F445367

General Info

Members Datasets Scaffolds Average Seq Length
444 305 416 194

Family's Representative Sequence

Representative Sequence 3300049775|Ga0501279_010973|Ga0501279_010973_473_1129
Length 188
Sequence MNAFRTVALQHASRLVNHGPTVLVTSAHGGRRNVMAAAWSMPVEFTPPRIAVVIDKKTFTRELVAASGVFGLCLPGIALAGLAYAVGDKFARHGIVAHPGPVLGMPVMESGCSAWLECRLIPERHTEDAYDTCFGEVVAAAADARIFEDGHWNFRDDNAALQSIHHLGAGLFVRAGGTVRAAQIKENP

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
8 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
9 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
10 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
11 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
12 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
13 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
14 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
15 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
16 2842733646 Variovorax sp. R-72446 Isolate Unclassified
17 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
18 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
19 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
20 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
21 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
22 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
23 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
24 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
27 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
28 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
31 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
32 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
33 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
34 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
40 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
41 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
42 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
43 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
44 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
47 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
48 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
49 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
50 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
51 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
52 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
53 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
54 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
55 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
124 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
125 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
133 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
135 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
136 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
147 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
213 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
214 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
215 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
216 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
287 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
298 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
299 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
300 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.69
Metatranscriptomes 0
Isolates 6.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.3
Nodule 1.35
Rhizoplane 6.31
Rhizosphere 56.98
Stem 0
Stem Tuber 0
Unclassified 13.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10058503 3300001990 Bacteria 1162
2 JGI24735J21928_10000397 3300002067 Bacteria 15159
3 JGI25155J39150_1000036 3300002704 Bacteria 97790
4 JGI25156J39149_1000047 3300002705 Bacteria 97697
5 JGI25154J39366_1000068 3300002738 Bacteria 97697
