689 192
49 3300049579 Ga0501043_0254659 Ga0501043_0254659_416_994 192
50 3300049590 Ga0501074_0294104 Ga0501074_0294104_170_748 192
51 3300059491 Ga0587070_056946 Ga0587070_056946_29_607 192
52 3300059505 Ga0587083_0014219 Ga0587083_0014219_760_1338 192
53 3300059603 Ga0587097_01194 Ga0587097_01194_141_719 192
54 3300059631 Ga0587130_008048 Ga0587130_008048_276_854 192
55 iso_pu_bacteria 2643221542 2643732575 192
56 iso_pu_bacteria 2643221553 2643786359 192
57 iso_pu_bacteria 2643221566 2643847792 192
58 iso_pu_bacteria 2643221575 2643888104 192
59 iso_pu_bacteria 2643221597 2643994819 192
60 iso_pu_bacteria 2643221630 2644171375 192
61 iso_pu_bacteria 2643221724 2644681059 192
62 iso_pu_bacteria 2728369380 2730230508 192
63 iso_pu_bacteria 2747842429 2747952129 192
64 iso_pu_bacteria 2757320536 2758224795 192
65 iso_pu_bacteria 2773857758 2774378919 192
66 iso_pu_bacteria 2773857759 2774382006 192
67 iso_pu_bacteria 2773857763 2774400765 192
68 iso_pu_bacteria 2808606306 2808628767 192
69 iso_pu_bacteria 2808606447 2809226254 192
70 iso_pu_bacteria 2811994872 2812322091 192
71 iso_pu_bacteria 2821268502 2821269003 192
72 iso_pu_bacteria 2833709550 2833709893 192
73 iso_pu_bacteria 2844852863 2844854323 192
74 iso_pu_bacteria 2852632344 2852632513 192
75 iso_pu_bacteria 2852646457 2852647577 192
76 iso_pu_bacteria 2852663356 2852664089 192
77 iso_pu_bacteria 2857720070 2857722748 192
78 iso_pu_bacteria 2857723135 2857725827 192
79 iso_pu_bacteria 2857737099 2857738232 192
80 iso_pu_bacteria 2870628048 2870629398 192
81 iso_pu_bacteria 2904509784 2904510381 192
82 iso_pu_bacteria 2908678064 2908678401 192
83 iso_pu_bacteria 2919069694 2919070725 192
84 iso_pu_bacteria 2919395869 2919397194 192
85 iso_pu_bacteria 2928090899 2928093832 192
86 iso_pu_bacteria 2945968032 2945968744 192
87 iso_pu_bacteria 2946033335 2946036582 192
88 iso_pu_bacteria 2946041624 2946045185 192
89 iso_pu_bacteria 2946080515 2946084047 192
90 iso_pu_bacteria 2974294766 2974294865 192
91 iso_pu_bacteria 2974324384 2974325335 192
92 iso_pu_bacteria 2977228692 2977230297 192
93 iso_pu_bacteria 2977236895 2977239101 192
94 iso_pu_bacteria 2977251589 2977252167 192
95 iso_pu_bacteria 2977264416 2977265515 192
96 iso_pu_bacteria 2984542743 2984543114 192
97 iso_pu_bacteria 2984580707 2984582481 192
98 iso_pu_bacteria 8004182704 8004184528 192
99 iso_pu_bacteria 8004212874 8004213334 192
100 iso_pu_bacteria 8016254467 8016255120 192
101 iso_pu_bacteria 8045830549 8045832195 192
102 iso_pu_bacteria 8056037122 8056039380 192
103 3300041509 Ga0451843_1544020 Ga0451843_1544020_119_700 193
104 3300044693 Ga0466961_0101351 Ga0466961_0101351_485_1066 193
105 3300044765 Ga0466970_0040814 Ga0466970_0040814_1812_2393 193
106 3300044901 Ga0466960_0008733 Ga0466960_0008733_2324_2905 193
107 3300048920 Ga0496117_0031402 Ga0496117_0031402_1767_2348 193
108 3300048921 Ga0496118_0008749 Ga0496118_0008749_3054_3635 193
109 3300048922 Ga0496119_0003034 Ga0496119_0003034_14133_14714 193
110 3300048923 Ga0496120_0037279 Ga0496120_0037279_1422_2003 193
111 3300048925 Ga0496122_0000799 Ga0496122_0000799_22530_23111 193
112 3300048926 Ga0496123_0000009 Ga0496123_0000009_381554_382135 193
