F445400

General Info

Members Datasets Scaffolds Average Seq Length
445 301 412 304

Family's Representative Sequence

Representative Sequence 3300002987|JGI25159J45721_1012339|JGI25159J45721_10123392
Length 314
Sequence MIGYLVRRIVLAIPTLFVMLTAIFVLVRLVPGDAASVILGDQASAASLAALREKLGLDQPVHVQYLAFLGKILTGDFGESLSSGRSVIREVLLVLPSTIELTVAAITIGLLFGLPLGVAAALSRNGWVDYVSRVVSLVGLSFPAFVSGILMLIVFAIQLNWFPVLGNTSGAGSFAERMRALALPALNLGIIMIAYVMRVTRAAMLGVLTEDYIRTARAKGVGPAQLVVTHALRNGLIPIITVVGLYFGTLIGNSVLTEIIFNRPGLGKLIIGALNARDYTLLQGLMIIFAICVIVVNTLTDLAYGLVDPRVKYS

Samples

Sample ID Description Type Environment
1 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
2 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
5 2643221621 Achromobacter sp. Root83 Isolate Unclassified
6 2643221734 Bosea sp. Root670 Isolate Unclassified
7 2643221736 Bosea sp. Root483D1 Isolate Unclassified
8 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
9 2818991467 Bosea vestrisii 3192 Isolate Unclassified
10 2841760612 Bosea sp. Tri-49 Isolate Nodule
11 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
12 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
13 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
14 2844104063 Bosea sp. Tri-39 Isolate Nodule
15 2851182111 Bosea sp. Tri-44 Isolate Nodule
16 2851246043 Bosea sp. Tri-54 Isolate Nodule
17 2855730933 Achromobacter sp. HZ28 Isolate Nodule
18 2855767633 Achromobacter sp. HZ34 Isolate Nodule
19 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
20 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
21 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
22 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
23 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
24 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
25 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
26 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
27 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
28 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
29 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
30 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
119 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
201 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
202 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
208 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
209 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
286 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
287 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
293 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
294 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
295 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
296 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
297 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
300 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
301 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.58
Metatranscriptomes 0
Isolates 7.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.46
Nodule 2.92
Rhizoplane 5.17
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1012339 3300002987 Bacteria 2044
2 JGI25151J46595_10000441 3300003187 Bacteria 40607
3 JGI25151J46595_10000584 3300003187 Bacteria 32416
4 JGI25151J46595_10061271 3300003187 Bacteria 1198
5 Ga0055526_1000027 3300003771 Bacteria 150957
6 Ga0065165_1000014 3300005262 Bacteria 292366
7 Ga0065715_10100394 3300005293 Bacteria 3308
8 Ga0070676_10014053 3300005328 Bacteria 4393
9 Ga0070683_100017757 3300005329 Bacteria 6286
10 Ga0070683_100033906 3300005329 Bacteria 4659
11 Ga0070670_100000782 3300005331 Bacteria 24722
12 Ga0070670_100059245 3300005331 Bacteria 3286
13 Ga0070677_10001013 3300005333 Bacteria 9080
14 Ga0068869_100012055 3300005334 Bacteria 5696
15 Ga0070666_10073503 3300005335 Bacteria 2329
16 Ga0070680_100296508 3300005336 Bacteria 1371
17 Ga0068868_100046821 3300005338 Bacteria 3385
18 Ga0070660_100046519 3300005339 Bacteria 3326
19 Ga0070687_100036650 3300005343 Bacteria 2446
20 Ga0070661_100000387 3300005344 Bacteria 34490
21 Ga0070661_100205346 3300005344 Bacteria 1507
22 Ga0070668_100002747 3300005347 Bacteria 12952
23 Ga0070669_100002018 3300005353 Bacteria 14694
24 Ga0070669_100109508 3300005353 Bacteria 2094
25 Ga0070675_100000313 3300005354 Bacteria 32680
26 Ga0070671_100007425 3300005355 Bacteria 8761
27 Ga0070671_100065440 3300005355 Bacteria 3028
28 Ga0070671_100102829 3300005355 Bacteria 2397
29 Ga0070674_100003130 3300005356 Bacteria 9219
30 Ga0070674_100252457 3300005356 Bacteria 1386
31 Ga0070659_100244235 3300005366 Bacteria 1487
32 Ga0070667_100121394 3300005367 Bacteria 2273
33 Ga0070667_100263216 3300005367 Bacteria 1545
34 Ga0070667_100326942 3300005367 Bacteria 1384
35 Ga0070714_100030392 3300005435 Bacteria 4496
36 Ga0070663_100055572 3300005455 Bacteria 2834
37 Ga0070678_100042218 3300005456 Bacteria 3240
38 Ga0070678_100109020 3300005456 Bacteria 2162
39 Ga0070678_100117760 3300005456 Bacteria 2089
40 Ga0070678_100229306 3300005456 Bacteria 1547
41 Ga0070662_100031752 3300005457 Bacteria 3709
42 Ga0070662_100059042 3300005457 Bacteria 2793
43 Ga0070681_10041059 3300005458 Bacteria 4636
44 Ga0068867_100022558 3300005459 Bacteria 4500
45 Ga0070698_100178862 3300005471 Bacteria 2060
46 Ga0070679_100006687 3300005530 Bacteria 10754
47 Ga0070679_100019143 3300005530 Bacteria 6652
48 Ga0070684_100005072 3300005535 Bacteria 10058
49 Ga0068853_100030736 3300005539 Bacteria 4538
50 Ga0070672_100000269 3300005543 Bacteria 29466
51 Ga0070672_100170198 3300005543 Bacteria 1811
52 Ga0070672_100225926 3300005543 Bacteria 1571
53 Ga0070693_100019868 3300005547 Bacteria 3532
54 Ga0070693_100136818 3300005547 Bacteria 1538
55 Ga0070665_100098411 3300005548 Bacteria 2930
56 Ga0068855_100003942 3300005563 Bacteria 18114
57 Ga0070664_100001228 3300005564 Bacteria 20492
58 Ga0070664_100183770 3300005564 Bacteria 1860
59 Ga0068857_100000661 3300005577 Bacteria 25473
60 Ga0068854_100147049 3300005578 Bacteria 1814
61 Ga0068854_100213812 3300005578 Bacteria 1522
62 Ga0068856_100003798 3300005614 Bacteria 15129
63 Ga0068852_100000815 3300005616 Bacteria 20579
64 Ga0068852_100167770 3300005616 Bacteria 2055
65 Ga0068859_100220160 3300005617 Bacteria 1986
66 Ga0068859_100486246 3300005617 Bacteria 1330
67 Ga0068864_100046186 3300005618 Bacteria 3736
68 Ga0068864_100071128 3300005618 Bacteria 3028