6 JGI25157J39369_1000066 3300002741 Bacteria 97697
7 JGI25159J45721_1000180 3300002987 Bacteria 29383
8 JGI25159J45721_1003797 3300002987 Bacteria 5204
9 JGI25151J46595_10002141 3300003187 Bacteria 12298
10 JGI25151J46595_10017890 3300003187 Bacteria 3059
11 JGI25151J46595_10042401 3300003187 Bacteria 1640
12 JGI25153J46596_10052283 3300003215 Bacteria 1164
13 rootH1_10163813 3300003323 Bacteria 8104
14 JGI25160J50197_1000145 3300003354 Bacteria 63479
15 JGI25161J50226_1000064 3300003374 Bacteria 99448
16 Ga0055538_1000013 3300003751 Bacteria 348596
17 Ga0055539_1000018 3300003752 Bacteria 348596
18 Ga0055533_1000022 3300003756 Bacteria 348596
19 Ga0055525_1000024 3300003759 Bacteria 348596
20 Ga0055526_1002264 3300003771 Bacteria 13152
21 Ga0055537_1000043 3300003773 Bacteria 90816
22 Ga0055537_1000046 3300003773 Bacteria 88251
23 Ga0055524_1000012 3300003775 Bacteria 260384
24 Ga0055524_1000045 3300003775 Bacteria 151148
25 Ga0055536_1034885 3300003781 Bacteria 1264
26 Ga0055536_1034938 3300003781 Bacteria 1263
27 Ga0055534_1000886 3300003784 Bacteria 13620
28 Ga0055528_1004896 3300003790 Bacteria 6323
29 Ga0055530_10000015 3300003791 Bacteria 148790
30 Ga0055530_10000960 3300003791 Bacteria 23448
31 Ga0055530_10002836 3300003791 Bacteria 10599
32 Ga0055540_1000039 3300003792 Bacteria 161844
33 Ga0055540_1000149 3300003792 Bacteria 68747
34 Ga0055531_10003504 3300003794 Bacteria 9983
35 Ga0055531_10003564 3300003794 Bacteria 9882
36 Ga0055541_1000013 3300003841 Bacteria 348596
37 Ga0065165_1003471 3300005262 Bacteria 11019
38 Ga0065165_1004102 3300005262 Bacteria 9393
39 Ga0065165_1058507 3300005262 Bacteria 1064
40 Ga0065714_10073033 3300005288 Bacteria 3256
41 Ga0070690_100019734 3300005330 Bacteria 4098
42 Ga0070670_100018204 3300005331 Bacteria 6029
43 Ga0070670_100228216 3300005331 Bacteria 1620
44 Ga0068869_100013548 3300005334 Bacteria 5427
45 Ga0070666_10001894 3300005335 Bacteria 12731
46 Ga0070666_10161701 3300005335 Bacteria 1565
47 Ga0068868_100006969 3300005338 Bacteria 8033
48 Ga0070689_100030657 3300005340 Bacteria 4083
49 Ga0070668_100440479 3300005347 Bacteria 1118
50 Ga0070669_100026113 3300005353 Bacteria 4201
51 Ga0070675_100073929 3300005354 Bacteria 2830
52 Ga0070675_100662397 3300005354 Bacteria 949
53 Ga0070671_100011195 3300005355 Bacteria 7205
54 Ga0070674_100012000 3300005356 Bacteria 5305
55 Ga0070673_100005983 3300005364 Bacteria 7869
56 Ga0070673_100446538 3300005364 Bacteria 1163
57 Ga0070667_100004442 3300005367 Bacteria 11825
58 Ga0070667_100006860 3300005367 Bacteria 9460
59 Ga0070667_100030695 3300005367 Bacteria 4482
60 Ga0070700_100140797 3300005441 Bacteria 1639
61 Ga0070663_100143161 3300005455 Bacteria 1827
62 Ga0070678_100018456 3300005456 Bacteria 4521
63 Ga0070662_100012439 3300005457 Bacteria 5645
64 Ga0070662_100934577 3300005457 Bacteria 741
65 Ga0068867_100036511 3300005459 Bacteria 3568
66 Ga0068867_100086323 3300005459 Bacteria 2374
67 Ga0070685_10079074 3300005466 Bacteria 1967
68 Ga0068853_100587349 3300005539 Bacteria 1057
69 Ga0070672_100268579 3300005543 Bacteria 1440
70 Ga0070672_100650078 3300005543 Bacteria 921
71 Ga0070665_100058779 3300005548 Bacteria 3854
72 Ga0070665_100177031 3300005548 Bacteria 2134
73 Ga0070665_100983628 3300005548 Bacteria 856
74 Ga0068855_100054282 3300005563 Bacteria 4710
75 Ga0068854_100004534 3300005578 Bacteria 8761
76 Ga0068852_100672673 3300005616 Bacteria 1044
77 Ga0068852_101273361 3300005616 Bacteria 757
78 Ga0068859_100001578 3300005617 Bacteria 23231
79 Ga0068864_100031299 3300005618 Bacteria 4514
80 Ga0068851_10065823 3300005834 Bacteria 1866
81 Ga0068870_10082748 3300005840 Bacteria 1778
82 Ga0068863_100007440 3300005841 Bacteria 10716
83 Ga0068863_100762198 3300005841 Bacteria 964
84 Ga0068858_100002011 3300005842 Bacteria 20790
85 Ga0068860_100527012 3300005843 Bacteria 1182
86 Ga0068862_100163656 3300005844 Bacteria 1987