113 3300048927 Ga0496124_0006965 Ga0496124_0006965_4566_5147 193
114 3300048928 Ga0496125_0029529 Ga0496125_0029529_3639_4220 193
115 3300048929 Ga0496126_0052186 Ga0496126_0052186_1287_1868 193
116 3300049569 Ga0501032_0256550 Ga0501032_0256550_473_1057 193
117 3300049571 Ga0501034_0012335 Ga0501034_0012335_2253_2837 193
118 3300049580 Ga0501046_0092613 Ga0501046_0092613_366_950 193
119 3300049581 Ga0501047_0028559 Ga0501047_0028559_2427_3011 193
120 3300049586 Ga0501070_0040019 Ga0501070_0040019_2034_2618 193
121 3300049822 Ga0501035_0215772 Ga0501035_0215772_598_1182 193
122 3300049823 Ga0501044_0001222 Ga0501044_0001222_7592_8176 193
123 3300005333 Ga0070677_10150767 Ga0070677_101507672 194
124 3300006844 Ga0075428_100471418 Ga0075428_1004714182 194
125 3300007076 Ga0075435_100322044 Ga0075435_1003220443 194
126 3300013105 Ga0157369_10002930 Ga0157369_1000293024 194
127 3300013308 Ga0157375_10358632 Ga0157375_103586323 194
128 3300025904 Ga0207647_10090900 Ga0207647_100909003 194
129 3300048920 Ga0496117_0003610 Ga0496117_0003610_2952_3542 194
130 3300048920 Ga0496117_0070709 Ga0496117_0070709_1285_1869 194
131 3300048921 Ga0496118_0040002 Ga0496118_0040002_1664_2248 194
132 3300048926 Ga0496123_0182613 Ga0496123_0182613_119_703 194
133 3300006038 Ga0075365_10015615 Ga0075365_100156157 195
134 3300006038 Ga0075365_10029877 Ga0075365_100298776 195
135 3300006042 Ga0075368_10016248 Ga0075368_100162482 195
136 3300006048 Ga0075363_100050849 Ga0075363_1000508492 195
137 3300006051 Ga0075364_10021121 Ga0075364_100211216 195
138 3300006051 Ga0075364_10027461 Ga0075364_100274613 195
139 3300006051 Ga0075364_10172148 Ga0075364_101721482 195
140 3300006178 Ga0075367_10009009 Ga0075367_1000900910 195
141 3300006186 Ga0075369_10037457 Ga0075369_100374571 195
142 3300006353 Ga0075370_10015347 Ga0075370_100153477 195
143 3300013104 Ga0157370_10135809 Ga0157370_101358095 195
144 3300013306 Ga0163162_10392412 Ga0163162_103924123 195
145 3300013306 Ga0163162_10730607 Ga0163162_107306071 195
146 3300017792 Ga0163161_10058703 Ga0163161_100587033 195
147 3300025919 Ga0207657_10036712 Ga0207657_100367122 195
148 3300031548 Ga0307408_100193935 Ga0307408_1001939351 195
149 3300031824 Ga0307413_10244917 Ga0307413_102449173 195
150 3300031852 Ga0307410_10200263 Ga0307410_102002633 195
151 3300031901 Ga0307406_10000938 Ga0307406_1000093816 195
152 3300031911 Ga0307412_10231849 Ga0307412_102318492 195
153 3300031995 Ga0307409_101251406 Ga0307409_1012514061 195
154 3300044683 Ga0466965_0045670 Ga0466965_0045670_1071_1658 195
155 3300044901 Ga0466960_0056630 Ga0466960_0056630_1071_1658 195
156 3300046455 Ga0495603_0245202 Ga0495603_0245202_357_944 195
157 3300046515 Ga0495620_0029591 Ga0495620_0029591_1460_2050 195
158 3300047320 Ga0495672_0031256 Ga0495672_0031256_2343_2930 195
159 3300048090 Ga0495615_0104415 Ga0495615_0104415_67_654 195
160 3300048904 Ga0496101_0187846 Ga0496101_0187846_567_1154 195
161 3300048917 Ga0496114_0979233 Ga0496114_0979233_80_667 195
162 3300048928 Ga0496125_0002082 Ga0496125_0002082_24534_25121 195
163 3300048929 Ga0496126_0002563 Ga0496126_0002563_3158_3748 195
164 3300049162 Ga0501307_002229 Ga0501307_002229_715_1302 195