69 Ga0068864_100090980 3300005618 Bacteria 2690
70 Ga0068864_100172195 3300005618 Bacteria 1974
71 Ga0068864_100291871 3300005618 Bacteria 1524
72 Ga0068861_100001218 3300005719 Bacteria 16020
73 Ga0068861_100005248 3300005719 Bacteria 8732
74 Ga0068851_10005894 3300005834 Bacteria 5577
75 Ga0068851_10033271 3300005834 Bacteria 2569
76 Ga0068870_10183747 3300005840 Bacteria 1257
77 Ga0068863_100036241 3300005841 Bacteria 4699
78 Ga0068863_100069734 3300005841 Bacteria 3324
79 Ga0068863_100116395 3300005841 Bacteria 2547
80 Ga0068860_100049817 3300005843 Bacteria 3988
81 Ga0068860_100060185 3300005843 Bacteria 3609
82 Ga0068860_100121101 3300005843 Bacteria 2505
83 Ga0068860_100148090 3300005843 Bacteria 2260
84 Ga0068862_100302678 3300005844 Bacteria 1471
85 Ga0075365_10012772 3300006038 Bacteria 5001
86 Ga0075363_100072100 3300006048 Bacteria 1878
87 Ga0075363_100136338 3300006048 Bacteria 1379
88 Ga0075364_10006323 3300006051 Bacteria 6960
89 Ga0075364_10016107 3300006051 Bacteria 4646
90 Ga0075364_10046484 3300006051 Bacteria 2826
91 Ga0075367_10046969 3300006178 Bacteria 2538
92 Ga0097621_100013308 3300006237 Bacteria 6128
93 Ga0097621_100045138 3300006237 Bacteria 3558
94 Ga0097621_100074128 3300006237 Bacteria 2819
95 Ga0075370_10069057 3300006353 Bacteria 2019
96 Ga0068871_100038836 3300006358 Bacteria 3805
97 Ga0068871_100092778 3300006358 Bacteria 2518
98 Ga0068871_100173557 3300006358 Bacteria 1849
99 Ga0075428_100454247 3300006844 Bacteria 1372
100 Ga0075430_100191608 3300006846 Bacteria 1699
101 Ga0068865_100028710 3300006881 Bacteria 3684
102 Ga0068865_100320394 3300006881 Bacteria 1247
103 Ga0097620_100220159 3300006931 Bacteria 1986
104 Ga0097620_100486200 3300006931 Bacteria 1330
105 Ga0105240_10009471 3300009093 Bacteria 13790
106 Ga0105240_10765762 3300009093 Bacteria 1048
107 Ga0105245_10036246 3300009098 Bacteria 4380
108 Ga0105243_10182298 3300009148 Bacteria 1827
109 Ga0105241_10244627 3300009174 Bacteria 1518
110 Ga0105242_10215590 3300009176 Bacteria 1713
111 Ga0105248_10039921 3300009177 Bacteria 5261
112 Ga0105248_10103885 3300009177 Bacteria 3203
113 Ga0105248_10223714 3300009177 Bacteria 2118
114 Ga0105248_10254838 3300009177 Bacteria 1975
115 Ga0105238_10000239 3300009551 Bacteria 61402
116 Ga0105238_10003580 3300009551 Bacteria 15490
117 Ga0105249_10173746 3300009553 Bacteria 2091
118 Ga0157373_10016191 3300013100 Bacteria 5441
119 Ga0157371_10034798 3300013102 Bacteria 3612
120 Ga0157371_10097350 3300013102 Bacteria 2086
121 Ga0157370_10002344 3300013104 Bacteria 22871
122 Ga0157370_10034136 3300013104 Bacteria 4956
123 Ga0157369_10541523 3300013105 Bacteria 1203
124 Ga0157369_10668809 3300013105 Bacteria 1070
125 Ga0171462_1043 3300013250 Bacteria 56604
126 Ga0157374_10076479 3300013296 Bacteria 3166
127 Ga0157374_10132894 3300013296 Bacteria 2409
128 Ga0157374_10668795 3300013296 Bacteria 1051
129 Ga0163162_10268801 3300013306 Bacteria 1837
130 Ga0163162_10338999 3300013306 Bacteria 1636
131 Ga0163162_10749188 3300013306 Bacteria 1096
132 Ga0157372_10004938 3300013307 Bacteria 14162
133 Ga0157372_10055170 3300013307 Bacteria 4436
134 Ga0157372_10128364 3300013307 Bacteria 2916
135 Ga0157372_10800527 3300013307 Bacteria 1095
136 Ga0157375_10044109 3300013308 Bacteria 4329
137 Ga0157375_10183950 3300013308 Bacteria 2242
138 Ga0157375_10343367 3300013308 Bacteria 1658
139 Ga0163163_10053558 3300014325 Bacteria 3983
140 Ga0182008_10001409 3300014497 Bacteria 16139
141 Ga0182008_10101469 3300014497 Bacteria 1423
142 Ga0157379_10009378 3300014968 Bacteria 8528
143 Ga0157379_10148169 3300014968 Bacteria 2117
144 Ga0157376_10000947 3300014969 Bacteria 18887
145 Ga0182006_1001180 3300015261 Bacteria 16409
146 Ga0182007_10001942 3300015262 Bacteria 10705
147 Ga0213876_10004109 3300021384 Bacteria 8176
148 Ga0209672_105433 3300025228 Bacteria 2183
149 Ga0209565_1018307 3300025263 Bacteria 1516
150 Ga0209455_1001357 3300025272 Bacteria 11241
151 Ga0209130_1000024 3300025284 Bacteria 354212
152 Ga0209675_1000570 3300025291 Bacteria 26588
153 Ga0209025_1000017 3300025294 Bacteria 768983
154 Ga0209025_1000018 3300025294 Bacteria 686898
155 Ga0209025_1006499 3300025294 Bacteria 9042
156 Ga0209564_1000180 3300025295 Bacteria 151009
157 Ga0209256_1018689 3300025299 Bacteria 2238
158 Ga0207426_1046565 3300025302 Bacteria 1313
159 Ga0209257_1042372 3300025304 Bacteria 1344
160 Ga0207697_10007598 3300025315 Bacteria 4813
161 Ga0207656_10018399 3300025321 Bacteria 2751
162 Ga0207656_10029296 3300025321 Bacteria 2266
163 Ga0207656_10108801 3300025321 Bacteria 1279
164 Ga0207682_10000830 3300025893 Bacteria 14279
165 Ga0207645_10004381 3300025907 Bacteria 10455
166 Ga0207705_10122375 3300025909 Bacteria 1932
167 Ga0207707_10005745 3300025912 Bacteria 10848
168 Ga0207707_10053249 3300025912 Bacteria 3523
169 Ga0207695_10018006 3300025913 Bacteria 8180
170 Ga0207660_10288275 3300025917 Bacteria 1305
171 Ga0207662_10058940 3300025918 Bacteria 2300
172 Ga0207657_10007074 3300025919 Bacteria 11527
173 Ga0207657_10078446 3300025919 Bacteria 2781
174 Ga0207652_10040962 3300025921 Bacteria 3936
175 Ga0207681_10025918 3300025923 Bacteria 3777
176 Ga0207681_10072928 3300025923 Bacteria 2399
177 Ga0207694_10023448 3300025924 Bacteria 4684
178 Ga0207650_10001673 3300025925 Bacteria 15751
179 Ga0207650_10023687 3300025925 Bacteria 4358
180 Ga0207650_10077481 3300025925 Bacteria 2513
181 Ga0207659_10002368 3300025926 Bacteria 11222
182 Ga0207664_10022834 3300025929 Bacteria 4679
183 Ga0207664_10123720 3300025929 Bacteria 2169
184 Ga0207644_10002722 3300025931 Bacteria 11388
185 Ga0207644_10069226 3300025931 Bacteria 2576
186 Ga0207690_10192898 3300025932 Bacteria 1542
187 Ga0207706_10000416 3300025933 Bacteria 45659
188 Ga0207706_10107831 3300025933 Bacteria 2451
189 Ga0207709_10036461 3300025935 Bacteria 2914
190 Ga0207670_10118245 3300025936 Bacteria 1922
191 Ga0207669_10038791 3300025937 Bacteria 2746
192 Ga0207669_10305474 3300025937 Bacteria 1211
193 Ga0207704_10034067 3300025938 Bacteria 2903
194 Ga0207691_10000561 3300025940 Bacteria 37149
195 Ga0207711_10018097 3300025941 Bacteria 5859
196 Ga0207711_10023489 3300025941 Bacteria 5162
197 Ga0207711_10063334 3300025941 Bacteria 3192
198 Ga0207711_10173059 3300025941 Bacteria 1960
199 Ga0207711_10295616 3300025941 Bacteria 1493
200 Ga0207689_10000220 3300025942 Bacteria 50583