87 Ga0075432_10015578 3300006058 Bacteria 2593
88 Ga0075362_10040724 3300006177 Bacteria 2046
89 Ga0075366_10005472 3300006195 Bacteria 6881
90 Ga0075366_10089046 3300006195 Bacteria 1848
91 Ga0075366_10234680 3300006195 Bacteria 1118
92 Ga0075366_10277320 3300006195 Bacteria 1024
93 Ga0097621_100001636 3300006237 Bacteria 15349
94 Ga0097621_100545741 3300006237 Bacteria 1055
95 Ga0075370_10008487 3300006353 Bacteria 5289
96 Ga0075370_10035258 3300006353 Bacteria 2808
97 Ga0075370_10506262 3300006353 Bacteria 729
98 Ga0068871_100018697 3300006358 Bacteria 5276
99 Ga0068871_100268585 3300006358 Bacteria 1490
100 Ga0068865_100286529 3300006881 Bacteria 1313
101 Ga0097620_100001578 3300006931 Bacteria 23231
102 Ga0079104_1000301 3300006946 Bacteria 62512
103 Ga0079104_1028005 3300006946 Bacteria 1437
104 Ga0105251_10000441 3300009011 Bacteria 40238
105 Ga0105240_10115721 3300009093 Bacteria 3236
106 Ga0105245_10189215 3300009098 Bacteria 1971
107 Ga0105245_10349759 3300009098 Bacteria 1464
108 Ga0105245_10620150 3300009098 Bacteria 1110
109 Ga0105247_10274756 3300009101 Bacteria 1160
110 Ga0105243_10266331 3300009148 Bacteria 1537
111 Ga0105243_10399982 3300009148 Bacteria 1276
112 Ga0105242_10141099 3300009176 Bacteria 2091
113 Ga0105242_10328916 3300009176 Bacteria 1404
114 Ga0105248_10145505 3300009177 Bacteria 2674
115 Ga0105237_10015082 3300009545 Bacteria 8053
116 Ga0105237_10065330 3300009545 Bacteria 3635
117 Ga0105238_10000955 3300009551 Bacteria 29651
118 Ga0105238_10332878 3300009551 Bacteria 1505
119 Ga0105249_10030472 3300009553 Bacteria 4877
120 Ga0105239_10026502 3300010375 Bacteria 6379
121 Ga0157369_10031706 3300013105 Bacteria 5817
122 Ga0157369_10481881 3300013105 Bacteria 1284
123 Ga0157374_10099446 3300013296 Bacteria 2786
124 Ga0157374_10244114 3300013296 Bacteria 1766
125 Ga0157378_10042340 3300013297 Bacteria 4042
126 Ga0163162_10006479 3300013306 Bacteria 11334
127 Ga0163162_10013170 3300013306 Bacteria 8077
128 Ga0163162_10053188 3300013306 Bacteria 4069
129 Ga0163162_11876001 3300013306 Bacteria 686
130 Ga0157375_10014503 3300013308 Bacteria 7031
131 Ga0157375_10238690 3300013308 Bacteria 1977
132 Ga0163163_11078209 3300014325 Bacteria 866
133 Ga0157380_10338449 3300014326 Bacteria 1402
134 Ga0182008_10034088 3300014497 Bacteria 2553
135 Ga0182008_10046797 3300014497 Bacteria 2150
136 Ga0157377_10497203 3300014745 Bacteria 851
137 Ga0157379_10244580 3300014968 Bacteria 1628
138 Ga0157376_10653921 3300014969 Bacteria 1052
139 Ga0157376_10965324 3300014969 Bacteria 873
140 Ga0182006_1000551 3300015261 Bacteria 28238
141 Ga0182007_10021936 3300015262 Bacteria 2260
142 Ga0163161_10008518 3300017792 Bacteria 7099
143 Ga0163161_10009074 3300017792 Bacteria 6878
144 Ga0163161_10027227 3300017792 Bacteria 4055
145 Ga0163161_10175820 3300017792 Bacteria 1639
146 Ga0213872_10017937 3300021361 Bacteria 3265
147 Ga0209435_100001 3300025206 Bacteria 1424171
148 Ga0209436_109304 3300025208 Bacteria 1883
149 Ga0209784_100005 3300025224 Bacteria 1040422
150 Ga0209566_100005 3300025225 Bacteria 1040422
151 Ga0209674_100009 3300025226 Bacteria 1040422
152 Ga0209563_100012 3300025230 Bacteria 1040422
153 Ga0207425_1000827 3300025245 Bacteria 15430
154 Ga0207425_1005884 3300025245 Bacteria 3429
155 Ga0209646_1000001 3300025246 Bacteria 3092932
156 Ga0209026_1000003 3300025250 Bacteria 1060571
157 Ga0209677_100006 3300025253 Bacteria 1040422
158 Ga0209759_1000001 3300025256 Bacteria 2799452
159 Ga0209129_1006173 3300025258 Bacteria 3975
160 Ga0209129_1014043 3300025258 Bacteria 1725
161 Ga0209565_1000004 3300025263 Bacteria 983150
162 Ga0209565_1000407 3300025263 Bacteria 35850
163 Ga0209673_1000221 3300025273 Bacteria 112739
164 Ga0209130_1000094 3300025284 Bacteria 145569
165 Ga0209130_1000855 3300025284 Bacteria 25210
166 Ga0209675_1000061 3300025291 Bacteria 181096