165 3300049528 Ga0501312_014195 Ga0501312_014195_89_682 195
166 3300049538 Ga0501322_002862 Ga0501322_002862_470_1057 195
167 3300049539 Ga0501323_011339 Ga0501323_011339_250_837 195
168 3300050490 nmdc:mga03n38_33332_c1 nmdc:mga03n38_33332_c1_1391_1978 195
169 3300050491 nmdc:mga00v17_34172_c1 nmdc:mga00v17_34172_c1_2055_2642 195
170 3300050491 nmdc:mga00v17_8123_c1 nmdc:mga00v17_8123_c1_4166_4753 195
171 3300050492 nmdc:mga0yw44_277_c1 nmdc:mga0yw44_277_c1_6492_7079 195
172 3300050492 nmdc:mga0yw44_5399_c1 nmdc:mga0yw44_5399_c1_4224_4811 195
173 3300050494 nmdc:mga06z11_11796_c1 nmdc:mga06z11_11796_c1_2292_2879 195
174 3300050496 nmdc:mga07m45_24923_c1 nmdc:mga07m45_24923_c1_1899_2486 195
175 3300050516 nmdc:mga0sz30_6222_c2 nmdc:mga0sz30_6222_c2_1618_2205 195
176 3300001979 JGI24740J21852_10000460 JGI24740J21852_1000046015 196
177 3300002738 JGI25154J39366_1001910 JGI25154J39366_10019107 196
178 3300003559 Ga0007427J51700_102557 Ga0007427J51700_10255714 196
179 3300003578 Ga0006562J51391_1104523 Ga0006562J51391_11045236 196
180 3300003578 Ga0006562J51391_1104526 Ga0006562J51391_11045261 196
181 3300003735 Ga0006780_1007001 Ga0006780_10070012 196
182 3300005288 Ga0065714_10067377 Ga0065714_100673778 196
183 3300005327 Ga0070658_10009122 Ga0070658_100091222 196
184 3300005327 Ga0070658_10080026 Ga0070658_100800266 196
185 3300005339 Ga0070660_100036773 Ga0070660_1000367736 196
186 3300005339 Ga0070660_100468720 Ga0070660_1004687201 196
187 3300005344 Ga0070661_100018488 Ga0070661_1000184887 196
188 3300005347 Ga0070668_100754380 Ga0070668_1007543801 196
189 3300005355 Ga0070671_100023253 Ga0070671_1000232534 196
190 3300005365 Ga0070688_100546599 Ga0070688_1005465992 196
191 3300005367 Ga0070667_100085309 Ga0070667_1000853092 196
192 3300005435 Ga0070714_100171888 Ga0070714_1001718884 196
193 3300005437 Ga0070710_10031075 Ga0070710_100310752 196
194 3300005456 Ga0070678_100463977 Ga0070678_1004639772 196
195 3300005530 Ga0070679_100474979 Ga0070679_1004749793 196
196 3300005539 Ga0068853_100293807 Ga0068853_1002938071 196
197 3300005539 Ga0068853_100793392 Ga0068853_1007933921 196
198 3300005563 Ga0068855_100128220 Ga0068855_1001282204 196
199 3300005563 Ga0068855_100338933 Ga0068855_1003389333 196
200 3300005577 Ga0068857_100852529 Ga0068857_1008525291 196
201 3300005578 Ga0068854_100212182 Ga0068854_1002121821 196
202 3300005614 Ga0068856_100414380 Ga0068856_1004143803 196
203 3300005614 Ga0068856_100482645 Ga0068856_1004826452 196
204 3300005614 Ga0068856_100587047 Ga0068856_1005870472 196
205 3300005834 Ga0068851_10000022 Ga0068851_1000002240 196
206 3300005842 Ga0068858_100001116 Ga0068858_1000011166 196
207 3300006038 Ga0075365_10186113 Ga0075365_101861134 196
208 3300006048 Ga0075363_100094473 Ga0075363_1000944732 196
209 3300006048 Ga0075363_100205748 Ga0075363_1002057482 196
210 3300006051 Ga0075364_10077143 Ga0075364_100771432 196
211 3300006051 Ga0075364_10111899 Ga0075364_101118993 196
212 3300006186 Ga0075369_10156965 Ga0075369_101569652 196
213 3300006353 Ga0075370_10077989 Ga0075370_100779892 196
214 3300006353 Ga0075370_10246323 Ga0075370_102463233 196
215 3300009036 Ga0105244_10004765 Ga0105244_1000476512 196