201 Ga0207689_10057044 3300025942 Bacteria 3213
202 Ga0207661_10125497 3300025944 Bacteria 2191
203 Ga0207679_10020457 3300025945 Bacteria 4466
204 Ga0207679_10286759 3300025945 Bacteria 1414
205 Ga0207667_10229098 3300025949 Bacteria 1903
206 Ga0207651_10187708 3300025960 Bacteria 1646
207 Ga0207651_10229764 3300025960 Bacteria 1505
208 Ga0207712_10083317 3300025961 Bacteria 2334
209 Ga0207668_10019485 3300025972 Bacteria 4291
210 Ga0207668_10211955 3300025972 Bacteria 1550
211 Ga0207658_10122267 3300025986 Bacteria 2077
212 Ga0207658_10245748 3300025986 Bacteria 1518
213 Ga0207639_10011834 3300026041 Bacteria 6067
214 Ga0207678_10102122 3300026067 Bacteria 2448
215 Ga0207678_10106499 3300026067 Bacteria 2392
216 Ga0207702_10003907 3300026078 Bacteria 13413
217 Ga0207702_10374776 3300026078 Bacteria 1367
218 Ga0207641_10083484 3300026088 Bacteria 2778
219 Ga0207648_10001824 3300026089 Bacteria 23286
220 Ga0207648_10016554 3300026089 Bacteria 6733
221 Ga0207676_10043554 3300026095 Bacteria 3457
222 Ga0207676_10066517 3300026095 Bacteria 2875
223 Ga0207676_10131021 3300026095 Bacteria 2132
224 Ga0207676_10442624 3300026095 Bacteria 1223
225 Ga0207674_10000605 3300026116 Bacteria 47083
226 Ga0207675_100000548 3300026118 Bacteria 36639
227 Ga0207675_100003122 3300026118 Bacteria 16252
228 Ga0207675_100044374 3300026118 Bacteria 4154
229 Ga0207683_10025715 3300026121 Bacteria 5078
230 Ga0207683_10144126 3300026121 Bacteria 2147
231 Ga0207683_10434640 3300026121 Bacteria 1209
232 Ga0207698_10001837 3300026142 Bacteria 12404
233 Ga0207698_10010341 3300026142 Bacteria 5987
234 Ga0207698_10348829 3300026142 Bacteria 1397
235 Ga0268266_10057615 3300028379 Bacteria 3344
236 Ga0268265_10164735 3300028380 Bacteria 1888
237 Ga0268264_10093881 3300028381 Bacteria 2593
238 Ga0265318_10012822 3300028577 Bacteria 3555
239 Ga0265332_10022895 3300031238 Bacteria 2756
240 Ga0265328_10007699 3300031239 Bacteria 4478
241 Ga0265320_10010529 3300031240 Bacteria 5502
242 Ga0265331_10032916 3300031250 Bacteria 2565
243 Ga0307513_10000458 3300031456 Bacteria 58799
244 Ga0307513_10351347 3300031456 Bacteria 1222
245 Ga0265314_10000277 3300031711 Bacteria 74718
246 Ga0265342_10037339 3300031712 Bacteria 2963
247 Ga0307405_10059876 3300031731 Bacteria 2401
248 Ga0307413_10016872 3300031824 Bacteria 3789
249 Ga0307410_10083511 3300031852 Bacteria 2249
250 Ga0307412_10000252 3300031911 Bacteria 34826
251 Ga0307412_10005252 3300031911 Bacteria 7263
252 Ga0307409_100027674 3300031995 Bacteria 4023
253 Ga0307416_100125002 3300032002 Bacteria 2302
254 Ga0307414_10018629 3300032004 Bacteria 4281
255 Ga0307411_10019456 3300032005 Bacteria 3922
256 Ga0307510_10000029 3300033180 Bacteria 115686
257 Ga0373951_0036538 3300035091 Bacteria 1173
258 Ga0373955_0058066 3300035172 Bacteria 2128
259 Ga0373931_0022196 3300035691 Bacteria 3192
260 Ga0373937_0359251 3300036401 Bacteria 1380
261 Ga0395898_0005759 3300037466 Bacteria 13337
262 Ga0395905_0000063 3300037471 Bacteria 187830
263 Ga0395905_0208326 3300037471 Bacteria 1832
264 Ga0436364_0933571 3300037853 Bacteria 1550
265 Ga0395901_0000026 3300038443 Bacteria 249248
266 Ga0395901_0000045 3300038443 Bacteria 188874
267 Ga0436365_0156089 3300039437 Bacteria 2229
268 Ga0436365_0161983 3300039437 Bacteria 9173
269 Ga0436365_0382394 3300039437 Bacteria 1245
270 Ga0436365_0614178 3300039437 Bacteria 3448
271 Ga0436365_0633965 3300039437 Bacteria 1593
272 Ga0436360_1090220 3300039438 Bacteria 3083
273 Ga0436361_0106719 3300039447 Bacteria 6126
274 Ga0436363_1233042 3300039450 Bacteria 1027
275 Ga0436363_1499244 3300039450 Bacteria 1372
276 Ga0439438_000303 3300041405 Bacteria 22066
277 Ga0439447_000174 3300041407 Bacteria 22394
278 Ga0439447_004186 3300041407 Bacteria 5008
279 Ga0439466_0000018 3300041411 Bacteria 103207
280 Ga0439465_0019229 3300041413 Bacteria 2135
281 Ga0451853_0671037 3300041512 Bacteria 1443
282 Ga0439452_002367 3300042010 Bacteria 7002
283 Ga0450906_006910 3300042145 Bacteria 2266
284 Ga0450907_004607 3300042146 Bacteria 2368
285 Ga0450910_000036 3300042147 Bacteria 15727
286 Ga0450908_000057 3300042184 Bacteria 22298
287 Ga0453684_0008467 3300044712 Bacteria 18410
288 Ga0451576_0029621 3300045051 Bacteria 5857
289 Ga0451576_0071024 3300045051 Bacteria 3624
290 Ga0495592_0258173 3300046454 Bacteria 1149
291 Ga0495603_0136467 3300046455 Bacteria 1428
292 Ga0495638_0061310 3300046460 Bacteria 2324
293 Ga0495653_0000340 3300046463 Bacteria 38062
294 Ga0495653_0121299 3300046463 Bacteria 1863
295 Ga0495650_0031274 3300046471 Bacteria 2398
296 Ga0495582_0105840 3300046473 Bacteria 1578
297 Ga0495585_0142682 3300046492 Bacteria 1253
298 Ga0495607_0000004 3300046501 Bacteria 317271
299 Ga0495607_0000782 3300046501 Bacteria 30333
300 Ga0495607_0001077 3300046501 Bacteria 24947
301 Ga0495583_0001011 3300046506 Bacteria 32138
302 Ga0495608_0135807 3300046511 Bacteria 1572
303 Ga0495610_0054196 3300046512 Bacteria 1938
304 Ga0495610_0082730 3300046512 Bacteria 1471
305 Ga0495632_0034140 3300046519 Bacteria 2606
306 Ga0495654_0000495 3300046530 Bacteria 32218
307 Ga0495654_0014932 3300046530 Bacteria 4126
308 Ga0495586_0110443 3300046535 Bacteria 1530
309 Ga0495609_0000091 3300046538 Bacteria 106458
310 Ga0495645_0132525 3300046543 Bacteria 1745
311 Ga0495625_0000173 3300046660 Bacteria 101216
312 Ga0495661_0006696 3300046665 Bacteria 8090
313 Ga0495588_0000211 3300046674 Bacteria 55979
314 Ga0495647_0041340 3300046681 Bacteria 1755
315 Ga0495613_0044047 3300046689 Bacteria 3302
316 Ga0495674_0134224 3300047319 Bacteria 2084
317 Ga0495687_004057 3300047443 Bacteria 10146
318 Ga0495687_013244 3300047443 Unclassified 4315
319 Ga0495681_0006350 3300047470 Bacteria 7781
320 Ga0495626_0135340 3300048091 Bacteria 1048
321 Ga0496101_0265933 3300048904 Bacteria 1338
322 Ga0496102_0102756 3300048905 Bacteria 2657
323 Ga0496102_0508736 3300048905 Bacteria 1127
324 Ga0496104_0000854 3300048907 Bacteria 26337
325 Ga0496104_0124240 3300048907 Bacteria 2478
326 Ga0496105_0002766 3300048908 Bacteria 12815
327 Ga0496105_0271539 3300048908 Bacteria 1369
328 Ga0496106_0033025 3300048909 Bacteria 3859
329 Ga0496107_0040428 3300048910 Bacteria 3347
330 Ga0496108_0053473 3300048911 Bacteria 3387
331 Ga0496108_0078255 3300048911 Bacteria 2798
332 Ga0496108_0181484 3300048911 Bacteria 1823
333 Ga0496109_0023033 3300048912 Bacteria 5522
334 Ga0496109_0075483 3300048912 Bacteria 3099