167 Ga0209675_1001684 3300025291 Bacteria 12266
168 Ga0209675_1039328 3300025291 Bacteria 1047
169 Ga0209676_1000029 3300025292 Bacteria 520536
170 Ga0209676_1009743 3300025292 Bacteria 4103
171 Ga0209676_1040378 3300025292 Bacteria 1314
172 Ga0209025_1001787 3300025294 Bacteria 25530
173 Ga0209025_1003318 3300025294 Bacteria 15473
174 Ga0209025_1006838 3300025294 Bacteria 8707
175 Ga0209564_1000681 3300025295 Bacteria 50123
176 Ga0209758_1008417 3300025297 Bacteria 6686
177 Ga0209758_1021961 3300025297 Bacteria 2949
178 Ga0209050_1000003 3300025298 Bacteria 1609245
179 Ga0209050_1000537 3300025298 Bacteria 62966
180 Ga0209050_1003124 3300025298 Bacteria 12664
181 Ga0209050_1003949 3300025298 Bacteria 10478
182 Ga0209050_1007355 3300025298 Bacteria 6193
183 Ga0209256_1000001 3300025299 Bacteria 2166974
184 Ga0209256_1000143 3300025299 Bacteria 151331
185 Ga0209256_1034815 3300025299 Bacteria 1336
186 Ga0207426_1000025 3300025302 Bacteria 532921
187 Ga0207426_1001566 3300025302 Bacteria 18454
188 Ga0207426_1001936 3300025302 Bacteria 14850
189 Ga0209051_1000003 3300025303 Bacteria 1609245
190 Ga0209051_1000345 3300025303 Bacteria 69229
191 Ga0209257_1000018 3300025304 Bacteria 836016
192 Ga0209257_1000685 3300025304 Bacteria 52685
193 Ga0207656_10051223 3300025321 Bacteria 1785
194 Ga0207713_1004622 3300025735 Bacteria 8893
195 Ga0207680_10001380 3300025903 Bacteria 11477
196 Ga0207680_10417230 3300025903 Bacteria 950
197 Ga0207680_10528435 3300025903 Bacteria 841
198 Ga0207647_10110520 3300025904 Bacteria 1625
199 Ga0207695_10001485 3300025913 Bacteria 39195
200 Ga0207662_10125788 3300025918 Bacteria 1612
201 Ga0207649_10194364 3300025920 Bacteria 1429
202 Ga0207681_10000857 3300025923 Bacteria 19987
203 Ga0207694_10000783 3300025924 Bacteria 28558
204 Ga0207650_10043676 3300025925 Bacteria 3291
205 Ga0207644_10024714 3300025931 Bacteria 4126
206 Ga0207706_10015989 3300025933 Bacteria 6779
207 Ga0207686_10085160 3300025934 Bacteria 2073
208 Ga0207709_10310785 3300025935 Bacteria 1176
209 Ga0207670_10055270 3300025936 Bacteria 2682
210 Ga0207669_10027163 3300025937 Bacteria 3128
211 Ga0207704_10254338 3300025938 Bacteria 1321
212 Ga0207691_10278380 3300025940 Bacteria 1440
213 Ga0207711_10167294 3300025941 Bacteria 1993
214 Ga0207689_10021319 3300025942 Bacteria 5448
215 Ga0207689_10590160 3300025942 Bacteria 934
216 Ga0207667_10044400 3300025949 Bacteria 4710
217 Ga0207651_10187066 3300025960 Bacteria 1648
218 Ga0207651_10391312 3300025960 Bacteria 1180
219 Ga0207651_10703781 3300025960 Bacteria 890
220 Ga0207712_10030412 3300025961 Bacteria 3630
221 Ga0207640_10005241 3300025981 Bacteria 7054
222 Ga0207658_10004476 3300025986 Bacteria 9714
223 Ga0207658_10118594 3300025986 Bacteria 2105
224 Ga0207658_10155107 3300025986 Bacteria 1870
225 Ga0207677_10000727 3300026023 Bacteria 19239
226 Ga0207703_10020058 3300026035 Bacteria 5224
227 Ga0207639_10441273 3300026041 Bacteria 1180
228 Ga0207678_10257741 3300026067 Bacteria 1494
229 Ga0207641_10046661 3300026088 Bacteria 3652
230 Ga0207648_10036577 3300026089 Bacteria 4325
231 Ga0207648_10041762 3300026089 Bacteria 4028
232 Ga0207648_10104439 3300026089 Bacteria 2485
233 Ga0207676_10014820 3300026095 Bacteria 5616
234 Ga0207675_100029131 3300026118 Bacteria 5146
235 Ga0207675_100109097 3300026118 Bacteria 2611
236 Ga0207683_10000909 3300026121 Bacteria 27226
237 Ga0207683_10107295 3300026121 Bacteria 2498
238 Ga0207683_10419594 3300026121 Bacteria 1232
239 Ga0207698_10011507 3300026142 Bacteria 5739
240 Ga0207698_10878857 3300026142 Bacteria 903
241 Ga0209281_1000307 3300027111 Bacteria 87401
242 Ga0209970_1000254 3300027614 Bacteria 8719
243 Ga0268266_10066478 3300028379 Bacteria 3118
244 Ga0268266_10231061 3300028379 Bacteria 1704
245 Ga0268266_10470340 3300028379 Bacteria 1197
246 Ga0268266_10721972 3300028379 Bacteria 961
247 Ga0268264_10607545 3300028381 Bacteria 1078