216 3300009036 Ga0105244_10036504 Ga0105244_100365042 196
217 3300009093 Ga0105240_10070946 Ga0105240_100709462 196
218 3300009093 Ga0105240_10420138 Ga0105240_104201382 196
219 3300009098 Ga0105245_10118013 Ga0105245_101180133 196
220 3300009098 Ga0105245_10438128 Ga0105245_104381282 196
221 3300009148 Ga0105243_10044746 Ga0105243_100447462 196
222 3300009174 Ga0105241_10734061 Ga0105241_107340612 196
223 3300009545 Ga0105237_10031122 Ga0105237_1003112211 196
224 3300009545 Ga0105237_10111613 Ga0105237_101116133 196
225 3300009551 Ga0105238_10045909 Ga0105238_100459098 196
226 3300010375 Ga0105239_10490888 Ga0105239_104908882 196
227 3300011119 Ga0105246_10170900 Ga0105246_101709003 196
228 3300013102 Ga0157371_10016523 Ga0157371_100165238 196
229 3300013102 Ga0157371_10024138 Ga0157371_100241386 196
230 3300013104 Ga0157370_10063693 Ga0157370_100636935 196
231 3300013105 Ga0157369_10084273 Ga0157369_100842734 196
232 3300013250 Ga0171462_1001 Ga0171462_1001817 196
233 3300013306 Ga0163162_10211924 Ga0163162_102119243 196
234 3300013307 Ga0157372_10221913 Ga0157372_102219133 196
235 3300013307 Ga0157372_10227095 Ga0157372_102270953 196
236 3300013308 Ga0157375_11118519 Ga0157375_111185192 196
237 3300014325 Ga0163163_10076682 Ga0163163_100766823 196
238 3300014968 Ga0157379_10092307 Ga0157379_100923075 196
239 3300014969 Ga0157376_10240121 Ga0157376_102401212 196
240 3300020069 Ga0197907_11050670 Ga0197907_110506701 196
241 3300020069 Ga0197907_11084650 Ga0197907_110846503 196
242 3300025246 Ga0209646_1000013 Ga0209646_1000013292 196
243 3300025246 Ga0209646_1000014 Ga0209646_100001485 196
244 3300025321 Ga0207656_10000005 Ga0207656_10000005302 196
245 3300025728 Ga0207655_1000386 Ga0207655_100038627 196
246 3300025728 Ga0207655_1107406 Ga0207655_11074061 196
247 3300025904 Ga0207647_10033365 Ga0207647_100333652 196
248 3300025909 Ga0207705_10000001 Ga0207705_10000001688 196
249 3300025909 Ga0207705_10035339 Ga0207705_100353391 196
250 3300025909 Ga0207705_10036550 Ga0207705_100365503 196
251 3300025909 Ga0207705_10207372 Ga0207705_102073722 196
252 3300025911 Ga0207654_10000001 Ga0207654_10000001851 196
253 3300025913 Ga0207695_10082467 Ga0207695_100824677 196
254 3300025913 Ga0207695_10418749 Ga0207695_104187492 196
255 3300025914 Ga0207671_10000016 Ga0207671_10000016158 196
256 3300025919 Ga0207657_10005997 Ga0207657_1000599714 196
257 3300025919 Ga0207657_10399851 Ga0207657_103998512 196
258 3300025920 Ga0207649_10024394 Ga0207649_100243945 196
259 3300025924 Ga0207694_10000057 Ga0207694_1000005798 196
260 3300025927 Ga0207687_10416254 Ga0207687_104162542 196
261 3300025929 Ga0207664_10169827 Ga0207664_101698273 196
262 3300025931 Ga0207644_10123828 Ga0207644_101238282 196
263 3300025932 Ga0207690_10003803 Ga0207690_1000380316 196
264 3300025935 Ga0207709_10068641 Ga0207709_100686412 196
265 3300025935 Ga0207709_10254066 Ga0207709_102540661 196
266 3300025937 Ga0207669_10156012 Ga0207669_101560123 196
267 3300025949 Ga0207667_10035600 Ga0207667_1003560010 196
268 3300025949 Ga0207667_10083110 Ga0207667_100831107 196
269 3300025949 Ga0207667_10282768 Ga0207667_102827683 196
270 3300025972 Ga0207668_10206525 Ga0207668_102065253 196