335 Ga0496109_0175537 3300048912 Bacteria 2011
336 Ga0496110_0052405 3300048913 Bacteria 3585
337 Ga0496110_0374246 3300048913 Bacteria 1298
338 Ga0496111_0040641 3300048914 Bacteria 3336
339 Ga0496112_0063874 3300048915 Bacteria 3632
340 Ga0496112_0482367 3300048915 Bacteria 1176
341 Ga0496113_0002812 3300048916 Bacteria 10241
342 Ga0496114_0020035 3300048917 Bacteria 5426
343 Ga0496115_0107344 3300048918 Bacteria 2292
344 Ga0496117_0023650 3300048920 Bacteria 4888
345 Ga0496117_0029315 3300048920 Bacteria 4245
346 Ga0496117_0053063 3300048920 Bacteria 2851
347 Ga0496118_0029213 3300048921 Bacteria 4627
348 Ga0496121_0016352 3300048924 Bacteria 7666
349 Ga0496121_0190317 3300048924 Bacteria 1472
350 Ga0496122_0016614 3300048925 Bacteria 6946
351 Ga0496122_0056743 3300048925 Bacteria 2916
352 Ga0496123_0013951 3300048926 Bacteria 6695
353 Ga0496123_0110811 3300048926 Bacteria 1569
354 Ga0496124_0000038 3300048927 Bacteria 312485
355 Ga0496124_0245303 3300048927 Bacteria 1329
356 Ga0496125_0120945 3300048928 Bacteria 1868
357 Ga0496126_0162604 3300048929 Bacteria 1907
358 Ga0501031_0000005 3300049568 Bacteria 183960
359 Ga0501032_0000337 3300049569 Bacteria 39238
360 Ga0501033_0000631 3300049570 Bacteria 32526
361 Ga0501033_0016211 3300049570 Bacteria 5643
362 Ga0501033_0151234 3300049570 Bacteria 1675
363 Ga0501034_0001953 3300049571 Bacteria 26109
364 Ga0501034_0044417 3300049571 Bacteria 4495
365 Ga0501036_0000014 3300049572 Bacteria 148705
366 Ga0501037_0000517 3300049573 Bacteria 30998
367 Ga0501038_0000024 3300049574 Bacteria 148705
368 Ga0501038_0069390 3300049574 Bacteria 2994
369 Ga0501039_0000122 3300049575 Bacteria 53871
370 Ga0501040_0014270 3300049576 Bacteria 5233
371 Ga0501043_0000987 3300049579 Bacteria 25068
372 Ga0501047_0001328 3300049581 Bacteria 24254
373 Ga0501047_0002249 3300049581 Bacteria 18472
374 Ga0501067_0011293 3300049583 Bacteria 4946
375 Ga0501070_0002802 3300049586 Bacteria 15213
376 Ga0501070_0171349 3300049586 Bacteria 1788
377 Ga0501074_0078651 3300049590 Bacteria 2367
378 Ga0501227_002667 3300049665 Bacteria 3915
379 Ga0501035_0000045 3300049822 Bacteria 148705
380 Ga0501035_0018636 3300049822 Bacteria 6392
381 Ga0501035_0302995 3300049822 Bacteria 1346
382 Ga0501044_0000044 3300049823 Bacteria 148705
383 Ga0501044_0003322 3300049823 Bacteria 18122
384 nmdc:mga03n38_58627_c1 3300050490 Bacteria 1745
385 nmdc:mga00v17_3430_c2 3300050491 Bacteria 4875
386 nmdc:mga0yw44_104797_c1 3300050492 Bacteria 1806
387 nmdc:mga0k408_71589_c1 3300050493 Bacteria 2024
388 nmdc:mga06z11_2217_c1 3300050494 Bacteria 7384
389 nmdc:mga06z11_25407_c1 3300050494 Bacteria 2807
390 nmdc:mga06z11_66485_c1 3300050494 Bacteria 1895
391 nmdc:mga06z11_82287_c1 3300050494 Bacteria 1730
392 nmdc:mga07m45_87930_c2 3300050496 Bacteria 1329
393 nmdc:mga0rr50_210801_c1 3300050513 Bacteria 1600
394 nmdc:mga0rr50_225491_c1 3300050513 Bacteria 1549
395 Ga0500610_0000690 3300053079 Bacteria 10468
396 Ga0495619_0259618 3300053085 Bacteria 1204
397 Ga0500572_000208 3300053111 Bacteria 20777
398 Ga0500608_072688 3300053122 Bacteria 1634
399 Ga0500618_002577 3300053125 Bacteria 6713
400 Ga0500559_0157567 3300053136 Bacteria 1066
401 Ga0500568_0003635 3300053139 Bacteria 8496
402 Ga0500568_0041809 3300053139 Bacteria 1840
403 Ga0500574_000022 3300053141 Bacteria 27422
404 Ga0500616_0000465 3300053153 Bacteria 52660
405 Ga0500616_0023023 3300053153 Bacteria 3474
406 Ga0500624_001856 3300053157 Bacteria 3059
407 Ga0500639_008527 3300053163 Bacteria 5349
408 Ga0500636_0003252 3300053177 Bacteria 9106
409 Ga0500576_059255 3300053725 Bacteria 1679
410 Ga0500596_000787 3300053735 Bacteria 6251
411 Ga0500661_009126 3300055283 Bacteria 1820
412 Ga0501082_0040593 3300060353 Bacteria 4013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2738541309 2738899713 257
2 3300049568 Ga0501031_0000005 Ga0501031_0000005_165275_166216 266
3 3300049569 Ga0501032_0000337 Ga0501032_0000337_21267_22208 266
4 3300049570 Ga0501033_0000631 Ga0501033_0000631_14555_15496 266
5 3300049571 Ga0501034_0001953 Ga0501034_0001953_8138_9079 266
6 3300049572 Ga0501036_0000014 Ga0501036_0000014_17031_17972 266
7 3300049573 Ga0501037_0000517 Ga0501037_0000517_17031_17972 266
8 3300049574 Ga0501038_0000024 Ga0501038_0000024_17031_17972 266
9 3300049575 Ga0501039_0000122 Ga0501039_0000122_35900_36841 266
10 3300049576 Ga0501040_0014270 Ga0501040_0014270_3321_4262 266
11 3300049579 Ga0501043_0000987 Ga0501043_0000987_7120_8061 266
12 3300049581 Ga0501047_0001328 Ga0501047_0001328_15212_16153 266
13 3300049586 Ga0501070_0002802 Ga0501070_0002802_3951_4892 266
14 3300049590 Ga0501074_0078651 Ga0501074_0078651_149_1090 266
15 3300049822 Ga0501035_0000045 Ga0501035_0000045_130734_131675 266
16 3300049823 Ga0501044_0000044 Ga0501044_0000044_17031_17972 266
17 3300049822 Ga0501035_0302995 Ga0501035_0302995_42_983 271
18 iso_pu_bacteria 8004395343 8004396827 273
19 3300025929 Ga0207664_10123720 Ga0207664_101237202 281
20 3300028577 Ga0265318_10012822 Ga0265318_100128222 282
21 3300031238 Ga0265332_10022895 Ga0265332_100228953 282
22 3300031239 Ga0265328_10007699 Ga0265328_100076994 282
23 3300031240 Ga0265320_10010529 Ga0265320_100105294 282
24 3300031250 Ga0265331_10032916 Ga0265331_100329162 282
25 3300031711 Ga0265314_10000277 Ga0265314_100002776 282
26 3300031712 Ga0265342_10037339 Ga0265342_100373393 282
27 3300014497 Ga0182008_10001409 Ga0182008_100014097 286
28 3300015261 Ga0182006_1001180 Ga0182006_100118010 286
29 3300015262 Ga0182007_10001942 Ga0182007_100019428 286
30 3300006038 Ga0075365_10012772 Ga0075365_100127723 288
31 3300006051 Ga0075364_10006323 Ga0075364_100063235 288
32 3300050492 nmdc:mga0yw44_104797_c1 nmdc:mga0yw44_104797_c1_56_994 288
33 3300050494 nmdc:mga06z11_66485_c1 nmdc:mga06z11_66485_c1_91_1029 288
34 3300036401 Ga0373937_0359251 Ga0373937_0359251_340_1278 290
35 3300048905 Ga0496102_0508736 Ga0496102_0508736_173_1111 290
36 3300048907 Ga0496104_0000854 Ga0496104_0000854_22635_23573 290
37 3300048908 Ga0496105_0002766 Ga0496105_0002766_9831_10769 290
38 3300048911 Ga0496108_0078255 Ga0496108_0078255_886_1824 290
39 3300048912 Ga0496109_0023033 Ga0496109_0023033_23_961 290
40 3300048915 Ga0496112_0063874 Ga0496112_0063874_282_1220 290
41 3300048916 Ga0496113_0002812 Ga0496113_0002812_2678_3616 290
42 3300005843 Ga0068860_100121101 Ga0068860_1001211012 292