248 Ga0307517_10066414 3300028786 Bacteria 3319
249 Ga0307517_10096955 3300028786 Bacteria 2358
250 Ga0307515_10040461 3300028794 Bacteria 7369
251 Ga0307515_10092079 3300028794 Bacteria 3778
252 Ga0307513_10050414 3300031456 Bacteria 4500
253 Ga0307509_10191835 3300031507 Bacteria 1893
254 Ga0307408_100000924 3300031548 Bacteria 22892
255 Ga0307408_100425283 3300031548 Bacteria 1146
256 Ga0307508_10173285 3300031616 Bacteria 1761
257 Ga0307516_10010173 3300031730 Bacteria 10382
258 Ga0307516_10172941 3300031730 Bacteria 1899
259 Ga0307405_10073020 3300031731 Bacteria 2213
260 Ga0307405_10241810 3300031731 Bacteria 1337
261 Ga0307405_10289527 3300031731 Bacteria 1237
262 Ga0307405_10621562 3300031731 Bacteria 884
263 Ga0307413_10011939 3300031824 Bacteria 4298
264 Ga0307410_10008358 3300031852 Bacteria 5735
265 Ga0307406_10141190 3300031901 Bacteria 1705
266 Ga0307407_10267054 3300031903 Bacteria 1179
267 Ga0307412_10008681 3300031911 Bacteria 5811
268 Ga0307412_10925720 3300031911 Bacteria 765
269 Ga0307409_100469191 3300031995 Bacteria 1219
270 Ga0307416_100028450 3300032002 Bacteria 4156
271 Ga0307414_10008452 3300032004 Bacteria 5837
272 Ga0307414_10327271 3300032004 Bacteria 1307
273 Ga0307411_10139324 3300032005 Bacteria 1786
274 Ga0373932_0198042 3300035112 Bacteria 713
275 Ga0395905_0011597 3300037471 Bacteria 8514
276 Ga0395905_0511396 3300037471 Bacteria 1101
277 Ga0436361_0007558 3300039447 Bacteria 6341
278 Ga0436361_0527730 3300039447 Bacteria 33218
279 Ga0451791_0972801 3300041451 Bacteria 1232
280 Ga0451793_0954822 3300041452 Bacteria 1382
281 Ga0451807_1654550 3300041486 Bacteria 735
282 Ga0451853_1411835 3300041512 Bacteria 1261
283 Ga0450911_000402 3300042115 Bacteria 14291
284 Ga0450890_018210 3300042127 Bacteria 939
285 Ga0450891_005028 3300042129 Bacteria 1226
286 Ga0450898_005911 3300042134 Bacteria 1865
287 Ga0439444_0037299 3300042437 Bacteria 940
288 Ga0439464_0046887 3300042439 Bacteria 1242
289 Ga0466969_0013851 3300044656 Bacteria 4244
290 Ga0466980_0059249 3300044668 Bacteria 2678
291 Ga0466966_0001064 3300044684 Bacteria 17544
292 Ga0466966_0016926 3300044684 Bacteria 4819
293 Ga0466961_0033736 3300044693 Bacteria 3288
294 Ga0466961_0067855 3300044693 Bacteria 2265
295 Ga0466963_0051381 3300044694 Bacteria 2732
296 Ga0466971_0000733 3300044719 Bacteria 13133
297 Ga0466970_0005023 3300044765 Bacteria 6539
298 Ga0466957_0008973 3300044842 Bacteria 5700
299 Ga0466957_0212576 3300044842 Bacteria 1274
300 Ga0466959_0015142 3300045049 Bacteria 5617
301 Ga0466959_0052706 3300045049 Bacteria 2978
302 Ga0495590_0000720 3300046457 Bacteria 15134
303 Ga0495629_0012922 3300046459 Bacteria 6039
304 Ga0495653_0000611 3300046463 Bacteria 27278
305 Ga0495653_0348237 3300046463 Bacteria 953
306 Ga0495580_0429400 3300046472 Bacteria 888
307 Ga0495664_0156070 3300046477 Bacteria 1384
308 Ga0495584_0039565 3300046491 Bacteria 2382
309 Ga0495596_0058651 3300046500 Bacteria 1501
310 Ga0495606_0112402 3300046507 Bacteria 1641
311 Ga0495606_0403289 3300046507 Bacteria 711
312 Ga0495608_0351614 3300046511 Bacteria 907
313 Ga0495628_0111883 3300046516 Bacteria 2099
314 Ga0495630_0006575 3300046517 Bacteria 8280
315 Ga0495632_0011146 3300046519 Bacteria 5266
316 Ga0495642_0036050 3300046528 Bacteria 1998
317 Ga0495652_0060304 3300046529 Bacteria 3207
318 Ga0495654_0288647 3300046530 Bacteria 673
319 Ga0495665_0000611 3300046531 Bacteria 18178
320 Ga0495587_0382966 3300046536 Bacteria 782
321 Ga0495598_0036350 3300046537 Bacteria 1415
322 Ga0495621_0078432 3300046539 Bacteria 1228
323 Ga0495597_0008841 3300046542 Bacteria 5025
324 Ga0495645_0169508 3300046543 Bacteria 1503
325 Ga0495633_0145402 3300046558 Bacteria 1096
326 Ga0495656_0277590 3300046615 Bacteria 853
327 Ga0495625_0011691 3300046660 Bacteria 7139
328 Ga0495635_0069926 3300046663 Bacteria 2406
329 Ga0495623_0003087 3300046679 Bacteria 10976