271 3300025981 Ga0207640_10037144 Ga0207640_100371443 196
272 3300025986 Ga0207658_10014981 Ga0207658_100149818 196
273 3300026041 Ga0207639_10071529 Ga0207639_100715295 196
274 3300026041 Ga0207639_10135861 Ga0207639_101358613 196
275 3300026041 Ga0207639_10524333 Ga0207639_105243331 196
276 3300026067 Ga0207678_10101275 Ga0207678_101012755 196
277 3300026067 Ga0207678_10320669 Ga0207678_103206693 196
278 3300026075 Ga0207708_10303410 Ga0207708_103034102 196
279 3300026078 Ga0207702_10100567 Ga0207702_101005672 196
280 3300026078 Ga0207702_10848092 Ga0207702_108480922 196
281 3300026121 Ga0207683_10062314 Ga0207683_100623145 196
282 3300026142 Ga0207698_10019872 Ga0207698_100198727 196
283 3300028794 Ga0307515_10291079 Ga0307515_102910792 196
284 3300031824 Ga0307413_10083111 Ga0307413_100831115 196
285 3300031901 Ga0307406_10032617 Ga0307406_100326175 196
286 3300031901 Ga0307406_10094564 Ga0307406_100945641 196
287 3300032004 Ga0307414_10101924 Ga0307414_101019244 196
288 3300037418 Ga0395900_1316066 Ga0395900_1316066_22_612 196
289 3300038443 Ga0395901_0085307 Ga0395901_0085307_166_756 196
290 3300041443 Ga0451789_1294910 Ga0451789_1294910_123_713 196
291 3300041456 Ga0451795_0674751 Ga0451795_0674751_367_960 196
292 3300041463 Ga0451804_0498327 Ga0451804_0498327_149_739 196
293 3300041498 Ga0451841_1105200 Ga0451841_1105200_209_799 196
294 3300041512 Ga0451853_2207870 Ga0451853_2207870_100_690 196
295 3300041997 Ga0439431_0146776 Ga0439431_0146776_63_653 196
296 3300044683 Ga0466965_0005434 Ga0466965_0005434_2325_2915 196
297 3300044684 Ga0466966_0511554 Ga0466966_0511554_51_668 196
298 3300044719 Ga0466971_0048616 Ga0466971_0048616_949_1539 196
299 3300044735 Ga0466968_0014966 Ga0466968_0014966_776_1366 196
300 3300044765 Ga0466970_0000027 Ga0466970_0000027_10717_11307 196
301 3300044765 Ga0466970_0035231 Ga0466970_0035231_1546_2136 196
302 3300044901 Ga0466960_0267565 Ga0466960_0267565_155_745 196
303 3300046453 Ga0495627_001687 Ga0495627_001687_7650_8240 196
304 3300046457 Ga0495590_0000902 Ga0495590_0000902_7930_8520 196
305 3300046471 Ga0495650_0060302 Ga0495650_0060302_72_662 196
306 3300046471 Ga0495650_0070523 Ga0495650_0070523_242_832 196
307 3300046515 Ga0495620_0194160 Ga0495620_0194160_24_614 196
308 3300046530 Ga0495654_0116540 Ga0495654_0116540_307_924 196
309 3300046558 Ga0495633_0146107 Ga0495633_0146107_427_1020 196
310 3300046660 Ga0495625_0157617 Ga0495625_0157617_648_1241 196
311 3300046692 Ga0495671_0046748 Ga0495671_0046748_228_821 196
312 3300047320 Ga0495672_0030252 Ga0495672_0030252_593_1189 196
313 3300048904 Ga0496101_0002898 Ga0496101_0002898_6510_7100 196
314 3300048905 Ga0496102_0196778 Ga0496102_0196778_665_1255 196
315 3300048906 Ga0496103_0005136 Ga0496103_0005136_164_754 196
316 3300048907 Ga0496104_0044706 Ga0496104_0044706_1843_2433 196
317 3300048907 Ga0496104_0757270 Ga0496104_0757270_53_643 196
318 3300048908 Ga0496105_0009192 Ga0496105_0009192_506_1096 196
319 3300048908 Ga0496105_0185075 Ga0496105_0185075_413_1003 196
320 3300048908 Ga0496105_0191704 Ga0496105_0191704_870_1460 196
321 3300048910 Ga0496107_0001328 Ga0496107_0001328_6683_7273 196
322 3300048911 Ga0496108_0141305 Ga0496108_0141305_216_806 196