43 3300014968 Ga0157379_10148169 Ga0157379_101481691 292
44 3300021384 Ga0213876_10004109 Ga0213876_100041092 292
45 3300039437 Ga0436365_0161983 Ga0436365_0161983_2901_3842 292
46 3300046530 Ga0495654_0000495 Ga0495654_0000495_9719_10660 292
47 3300053139 Ga0500568_0003635 Ga0500568_0003635_2461_3402 292
48 3300005617 Ga0068859_100220160 Ga0068859_1002201603 293
49 3300005844 Ga0068862_100302678 Ga0068862_1003026782 293
50 3300006931 Ga0097620_100220159 Ga0097620_1002201593 293
51 3300026118 Ga0207675_100044374 Ga0207675_1000443743 293
52 3300050493 nmdc:mga0k408_71589_c1 nmdc:mga0k408_71589_c1_571_1515 293
53 3300025228 Ga0209672_105433 Ga0209672_1054332 294
54 3300025272 Ga0209455_1001357 Ga0209455_10013578 294
55 3300041512 Ga0451853_0671037 Ga0451853_0671037_96_1034 294
56 3300045051 Ga0451576_0029621 Ga0451576_0029621_10_951 294
57 3300046492 Ga0495585_0142682 Ga0495585_0142682_64_1005 294
58 3300046501 Ga0495607_0000782 Ga0495607_0000782_19975_20916 294
59 3300046506 Ga0495583_0001011 Ga0495583_0001011_15875_16816 294
60 3300046512 Ga0495610_0082730 Ga0495610_0082730_318_1259 294
61 3300046530 Ga0495654_0014932 Ga0495654_0014932_795_1736 294
62 3300046538 Ga0495609_0000091 Ga0495609_0000091_35921_36862 294
63 3300046660 Ga0495625_0000173 Ga0495625_0000173_50538_51479 294
64 3300046665 Ga0495661_0006696 Ga0495661_0006696_2806_3747 294
65 3300046674 Ga0495588_0000211 Ga0495588_0000211_50674_51615 294
66 3300046689 Ga0495613_0044047 Ga0495613_0044047_1274_2215 294
67 3300047443 Ga0495687_004057 Ga0495687_004057_8701_9642 294
68 3300047470 Ga0495681_0006350 Ga0495681_0006350_4505_5446 294
69 3300049570 Ga0501033_0151234 Ga0501033_0151234_156_1097 294
70 3300053079 Ga0500610_0000690 Ga0500610_0000690_8973_9914 294
71 3300053122 Ga0500608_072688 Ga0500608_072688_68_1009 294
72 3300053136 Ga0500559_0157567 Ga0500559_0157567_166_1050 294
73 3300053141 Ga0500574_000022 Ga0500574_000022_19818_20759 294
74 3300006048 Ga0075363_100072100 Ga0075363_1000721002 295
75 3300006178 Ga0075367_10046969 Ga0075367_100469693 295
76 3300006353 Ga0075370_10069057 Ga0075370_100690572 295
77 3300039437 Ga0436365_0614178 Ga0436365_0614178_1345_2286 295
78 3300050490 nmdc:mga03n38_58627_c1 nmdc:mga03n38_58627_c1_80_1018 295
79 3300050494 nmdc:mga06z11_25407_c1 nmdc:mga06z11_25407_c1_606_1544 295
80 3300050496 nmdc:mga07m45_87930_c2 nmdc:mga07m45_87930_c2_106_1044 295
81 3300005618 Ga0068864_100046186 Ga0068864_1000461864 296
82 iso_pu_bacteria 2919114240 2919119469 298
83 iso_pu_bacteria 2919171160 2919177168 298
84 3300005471 Ga0070698_100178862 Ga0070698_1001788622 299
85 3300048924 Ga0496121_0190317 Ga0496121_0190317_105_1046 299
86 3300048929 Ga0496126_0162604 Ga0496126_0162604_46_987 299
87 3300005328 Ga0070676_10014053 Ga0070676_100140533 301
88 3300005343 Ga0070687_100036650 Ga0070687_1000366502 301
89 3300005347 Ga0070668_100002747 Ga0070668_1000027475 301
90 3300005367 Ga0070667_100121394 Ga0070667_1001213942 301
91 3300005456 Ga0070678_100109020 Ga0070678_1001090201 301
92 3300005457 Ga0070662_100059042 Ga0070662_1000590421 301
93 3300005543 Ga0070672_100170198 Ga0070672_1001701982 301
94 3300005616 Ga0068852_100167770 Ga0068852_1001677702 301
95 3300005617 Ga0068859_100486246 Ga0068859_1004862462 301
96 3300005719 Ga0068861_100005248 Ga0068861_1000052488 301
97 3300005841 Ga0068863_100036241 Ga0068863_1000362412 301
98 3300005843 Ga0068860_100060185 Ga0068860_1000601851 301
99 3300006881 Ga0068865_100028710 Ga0068865_1000287103 301
100 3300006931 Ga0097620_100486200 Ga0097620_1004862002 301
101 3300009148 Ga0105243_10182298 Ga0105243_101822982 301
102 3300009176 Ga0105242_10215590 Ga0105242_102155902 301
103 3300013306 Ga0163162_10338999 Ga0163162_103389992 301
104 3300013308 Ga0157375_10343367 Ga0157375_103433672 301
105 3300025907 Ga0207645_10004381 Ga0207645_100043819 301
106 3300025918 Ga0207662_10058940 Ga0207662_100589402 301
107 3300025923 Ga0207681_10072928 Ga0207681_100729282 301
108 3300025933 Ga0207706_10107831 Ga0207706_101078312 301
109 3300025935 Ga0207709_10036461 Ga0207709_100364612 301
110 3300025942 Ga0207689_10057044 Ga0207689_100570442 301
111 3300025961 Ga0207712_10083317 Ga0207712_100833172 301
112 3300025986 Ga0207658_10122267 Ga0207658_101222672 301
113 3300026088 Ga0207641_10083484 Ga0207641_100834842 301
114 3300026089 Ga0207648_10016554 Ga0207648_100165546 301
115 3300026095 Ga0207676_10442624 Ga0207676_104426241 301
116 3300026118 Ga0207675_100003122 Ga0207675_1000031226 301
117 3300026121 Ga0207683_10144126 Ga0207683_101441262 301
118 3300026142 Ga0207698_10348829 Ga0207698_103488292 301
119 3300037471 Ga0395905_0208326 Ga0395905_0208326_800_1741 301
120 3300046463 Ga0495653_0000340 Ga0495653_0000340_28270_29211 301
121 3300053125 Ga0500618_002577 Ga0500618_002577_3385_4326 301
122 3300005329 Ga0070683_100033906 Ga0070683_1000339064 302
123 3300005331 Ga0070670_100059245 Ga0070670_1000592453 302
124 3300005339 Ga0070660_100046519 Ga0070660_1000465192 302
125 3300005344 Ga0070661_100000387 Ga0070661_10000038732 302
126 3300005355 Ga0070671_100007425 Ga0070671_1000074253 302
127 3300005435 Ga0070714_100030392 Ga0070714_1000303923 302
128 3300005530 Ga0070679_100019143 Ga0070679_1000191432 302
129 3300005535 Ga0070684_100005072 Ga0070684_1000050725 302
130 3300005539 Ga0068853_100030736 Ga0068853_1000307364 302
131 3300005543 Ga0070672_100225926 Ga0070672_1002259262 302
132 3300005547 Ga0070693_100019868 Ga0070693_1000198683 302
133 3300005563 Ga0068855_100003942 Ga0068855_1000039423 302
134 3300005564 Ga0070664_100001228 Ga0070664_1000012285 302
135 3300005577 Ga0068857_100000661 Ga0068857_1000006615 302
136 3300005578 Ga0068854_100147049 Ga0068854_1001470492 302
137 3300005578 Ga0068854_100213812 Ga0068854_1002138122 302
138 3300005614 Ga0068856_100003798 Ga0068856_1000037985 302
139 3300005616 Ga0068852_100000815 Ga0068852_1000008155 302
140 3300005834 Ga0068851_10033271 Ga0068851_100332712 302
141 3300005840 Ga0068870_10183747 Ga0068870_101837472 302
142 3300005841 Ga0068863_100116395 Ga0068863_1001163952 302
143 3300006237 Ga0097621_100045138 Ga0097621_1000451382 302
144 3300009093 Ga0105240_10009471 Ga0105240_1000947116 302
145 3300009177 Ga0105248_10223714 Ga0105248_102237142 302
146 3300009551 Ga0105238_10000239 Ga0105238_1000023932 302
147 3300013102 Ga0157371_10034798 Ga0157371_100347982 302