330 Ga0495646_0007551 3300046680 Bacteria 6910
331 Ga0495624_0001310 3300046690 Bacteria 19513
332 Ga0495649_0007574 3300046694 Bacteria 6603
333 Ga0495649_0262071 3300046694 Bacteria 886
334 Ga0495600_0034781 3300046809 Bacteria 3272
335 Ga0495604_0005252 3300047317 Bacteria 10263
336 Ga0495674_0016719 3300047319 Bacteria 6843
337 Ga0495680_0014328 3300047322 Bacteria 6872
338 Ga0495683_0001539 3300047323 Bacteria 14941
339 Ga0495687_000005 3300047443 Bacteria 610401
340 Ga0495687_006618 3300047443 Bacteria 7048
341 Ga0495675_0113030 3300047444 Bacteria 1694
342 Ga0495675_0426935 3300047444 Bacteria 769
343 Ga0495685_033739 3300047447 Bacteria 1759
344 Ga0495593_0000030 3300047673 Bacteria 59166
345 Ga0495593_0292420 3300047673 Bacteria 814
346 Ga0495602_0029124 3300048088 Bacteria 5270
347 Ga0495602_0095177 3300048088 Bacteria 2459
348 Ga0496100_0000423 3300048903 Bacteria 20503
349 Ga0496100_0179300 3300048903 Bacteria 1531
350 Ga0496101_0005062 3300048904 Bacteria 8381
351 Ga0496101_0532613 3300048904 Bacteria 928
352 Ga0496102_0044287 3300048905 Bacteria 4038
353 Ga0496102_0312413 3300048905 Bacteria 1481
354 Ga0496103_0000956 3300048906 Bacteria 20492
355 Ga0496104_0027782 3300048907 Bacteria 5237
356 Ga0496104_0034000 3300048907 Bacteria 4752
357 Ga0496104_0210952 3300048907 Bacteria 1853
358 Ga0496105_0042325 3300048908 Bacteria 3754
359 Ga0496105_0063992 3300048908 Bacteria 3034
360 Ga0496105_0157717 3300048908 Bacteria 1863
361 Ga0496106_0000007 3300048909 Bacteria 248548
362 Ga0496106_0002841 3300048909 Bacteria 12855
363 Ga0496107_0530437 3300048910 Bacteria 873
364 Ga0496108_0153125 3300048911 Bacteria 1990
365 Ga0496109_0341574 3300048912 Bacteria 1414
366 Ga0496110_0065678 3300048913 Bacteria 3208
367 Ga0496110_0231575 3300048913 Bacteria 1680
368 Ga0496111_0093677 3300048914 Bacteria 2202
369 Ga0496112_0003805 3300048915 Bacteria 12615
370 Ga0496113_0015766 3300048916 Bacteria 5205
371 Ga0496114_0003424 3300048917 Bacteria 12179
372 Ga0496114_0161716 3300048917 Bacteria 1947
373 Ga0496116_0002039 3300048919 Bacteria 21658
374 Ga0496117_0169100 3300048920 Bacteria 1271
375 Ga0496117_0176578 3300048920 Bacteria 1233
376 Ga0496117_0212525 3300048920 Bacteria 1083
377 Ga0496118_0003312 3300048921 Bacteria 20428
378 Ga0496118_0023393 3300048921 Bacteria 5368
379 Ga0496119_0171230 3300048922 Bacteria 1147
380 Ga0496121_0002835 3300048924 Bacteria 25594
381 Ga0496121_0009458 3300048924 Bacteria 11199
382 Ga0496121_0010740 3300048924 Bacteria 10265
383 Ga0496121_0112572 3300048924 Bacteria 2073
384 Ga0496122_0000754 3300048925 Bacteria 62842
385 Ga0496122_0097002 3300048925 Bacteria 1985
386 Ga0496123_0000299 3300048926 Bacteria 96749
387 Ga0496124_0000038 3300048927 Bacteria 312485
388 Ga0496124_0014943 3300048927 Bacteria 7474
389 Ga0496124_0024216 3300048927 Bacteria 5525
390 Ga0496124_0206845 3300048927 Bacteria 1488
391 Ga0496125_0004947 3300048928 Bacteria 15076
392 Ga0496125_0010493 3300048928 Bacteria 9368
393 Ga0496125_0012850 3300048928 Bacteria 8273
394 Ga0496125_0108103 3300048928 Bacteria 2024
395 Ga0496126_0000065 3300048929 Bacteria 252549
396 Ga0496126_0062018 3300048929 Bacteria 3356
397 Ga0501279_010973 3300049775 Bacteria 1222
398 nmdc:mga0k408_141942_c1 3300050493 Bacteria 1429
399 nmdc:mga0k408_218262_c1 3300050493 Bacteria 1138
400 nmdc:mga0k408_501518_c1 3300050493 Bacteria 719
401 nmdc:mga0k408_68524_c1 3300050493 Bacteria 2070
402 nmdc:mga0k408_85189_c1 3300050493 Bacteria 1855
403 nmdc:mga07m45_2719_c1 3300050496 Bacteria 8339
404 nmdc:mga07m45_28571_c1 3300050496 Bacteria 3078
405 nmdc:mga07m45_286824_c1 3300050496 Bacteria 957
406 Ga0495612_0324289 3300053078 Bacteria 693
407 Ga0500578_0073303 3300053086 Bacteria 2181
408 Ga0500651_0387474 3300053093 Bacteria 787
409 Ga0500650_0027940 3300053098 Bacteria 2542
410 Ga0500555_036537 3300053103 Bacteria 1377