323 3300048912 Ga0496109_0016841 Ga0496109_0016841_2314_2904 196
324 3300048912 Ga0496109_0071948 Ga0496109_0071948_1688_2278 196
325 3300048913 Ga0496110_0036804 Ga0496110_0036804_3571_4161 196
326 3300048914 Ga0496111_0039015 Ga0496111_0039015_1928_2518 196
327 3300048915 Ga0496112_0020079 Ga0496112_0020079_3187_3777 196
328 3300048915 Ga0496112_0271824 Ga0496112_0271824_645_1235 196
329 3300048916 Ga0496113_0005620 Ga0496113_0005620_5527_6117 196
330 3300048916 Ga0496113_0563403 Ga0496113_0563403_206_796 196
331 3300048917 Ga0496114_0066335 Ga0496114_0066335_593_1183 196
332 3300048917 Ga0496114_0088508 Ga0496114_0088508_1306_1896 196
333 3300048917 Ga0496114_0140938 Ga0496114_0140938_363_953 196
334 3300048918 Ga0496115_0002702 Ga0496115_0002702_6750_7340 196
335 3300048920 Ga0496117_0000362 Ga0496117_0000362_28677_29267 196
336 3300048920 Ga0496117_0004032 Ga0496117_0004032_14930_15520 196
337 3300048920 Ga0496117_0006530 Ga0496117_0006530_5454_6044 196
338 3300048920 Ga0496117_0009885 Ga0496117_0009885_3525_4115 196
339 3300048920 Ga0496117_0028132 Ga0496117_0028132_733_1329 196
340 3300048920 Ga0496117_0115251 Ga0496117_0115251_90_680 196
341 3300048920 Ga0496117_0137662 Ga0496117_0137662_625_1215 196
342 3300048921 Ga0496118_0002856 Ga0496118_0002856_18840_19430 196
343 3300048921 Ga0496118_0006345 Ga0496118_0006345_2779_3369 196
344 3300048921 Ga0496118_0056469 Ga0496118_0056469_699_1289 196
345 3300048921 Ga0496118_0068984 Ga0496118_0068984_1868_2464 196
346 3300048922 Ga0496119_0000720 Ga0496119_0000720_28063_28653 196
347 3300048922 Ga0496119_0023416 Ga0496119_0023416_961_1551 196
348 3300048922 Ga0496119_0025618 Ga0496119_0025618_115_705 196
349 3300048922 Ga0496119_0054042 Ga0496119_0054042_1721_2311 196
350 3300048922 Ga0496119_0307111 Ga0496119_0307111_148_738 196
351 3300048923 Ga0496120_0015932 Ga0496120_0015932_1451_2041 196
352 3300048923 Ga0496120_0052780 Ga0496120_0052780_1592_2182 196
353 3300048923 Ga0496120_0099767 Ga0496120_0099767_573_1163 196
354 3300048923 Ga0496120_0129031 Ga0496120_0129031_442_1035 196
355 3300048924 Ga0496121_0000497 Ga0496121_0000497_7396_7986 196
356 3300048924 Ga0496121_0210207 Ga0496121_0210207_267_860 196
357 3300048925 Ga0496122_0000022 Ga0496122_0000022_253722_254312 196
358 3300048925 Ga0496122_0003594 Ga0496122_0003594_17262_17852 196
359 3300048925 Ga0496122_0010341 Ga0496122_0010341_6651_7241 196
360 3300048925 Ga0496122_0090523 Ga0496122_0090523_930_1520 196
361 3300048925 Ga0496122_0180178 Ga0496122_0180178_613_1203 196
362 3300048926 Ga0496123_0000016 Ga0496123_0000016_289205_289795 196
363 3300048926 Ga0496123_0004251 Ga0496123_0004251_1520_2110 196
364 3300048927 Ga0496124_0002766 Ga0496124_0002766_17610_18200 196
365 3300048927 Ga0496124_0029307 Ga0496124_0029307_337_927 196
366 3300048927 Ga0496124_0036040 Ga0496124_0036040_2317_2907 196
367 3300048927 Ga0496124_0085327 Ga0496124_0085327_48_638 196
368 3300048927 Ga0496124_0213967 Ga0496124_0213967_378_968 196
369 3300048927 Ga0496124_0327918 Ga0496124_0327918_333_923 196
370 3300048928 Ga0496125_0002578 Ga0496125_0002578_9581_10171 196
371 3300048928 Ga0496125_0005769 Ga0496125_0005769_1410_2000 196