148 3300013104 Ga0157370_10002344 Ga0157370_1000234420 302
149 3300013296 Ga0157374_10076479 Ga0157374_100764792 302
150 3300013307 Ga0157372_10004938 Ga0157372_100049383 302
151 3300014497 Ga0182008_10101469 Ga0182008_101014691 302
152 3300025321 Ga0207656_10018399 Ga0207656_100183993 302
153 3300025912 Ga0207707_10053249 Ga0207707_100532493 302
154 3300025913 Ga0207695_10018006 Ga0207695_1001800610 302
155 3300025919 Ga0207657_10007074 Ga0207657_100070743 302
156 3300025921 Ga0207652_10040962 Ga0207652_100409622 302
157 3300025924 Ga0207694_10023448 Ga0207694_100234482 302
158 3300025925 Ga0207650_10023687 Ga0207650_100236873 302
159 3300025925 Ga0207650_10077481 Ga0207650_100774812 302
160 3300025929 Ga0207664_10022834 Ga0207664_100228343 302
161 3300025931 Ga0207644_10002722 Ga0207644_1000272211 302
162 3300025941 Ga0207711_10018097 Ga0207711_100180974 302
163 3300025941 Ga0207711_10173059 Ga0207711_101730592 302
164 3300025944 Ga0207661_10125497 Ga0207661_101254972 302
165 3300025945 Ga0207679_10020457 Ga0207679_100204574 302
166 3300025960 Ga0207651_10229764 Ga0207651_102297642 302
167 3300025972 Ga0207668_10211955 Ga0207668_102119552 302
168 3300026041 Ga0207639_10011834 Ga0207639_100118344 302
169 3300026067 Ga0207678_10102122 Ga0207678_101021223 302
170 3300026078 Ga0207702_10003907 Ga0207702_1000390714 302
171 3300026116 Ga0207674_10000605 Ga0207674_1000060532 302
172 3300026142 Ga0207698_10001837 Ga0207698_100018377 302
173 3300044712 Ga0453684_0008467 Ga0453684_0008467_4238_5176 302
174 3300048912 Ga0496109_0175537 Ga0496109_0175537_10_951 302
175 3300048913 Ga0496110_0374246 Ga0496110_0374246_319_1260 302
176 3300013306 Ga0163162_10749188 Ga0163162_107491881 303
177 3300035172 Ga0373955_0058066 Ga0373955_0058066_353_1294 303
178 3300037466 Ga0395898_0005759 Ga0395898_0005759_9018_9959 303
179 3300038443 Ga0395901_0000045 Ga0395901_0000045_105404_106345 303
180 3300046473 Ga0495582_0105840 Ga0495582_0105840_215_1156 303
181 3300005293 Ga0065715_10100394 Ga0065715_101003942 304
182 3300005331 Ga0070670_100000782 Ga0070670_1000007828 304
183 3300005333 Ga0070677_10001013 Ga0070677_100010137 304
184 3300005335 Ga0070666_10073503 Ga0070666_100735032 304
185 3300005344 Ga0070661_100205346 Ga0070661_1002053462 304
186 3300005353 Ga0070669_100002018 Ga0070669_1000020184 304
187 3300005354 Ga0070675_100000313 Ga0070675_10000031322 304
188 3300005355 Ga0070671_100065440 Ga0070671_1000654403 304
189 3300005355 Ga0070671_100102829 Ga0070671_1001028292 304
190 3300005356 Ga0070674_100003130 Ga0070674_1000031302 304
191 3300005367 Ga0070667_100326942 Ga0070667_1003269422 304
192 3300005456 Ga0070678_100042218 Ga0070678_1000422183 304
193 3300005456 Ga0070678_100229306 Ga0070678_1002293062 304
194 3300005459 Ga0068867_100022558 Ga0068867_1000225582 304
195 3300005543 Ga0070672_100000269 Ga0070672_10000026910 304
196 3300005564 Ga0070664_100183770 Ga0070664_1001837702 304
197 3300005618 Ga0068864_100090980 Ga0068864_1000909803 304
198 3300006237 Ga0097621_100074128 Ga0097621_1000741282 304
199 3300006358 Ga0068871_100092778 Ga0068871_1000927782 304
200 3300025263 Ga0209565_1018307 Ga0209565_10183072 304
201 3300025291 Ga0209675_1000570 Ga0209675_100057022 304
202 3300025304 Ga0209257_1042372 Ga0209257_10423722 304
203 3300025315 Ga0207697_10007598 Ga0207697_100075985 304
204 3300025893 Ga0207682_10000830 Ga0207682_1000083012 304
205 3300025925 Ga0207650_10001673 Ga0207650_1000167312 304
206 3300025926 Ga0207659_10002368 Ga0207659_100023684 304
207 3300025931 Ga0207644_10069226 Ga0207644_100692262 304
208 3300025937 Ga0207669_10038791 Ga0207669_100387912 304
209 3300025938 Ga0207704_10034067 Ga0207704_100340672 304
210 3300025940 Ga0207691_10000561 Ga0207691_1000056124 304
211 3300025945 Ga0207679_10286759 Ga0207679_102867592 304
212 3300025960 Ga0207651_10187708 Ga0207651_101877082 304
213 3300025986 Ga0207658_10245748 Ga0207658_102457482 304
214 3300026089 Ga0207648_10001824 Ga0207648_1000182414 304
215 3300026095 Ga0207676_10066517 Ga0207676_100665173 304
216 3300026121 Ga0207683_10025715 Ga0207683_100257154 304
217 3300048911 Ga0496108_0181484 Ga0496108_0181484_571_1512 304
218 3300053139 Ga0500568_0041809 Ga0500568_0041809_308_1246 304
219 3300046471 Ga0495650_0031274 Ga0495650_0031274_804_1742 305
220 3300037853 Ga0436364_0933571 Ga0436364_0933571_47_991 306
221 3300005336 Ga0070680_100296508 Ga0070680_1002965081 307
222 3300005458 Ga0070681_10041059 Ga0070681_100410592 307
223 3300005530 Ga0070679_100006687 Ga0070679_1000066872 307
224 3300009093 Ga0105240_10765762 Ga0105240_107657621 307
225 3300013104 Ga0157370_10034136 Ga0157370_100341363 307
226 3300025912 Ga0207707_10005745 Ga0207707_100057456 307
227 3300025917 Ga0207660_10288275 Ga0207660_102882752 307
228 3300038443 Ga0395901_0000026 Ga0395901_0000026_179299_180240 308
229 3300048927 Ga0496124_0000038 Ga0496124_0000038_196340_197281 308
230 iso_pu_bacteria 2510917026 2511169610 308
231 iso_pu_bacteria 2513237086 2513587413 308
232 iso_pu_bacteria 2513237104 2513721349 308
233 iso_pu_bacteria 2537561587 2537876922 308
234 iso_pu_bacteria 2643221734 2644736453 308
235 iso_pu_bacteria 2818991467 2819718536 308
236 iso_pu_bacteria 2841911363 2841914756 308
237 iso_pu_bacteria 2841917233 2841920079 308
238 iso_pu_bacteria 2885270888 2885270959 308
239 iso_pu_bacteria 2643221621 2644124029 309
240 iso_pu_bacteria 2842333319 2842335184 309
241 iso_pu_bacteria 2855730933 2855731861 309
242 iso_pu_bacteria 2855767633 2855768567 309
243 iso_pu_bacteria 2857542790 2857544652 309
244 iso_pu_bacteria 2881412998 2881415461 309
245 iso_pu_bacteria 2881927736 2881930006 309
246 iso_pu_bacteria 2889790730 2889791071 309
247 iso_pu_bacteria 2889914905 2889915443 309
248 iso_pu_bacteria 3003665799 3003670498 309
249 iso_pu_bacteria 8054563764 8054564219 309
250 3300006051 Ga0075364_10016107 Ga0075364_100161072 310
251 3300050491 nmdc:mga00v17_3430_c2 nmdc:mga00v17_3430_c2_1589_2524 310
252 iso_pu_bacteria 2643221736 2644742923 310
253 iso_pu_bacteria 2818991467 2819722000 310
254 iso_pu_bacteria 2841760612 2841765714 310
255 iso_pu_bacteria 2844104063 2844107324 310
256 iso_pu_bacteria 2851182111 2851187847 310
257 iso_pu_bacteria 2851246043 2851249364 310
258 iso_pu_bacteria 2899259804 2899262571 310
259 iso_pu_bacteria 2917699015 2917702146 310
260 iso_pu_bacteria 8057529695 8057532043 310
261 3300006048 Ga0075363_100136338 Ga0075363_1001363382 312