411 Ga0500607_107903 3300053121 Bacteria 1370
412 Ga0500652_015361 3300053131 Bacteria 2762
413 Ga0500559_0001139 3300053136 Bacteria 16025
414 Ga0500573_0117510 3300053140 Bacteria 1483
415 Ga0500619_143827 3300053154 Bacteria 812
416 Ga0466962_0002353 3300061719 Bacteria 8970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047447 Ga0495685_033739 Ga0495685_033739_11_523 170
2 3300042127 Ga0450890_018210 Ga0450890_018210_20_556 177
3 3300053154 Ga0500619_143827 Ga0500619_143827_269_802 177
4 3300049775 Ga0501279_010973 Ga0501279_010973_473_1129 185
5 iso_pu_bacteria 2842733646 2842737031 187
6 iso_pu_bacteria 2852618963 2852620881 187
7 3300042115 Ga0450911_000402 Ga0450911_000402_1316_1885 188
8 3300042129 Ga0450891_005028 Ga0450891_005028_497_1066 188
9 3300048924 Ga0496121_0009458 Ga0496121_0009458_6538_7104 188
10 3300048928 Ga0496125_0004947 Ga0496125_0004947_249_815 188
11 3300048928 Ga0496125_0108103 Ga0496125_0108103_458_1027 188
12 3300048929 Ga0496126_0062018 Ga0496126_0062018_1420_1989 188
13 iso_pu_bacteria 2857542790 2857544618 188
14 iso_pu_bacteria 2511231002 2511246990 189
15 iso_pu_bacteria 2904439833 2904439980 189
16 iso_pu_bacteria 2904530477 2904531071 189
17 iso_pu_bacteria 2904584206 2904587284 189
18 iso_pu_bacteria 2904589729 2904592681 189
19 iso_pu_bacteria 2904601388 2904604536 189
20 iso_pu_bacteria 2919046199 2919050314 189
21 iso_pu_bacteria 2919079590 2919082358 189
22 3300003775 Ga0055524_1000045 Ga0055524_1000045121 190
23 3300003791 Ga0055530_10000960 Ga0055530_1000096012 190
24 3300003791 Ga0055530_10002836 Ga0055530_1000283612 190
25 3300003792 Ga0055540_1000149 Ga0055540_100014928 190
26 3300003794 Ga0055531_10003564 Ga0055531_100035646 190
27 3300009176 Ga0105242_10141099 Ga0105242_101410993 190
28 3300025298 Ga0209050_1000537 Ga0209050_100053732 190
29 3300025298 Ga0209050_1003949 Ga0209050_10039498 190
30 3300025299 Ga0209256_1000143 Ga0209256_100014329 190
31 3300025303 Ga0209051_1000345 Ga0209051_100034529 190
32 3300025304 Ga0209257_1000685 Ga0209257_100068512 190
33 3300025942 Ga0207689_10590160 Ga0207689_105901602 190
34 3300028786 Ga0307517_10096955 Ga0307517_100969553 190
35 3300037471 Ga0395905_0511396 Ga0395905_0511396_412_984 190
36 3300041486 Ga0451807_1654550 Ga0451807_1654550_143_715 190
37 3300042134 Ga0450898_005911 Ga0450898_005911_974_1546 190
38 3300048917 Ga0496114_0003424 Ga0496114_0003424_4748_5323 190
39 iso_pu_bacteria 2521172590 2521557281 190
40 iso_pu_bacteria 2585428058 2587732319 190
41 3300002987 JGI25159J45721_1003797 JGI25159J45721_10037974 191
42 3300003187 JGI25151J46595_10002141 JGI25151J46595_100021417 191
43 3300003187 JGI25151J46595_10017890 JGI25151J46595_100178903 191
44 3300003751 Ga0055538_1000013 Ga0055538_1000013142 191
45 3300003752 Ga0055539_1000018 Ga0055539_1000018142 191
46 3300003756 Ga0055533_1000022 Ga0055533_1000022142 191
47 3300003759 Ga0055525_1000024 Ga0055525_1000024142 191
48 3300003771 Ga0055526_1002264 Ga0055526_10022647 191
49 3300003773 Ga0055537_1000043 Ga0055537_100004348 191
50 3300003773 Ga0055537_1000046 Ga0055537_100004610 191
51 3300003775 Ga0055524_1000012 Ga0055524_1000012161 191
52 3300003781 Ga0055536_1034885 Ga0055536_10348852 191
53 3300003781 Ga0055536_1034938 Ga0055536_10349381 191
54 3300003784 Ga0055534_1000886 Ga0055534_10008867 191
55 3300003790 Ga0055528_1004896 Ga0055528_10048968 191
56 3300003791 Ga0055530_10000015 Ga0055530_1000001570 191
57 3300003792 Ga0055540_1000039 Ga0055540_100003972 191
58 3300003794 Ga0055531_10003504 Ga0055531_100035041 191
59 3300003841 Ga0055541_1000013 Ga0055541_1000013142 191
60 3300005262 Ga0065165_1058507 Ga0065165_10585071 191
61 3300005288 Ga0065714_10073033 Ga0065714_100730334 191
62 3300005331 Ga0070670_100228216 Ga0070670_1002282162 191
63 3300005335 Ga0070666_10161701 Ga0070666_101617011 191
64 3300005347 Ga0070668_100440479 Ga0070668_1004404792 191