372 3300048928 Ga0496125_0043499 Ga0496125_0043499_567_1157 196
373 3300048928 Ga0496125_0073122 Ga0496125_0073122_861_1451 196
374 3300048929 Ga0496126_0002077 Ga0496126_0002077_7089_7679 196
375 3300048929 Ga0496126_0015145 Ga0496126_0015145_3908_4498 196
376 3300048929 Ga0496126_0103173 Ga0496126_0103173_1202_1792 196
377 3300048929 Ga0496126_0108175 Ga0496126_0108175_427_1017 196
378 3300048929 Ga0496126_0697241 Ga0496126_0697241_24_614 196
379 3300049127 Ga0501306_009073 Ga0501306_009073_442_1032 196
380 3300049128 Ga0501308_030330 Ga0501308_030330_83_682 196
381 3300049129 Ga0501309_014803 Ga0501309_014803_76_666 196
382 3300049130 Ga0501310_009305 Ga0501310_009305_112_702 196
383 3300049161 Ga0501305_007464 Ga0501305_007464_388_978 196
384 3300049162 Ga0501307_005288 Ga0501307_005288_442_1032 196
385 3300049536 Ga0501320_004361 Ga0501320_004361_194_784 196
386 3300049539 Ga0501323_002830 Ga0501323_002830_466_1056 196
387 3300049571 Ga0501034_0002490 Ga0501034_0002490_5320_5910 196
388 3300049571 Ga0501034_0023372 Ga0501034_0023372_3453_4046 196
389 3300049571 Ga0501034_0032413 Ga0501034_0032413_3566_4174 196
390 3300049571 Ga0501034_0037011 Ga0501034_0037011_3031_3627 196
391 3300049571 Ga0501034_0040057 Ga0501034_0040057_2370_2963 196
392 3300049573 Ga0501037_0357545 Ga0501037_0357545_29_625 196
393 3300049574 Ga0501038_0020229 Ga0501038_0020229_2694_3284 196
394 3300049574 Ga0501038_0370516 Ga0501038_0370516_147_737 196
395 3300049575 Ga0501039_0069542 Ga0501039_0069542_550_1140 196
396 3300049579 Ga0501043_0087089 Ga0501043_0087089_886_1479 196
397 3300049583 Ga0501067_0042653 Ga0501067_0042653_769_1362 196
398 3300049585 Ga0501069_0203378 Ga0501069_0203378_241_834 196
399 3300049586 Ga0501070_0000874 Ga0501070_0000874_8086_8679 196
400 3300049586 Ga0501070_0068175 Ga0501070_0068175_1778_2368 196
401 3300049588 Ga0501072_0062259 Ga0501072_0062259_509_1102 196
402 3300049589 Ga0501073_0000030 Ga0501073_0000030_94218_94832 196
403 3300049589 Ga0501073_0069543 Ga0501073_0069543_1098_1691 196
404 3300049589 Ga0501073_0397237 Ga0501073_0397237_194_787 196
405 3300049741 Ga0501079_0304883 Ga0501079_0304883_184_777 196
406 3300049742 Ga0501080_0000208 Ga0501080_0000208_14664_15257 196
407 3300050490 nmdc:mga03n38_279311_c1 nmdc:mga03n38_279311_c1_238_828 196
408 3300050491 nmdc:mga00v17_105512_c1 nmdc:mga00v17_105512_c1_651_1241 196
409 3300050491 nmdc:mga00v17_99131_c1 nmdc:mga00v17_99131_c1_1153_1743 196
410 3300050492 nmdc:mga0yw44_436589_c1 nmdc:mga0yw44_436589_c1_15_608 196
411 3300050496 nmdc:mga07m45_203437_c1 nmdc:mga07m45_203437_c1_189_779 196
412 3300053108 Ga0500562_001347 Ga0500562_001347_2731_3342 196
413 3300053116 Ga0500592_049954 Ga0500592_049954_35_628 196
414 3300053117 Ga0500593_052144 Ga0500593_052144_66_656 196
415 3300053139 Ga0500568_0018835 Ga0500568_0018835_14_607 196
416 3300053139 Ga0500568_0125044 Ga0500568_0125044_198_791 196
417 3300053148 Ga0500590_058221 Ga0500590_058221_946_1551 196
418 3300053153 Ga0500616_0000027 Ga0500616_0000027_210124_210717 196
419 3300053153 Ga0500616_0000117 Ga0500616_0000117_94347_94940 196
420 3300053153 Ga0500616_0002723 Ga0500616_0002723_7665_8258 196