262 3300031456 Ga0307513_10351347 Ga0307513_103513471 312
263 3300033180 Ga0307510_10000029 Ga0307510_1000002950 312
264 3300039437 Ga0436365_0633965 Ga0436365_0633965_368_1306 312
265 3300041413 Ga0439465_0019229 Ga0439465_0019229_147_1085 312
266 3300046460 Ga0495638_0061310 Ga0495638_0061310_126_1064 312
267 3300046501 Ga0495607_0000004 Ga0495607_0000004_162977_163918 312
268 3300046501 Ga0495607_0001077 Ga0495607_0001077_17941_18879 312
269 3300047443 Ga0495687_013244 Ga0495687_013244_2870_3811 312
270 3300048091 Ga0495626_0135340 Ga0495626_0135340_35_973 312
271 3300048920 Ga0496117_0023650 Ga0496117_0023650_2550_3488 312
272 3300048925 Ga0496122_0016614 Ga0496122_0016614_2518_3456 312
273 3300048926 Ga0496123_0013951 Ga0496123_0013951_3432_4370 312
274 3300053111 Ga0500572_000208 Ga0500572_000208_4263_5201 312
275 3300053153 Ga0500616_0000465 Ga0500616_0000465_24833_25774 312
276 3300053157 Ga0500624_001856 Ga0500624_001856_2036_2977 312
277 3300053163 Ga0500639_008527 Ga0500639_008527_2032_2970 312
278 3300053725 Ga0500576_059255 Ga0500576_059255_187_1125 312
279 3300053735 Ga0500596_000787 Ga0500596_000787_2925_3863 312
280 3300003187 JGI25151J46595_10000584 JGI25151J46595_1000058418 313
281 3300005329 Ga0070683_100017757 Ga0070683_1000177576 313
282 3300005334 Ga0068869_100012055 Ga0068869_1000120553 313
283 3300005338 Ga0068868_100046821 Ga0068868_1000468212 313
284 3300005353 Ga0070669_100109508 Ga0070669_1001095083 313
285 3300005356 Ga0070674_100252457 Ga0070674_1002524572 313
286 3300005366 Ga0070659_100244235 Ga0070659_1002442352 313
287 3300005367 Ga0070667_100263216 Ga0070667_1002632162 313
288 3300005455 Ga0070663_100055572 Ga0070663_1000555722 313
289 3300005456 Ga0070678_100117760 Ga0070678_1001177603 313
290 3300005457 Ga0070662_100031752 Ga0070662_1000317523 313
291 3300005547 Ga0070693_100136818 Ga0070693_1001368182 313
292 3300005548 Ga0070665_100098411 Ga0070665_1000984112 313
293 3300005618 Ga0068864_100071128 Ga0068864_1000711282 313
294 3300005618 Ga0068864_100172195 Ga0068864_1001721952 313
295 3300005618 Ga0068864_100291871 Ga0068864_1002918712 313
296 3300005719 Ga0068861_100001218 Ga0068861_1000012183 313
297 3300005834 Ga0068851_10005894 Ga0068851_100058944 313
298 3300005841 Ga0068863_100069734 Ga0068863_1000697342 313
299 3300005843 Ga0068860_100049817 Ga0068860_1000498172 313
300 3300005843 Ga0068860_100148090 Ga0068860_1001480902 313
301 3300006051 Ga0075364_10046484 Ga0075364_100464842 313
302 3300006237 Ga0097621_100013308 Ga0097621_1000133083 313
303 3300006358 Ga0068871_100038836 Ga0068871_1000388362 313
304 3300006358 Ga0068871_100173557 Ga0068871_1001735572 313
305 3300006844 Ga0075428_100454247 Ga0075428_1004542472 313
306 3300006846 Ga0075430_100191608 Ga0075430_1001916082 313
307 3300006881 Ga0068865_100320394 Ga0068865_1003203942 313
308 3300009098 Ga0105245_10036246 Ga0105245_100362462 313
309 3300009174 Ga0105241_10244627 Ga0105241_102446272 313
310 3300009177 Ga0105248_10039921 Ga0105248_100399213 313
311 3300009177 Ga0105248_10103885 Ga0105248_101038852 313
312 3300009177 Ga0105248_10254838 Ga0105248_102548382 313
313 3300009551 Ga0105238_10003580 Ga0105238_100035802 313
314 3300009553 Ga0105249_10173746 Ga0105249_101737462 313
315 3300013100 Ga0157373_10016191 Ga0157373_100161911 313
316 3300013102 Ga0157371_10097350 Ga0157371_100973502 313
317 3300013105 Ga0157369_10541523 Ga0157369_105415232 313
318 3300013105 Ga0157369_10668809 Ga0157369_106688091 313
319 3300013296 Ga0157374_10132894 Ga0157374_101328942 313
320 3300013296 Ga0157374_10668795 Ga0157374_106687951 313
321 3300013306 Ga0163162_10268801 Ga0163162_102688012 313
322 3300013307 Ga0157372_10055170 Ga0157372_100551702 313
323 3300013307 Ga0157372_10128364 Ga0157372_101283643 313
324 3300013307 Ga0157372_10800527 Ga0157372_108005272 313
325 3300013308 Ga0157375_10044109 Ga0157375_100441092 313
326 3300013308 Ga0157375_10183950 Ga0157375_101839503 313
327 3300014325 Ga0163163_10053558 Ga0163163_100535583 313
328 3300014968 Ga0157379_10009378 Ga0157379_100093788 313
329 3300014969 Ga0157376_10000947 Ga0157376_1000094717 313
330 3300025294 Ga0209025_1000018 Ga0209025_1000018123 313
331 3300025321 Ga0207656_10029296 Ga0207656_100292963 313
332 3300025321 Ga0207656_10108801 Ga0207656_101088012 313
333 3300025909 Ga0207705_10122375 Ga0207705_101223752 313
334 3300025919 Ga0207657_10078446 Ga0207657_100784463 313
335 3300025923 Ga0207681_10025918 Ga0207681_100259182 313
336 3300025932 Ga0207690_10192898 Ga0207690_101928982 313
337 3300025933 Ga0207706_10000416 Ga0207706_100004162 313
338 3300025936 Ga0207670_10118245 Ga0207670_101182451 313
339 3300025937 Ga0207669_10305474 Ga0207669_103054742 313
340 3300025941 Ga0207711_10023489 Ga0207711_100234892 313
341 3300025941 Ga0207711_10063334 Ga0207711_100633342 313
342 3300025941 Ga0207711_10295616 Ga0207711_102956162 313
343 3300025942 Ga0207689_10000220 Ga0207689_100002204 313
344 3300025949 Ga0207667_10229098 Ga0207667_102290982 313
345 3300025972 Ga0207668_10019485 Ga0207668_100194852 313
346 3300026067 Ga0207678_10106499 Ga0207678_101064992 313
347 3300026078 Ga0207702_10374776 Ga0207702_103747762 313
348 3300026095 Ga0207676_10043554 Ga0207676_100435543 313
349 3300026095 Ga0207676_10131021 Ga0207676_101310212 313
350 3300026118 Ga0207675_100000548 Ga0207675_10000054833 313
351 3300026121 Ga0207683_10434640 Ga0207683_104346402 313
352 3300026142 Ga0207698_10010341 Ga0207698_100103413 313
353 3300028379 Ga0268266_10057615 Ga0268266_100576154 313
354 3300028380 Ga0268265_10164735 Ga0268265_101647352 313
355 3300028381 Ga0268264_10093881 Ga0268264_100938812 313
356 3300031456 Ga0307513_10000458 Ga0307513_1000045822 313
357 3300031731 Ga0307405_10059876 Ga0307405_100598762 313
358 3300031824 Ga0307413_10016872 Ga0307413_100168722 313
359 3300031852 Ga0307410_10083511 Ga0307410_100835112 313
360 3300031911 Ga0307412_10000252 Ga0307412_1000025211 313
361 3300031911 Ga0307412_10005252 Ga0307412_100052526 313
362 3300031995 Ga0307409_100027674 Ga0307409_1000276744 313
363 3300032002 Ga0307416_100125002 Ga0307416_1001250022 313
364 3300032004 Ga0307414_10018629 Ga0307414_100186292 313
365 3300032005 Ga0307411_10019456 Ga0307411_100194564 313
366 3300035091 Ga0373951_0036538 Ga0373951_0036538_220_1161 313
367 3300035691 Ga0373931_0022196 Ga0373931_0022196_294_1235 313