421 3300053155 Ga0500620_000519 Ga0500620_000519_956_1561 196
422 3300053730 Ga0500645_080478 Ga0500645_080478_202_819 196
423 3300053739 Ga0500587_024472 Ga0500587_024472_18_611 196
424 3300054114 Ga0501084_0776060 Ga0501084_0776060_52_645 196
425 3300059477 Ga0587084_000004 Ga0587084_000004_6889_7479 196
426 3300059491 Ga0587070_000783 Ga0587070_000783_1047_1637 196
427 3300059492 Ga0587073_0035398 Ga0587073_0035398_16_606 196
428 3300059493 Ga0587077_001116 Ga0587077_001116_1493_2083 196
429 3300059506 Ga0587085_001114 Ga0587085_001114_1323_1913 196
430 3300059507 Ga0587086_000329 Ga0587086_000329_1437_2027 196
431 3300059508 Ga0587088_020892 Ga0587088_020892_461_1051 196
432 3300059510 Ga0587090_001053 Ga0587090_001053_1027_1617 196
433 3300059511 Ga0587091_000453 Ga0587091_000453_1469_2059 196
434 3300059512 Ga0587092_000723 Ga0587092_000723_1197_1787 196
435 3300059513 Ga0587094_000376 Ga0587094_000376_1318_1908 196
436 3300059514 Ga0587095_000117 Ga0587095_000117_1324_1914 196
437 3300059607 Ga0587125_000594 Ga0587125_000594_213_803 196
438 3300059623 Ga0587101_000011 Ga0587101_000011_1502_2092 196
439 3300059626 Ga0587115_000267 Ga0587115_000267_1353_1943 196
440 3300059642 Ga0587069_006866 Ga0587069_006866_504_1094 196
441 3300059648 Ga0587100_000081 Ga0587100_000081_1821_2411 196
442 3300059651 Ga0587105_003189 Ga0587105_003189_311_901 196
443 3300059659 Ga0587120_004840 Ga0587120_004840_19_609 196
444 3300059660 Ga0587124_000269 Ga0587124_000269_1535_2125 196
445 3300060346 Ga0587111_0000761 Ga0587111_0000761_1278_1868 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

110

203

0.98

PF00281

Ribosomal_L5

Ribosomal protein L5

46

106

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9755 16 189
8crx-assembly1.cif.gz_f cutibacterium acnes 70s ribosome with mrna, p-site trna and sarecycline bound 0.9727 13 191
8cvm-assembly1.cif.gz_f cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9691 13 193
8fn2-assembly1.cif.gz_G the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9658 11 191
7azo-assembly1.cif.gz_L5A 70s thermus thermophilus ribosome with bound antibiotic lead seq-977 0.965 15 191
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9602 15 189 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9445 15 189 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9144 34 189 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9065 34 191 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9057 34 185 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A534PYF4-F1-model_v4 Large ribosomal subunit protein uL5 0.9849 13 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-B3QYD6-F1-model_v4 Large ribosomal subunit protein uL5 0.9844 12 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A6B8VES7-F1-model_v4 Large ribosomal subunit protein uL5 0.9838 13 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y2FLE2-F1-model_v4 Large ribosomal subunit protein uL5 0.9834 14 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A4Q5X1Z8-F1-model_v4 Large ribosomal subunit protein uL5 0.9833 9 191 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
81.7 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map