368 3300037471 Ga0395905_0000063 Ga0395905_0000063_162244_163185 313
369 3300039437 Ga0436365_0156089 Ga0436365_0156089_805_1746 313
370 3300039437 Ga0436365_0382394 Ga0436365_0382394_197_1138 313
371 3300039438 Ga0436360_1090220 Ga0436360_1090220_1940_2881 313
372 3300039447 Ga0436361_0106719 Ga0436361_0106719_3411_4352 313
373 3300039450 Ga0436363_1233042 Ga0436363_1233042_10_951 313
374 3300039450 Ga0436363_1499244 Ga0436363_1499244_247_1188 313
375 3300041405 Ga0439438_000303 Ga0439438_000303_11153_12094 313
376 3300041407 Ga0439447_000174 Ga0439447_000174_11612_12553 313
377 3300041407 Ga0439447_004186 Ga0439447_004186_1191_2132 313
378 3300041411 Ga0439466_0000018 Ga0439466_0000018_64944_65885 313
379 3300042010 Ga0439452_002367 Ga0439452_002367_3889_4830 313
380 3300042145 Ga0450906_006910 Ga0450906_006910_771_1712 313
381 3300042146 Ga0450907_004607 Ga0450907_004607_520_1461 313
382 3300042147 Ga0450910_000036 Ga0450910_000036_3687_4628 313
383 3300042184 Ga0450908_000057 Ga0450908_000057_9375_10316 313
384 3300045051 Ga0451576_0071024 Ga0451576_0071024_1645_2586 313
385 3300046454 Ga0495592_0258173 Ga0495592_0258173_94_1035 313
386 3300046455 Ga0495603_0136467 Ga0495603_0136467_165_1106 313
387 3300046463 Ga0495653_0121299 Ga0495653_0121299_898_1839 313
388 3300046511 Ga0495608_0135807 Ga0495608_0135807_73_1014 313
389 3300046512 Ga0495610_0054196 Ga0495610_0054196_917_1858 313
390 3300046519 Ga0495632_0034140 Ga0495632_0034140_707_1648 313
391 3300046535 Ga0495586_0110443 Ga0495586_0110443_479_1420 313
392 3300046543 Ga0495645_0132525 Ga0495645_0132525_64_1005 313
393 3300046681 Ga0495647_0041340 Ga0495647_0041340_154_1095 313
394 3300047319 Ga0495674_0134224 Ga0495674_0134224_73_1014 313
395 3300048904 Ga0496101_0265933 Ga0496101_0265933_165_1106 313
396 3300048905 Ga0496102_0102756 Ga0496102_0102756_18_959 313
397 3300048907 Ga0496104_0124240 Ga0496104_0124240_840_1781 313
398 3300048908 Ga0496105_0271539 Ga0496105_0271539_75_1016 313
399 3300048909 Ga0496106_0033025 Ga0496106_0033025_2340_3281 313
400 3300048910 Ga0496107_0040428 Ga0496107_0040428_1809_2750 313
401 3300048911 Ga0496108_0053473 Ga0496108_0053473_1026_1967 313
402 3300048912 Ga0496109_0075483 Ga0496109_0075483_1002_1943 313
403 3300048913 Ga0496110_0052405 Ga0496110_0052405_1173_2114 313
404 3300048914 Ga0496111_0040641 Ga0496111_0040641_658_1599 313
405 3300048915 Ga0496112_0482367 Ga0496112_0482367_143_1084 313
406 3300048917 Ga0496114_0020035 Ga0496114_0020035_2831_3772 313
407 3300048918 Ga0496115_0107344 Ga0496115_0107344_510_1451 313
408 3300048920 Ga0496117_0029315 Ga0496117_0029315_70_1011 313
409 3300048921 Ga0496118_0029213 Ga0496118_0029213_449_1390 313
410 3300048924 Ga0496121_0016352 Ga0496121_0016352_5999_6940 313
411 3300048928 Ga0496125_0120945 Ga0496125_0120945_49_990 313
412 3300049570 Ga0501033_0016211 Ga0501033_0016211_1002_1943 313
413 3300049571 Ga0501034_0044417 Ga0501034_0044417_1346_2287 313
414 3300049574 Ga0501038_0069390 Ga0501038_0069390_1295_2236 313
415 3300049581 Ga0501047_0002249 Ga0501047_0002249_8918_9859 313
416 3300049583 Ga0501067_0011293 Ga0501067_0011293_1075_2016 313
417 3300049586 Ga0501070_0171349 Ga0501070_0171349_469_1410 313
418 3300049665 Ga0501227_002667 Ga0501227_002667_2049_2990 313
419 3300049822 Ga0501035_0018636 Ga0501035_0018636_1250_2191 313
420 3300049823 Ga0501044_0003322 Ga0501044_0003322_4322_5263 313
421 3300050494 nmdc:mga06z11_2217_c1 nmdc:mga06z11_2217_c1_4769_5710 313
422 3300050494 nmdc:mga06z11_82287_c1 nmdc:mga06z11_82287_c1_222_1163 313
423 3300050513 nmdc:mga0rr50_210801_c1 nmdc:mga0rr50_210801_c1_445_1386 313
424 3300050513 nmdc:mga0rr50_225491_c1 nmdc:mga0rr50_225491_c1_403_1344 313
425 3300053085 Ga0495619_0259618 Ga0495619_0259618_183_1124 313
426 3300055283 Ga0500661_009126 Ga0500661_009126_754_1695 313
427 3300060353 Ga0501082_0040593 Ga0501082_0040593_2200_3141 313
428 3300002987 JGI25159J45721_1012339 JGI25159J45721_10123392 314
429 3300003187 JGI25151J46595_10000441 JGI25151J46595_1000044121 314
430 3300003187 JGI25151J46595_10061271 JGI25151J46595_100612711 314
431 3300003771 Ga0055526_1000027 Ga0055526_100002764 314
432 3300005262 Ga0065165_1000014 Ga0065165_100001460 314
433 3300013250 Ga0171462_1043 Ga0171462_104316 314
434 3300025284 Ga0209130_1000024 Ga0209130_1000024213 314
435 3300025294 Ga0209025_1000017 Ga0209025_1000017696 314
436 3300025294 Ga0209025_1006499 Ga0209025_10064996 314
437 3300025295 Ga0209564_1000180 Ga0209564_100018080 314
438 3300025299 Ga0209256_1018689 Ga0209256_10186892 314
439 3300025302 Ga0207426_1046565 Ga0207426_10465652 314
440 3300048920 Ga0496117_0053063 Ga0496117_0053063_921_1865 314
441 3300048925 Ga0496122_0056743 Ga0496122_0056743_1886_2830 314
442 3300048926 Ga0496123_0110811 Ga0496123_0110811_258_1202 314
443 3300048927 Ga0496124_0245303 Ga0496124_0245303_285_1229 314
444 3300053153 Ga0500616_0023023 Ga0500616_0023023_1971_2915 314
445 3300053177 Ga0500636_0003252 Ga0500636_0003252_1288_2232 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

113

313

0.96

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

102

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8338 91 308
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8131 87 308
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7981 91 308
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7892 88 308
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7822 87 308
ID Description Score Start End Superfamily
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9262 88 308 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9226 87 304 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9186 85 306 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9182 85 306 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.918 88 308 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A5N9DP11-F1-model_v4 ABC transporter permease 0.9482 1 312 GO:0005886
GO:0071916
AF-A0A8A5YY99-F1-model_v4 deleted 0.9452 1 312
AF-A0A5K7YRU6-F1-model_v4 Peptide ABC transporter permease 0.9435 1 311 GO:0005886
GO:0071916
AF-A0A3G1KXG7-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9427 1 314 GO:0005886
GO:0055085
AF-A0A3P3ESG9-F1-model_v4 ABC transporter permease 0.9426 1 311 GO:0005886
GO:0071916

Feature Viewer

pLDDT pTM Quality
84.89 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map