65 3300005353 Ga0070669_100026113 Ga0070669_1000261134 191
66 3300005354 Ga0070675_100662397 Ga0070675_1006623971 191
67 3300005356 Ga0070674_100012000 Ga0070674_1000120005 191
68 3300005364 Ga0070673_100446538 Ga0070673_1004465382 191
69 3300005367 Ga0070667_100004442 Ga0070667_10000444210 191
70 3300005367 Ga0070667_100030695 Ga0070667_1000306956 191
71 3300005441 Ga0070700_100140797 Ga0070700_1001407972 191
72 3300005457 Ga0070662_100934577 Ga0070662_1009345771 191
73 3300005459 Ga0068867_100036511 Ga0068867_1000365113 191
74 3300005539 Ga0068853_100587349 Ga0068853_1005873492 191
75 3300005543 Ga0070672_100650078 Ga0070672_1006500781 191
76 3300005548 Ga0070665_100177031 Ga0070665_1001770313 191
77 3300005563 Ga0068855_100054282 Ga0068855_1000542825 191
78 3300005578 Ga0068854_100004534 Ga0068854_1000045345 191
79 3300005616 Ga0068852_100672673 Ga0068852_1006726731 191
80 3300005616 Ga0068852_101273361 Ga0068852_1012733611 191
81 3300005840 Ga0068870_10082748 Ga0068870_100827483 191
82 3300005841 Ga0068863_100762198 Ga0068863_1007621982 191
83 3300005844 Ga0068862_100163656 Ga0068862_1001636562 191
84 3300006195 Ga0075366_10089046 Ga0075366_100890462 191
85 3300006195 Ga0075366_10277320 Ga0075366_102773202 191
86 3300006237 Ga0097621_100545741 Ga0097621_1005457411 191
87 3300006353 Ga0075370_10035258 Ga0075370_100352582 191
88 3300006358 Ga0068871_100268585 Ga0068871_1002685852 191
89 3300006946 Ga0079104_1000301 Ga0079104_100030114 191
90 3300009093 Ga0105240_10115721 Ga0105240_101157214 191
91 3300009098 Ga0105245_10189215 Ga0105245_101892153 191
92 3300009098 Ga0105245_10349759 Ga0105245_103497592 191
93 3300009098 Ga0105245_10620150 Ga0105245_106201502 191
94 3300009148 Ga0105243_10266331 Ga0105243_102663312 191
95 3300009148 Ga0105243_10399982 Ga0105243_103999822 191
96 3300009176 Ga0105242_10328916 Ga0105242_103289162 191
97 3300009545 Ga0105237_10015082 Ga0105237_100150827 191
98 3300009551 Ga0105238_10000955 Ga0105238_1000095518 191
99 3300009553 Ga0105249_10030472 Ga0105249_100304724 191
100 3300010375 Ga0105239_10026502 Ga0105239_100265023 191
101 3300013105 Ga0157369_10481881 Ga0157369_104818812 191
102 3300013306 Ga0163162_10013170 Ga0163162_100131708 191
103 3300013306 Ga0163162_10053188 Ga0163162_100531885 191
104 3300013306 Ga0163162_11876001 Ga0163162_118760011 191
105 3300013308 Ga0157375_10238690 Ga0157375_102386902 191
106 3300014325 Ga0163163_11078209 Ga0163163_110782092 191
107 3300014497 Ga0182008_10034088 Ga0182008_100340883 191
108 3300014497 Ga0182008_10046797 Ga0182008_100467972 191
109 3300014968 Ga0157379_10244580 Ga0157379_102445802 191
110 3300014969 Ga0157376_10653921 Ga0157376_106539211 191
111 3300014969 Ga0157376_10965324 Ga0157376_109653241 191
112 3300015261 Ga0182006_1000551 Ga0182006_100055115 191
113 3300015262 Ga0182007_10021936 Ga0182007_100219362 191
114 3300017792 Ga0163161_10008518 Ga0163161_1000851811 191
115 3300017792 Ga0163161_10009074 Ga0163161_100090744 191
116 3300017792 Ga0163161_10175820 Ga0163161_101758203 191
117 3300021361 Ga0213872_10017937 Ga0213872_100179372 191
118 3300025224 Ga0209784_100005 Ga0209784_100005582 191
119 3300025225 Ga0209566_100005 Ga0209566_100005582 191
120 3300025226 Ga0209674_100009 Ga0209674_100009582 191
121 3300025230 Ga0209563_100012 Ga0209563_100012582 191
122 3300025245 Ga0207425_1005884 Ga0207425_10058842 191
123 3300025253 Ga0209677_100006 Ga0209677_100006582 191
124 3300025258 Ga0209129_1006173 Ga0209129_10061736 191
125 3300025263 Ga0209565_1000004 Ga0209565_1000004474 191
126 3300025273 Ga0209673_1000221 Ga0209673_1000221105 191
127 3300025284 Ga0209130_1000855 Ga0209130_10008554 191
128 3300025291 Ga0209675_1000061 Ga0209675_100006174 191
129 3300025291 Ga0209675_1039328 Ga0209675_10393281 191
130 3300025292 Ga0209676_1000029 Ga0209676_1000029435 191
131 3300025292 Ga0209676_1009743 Ga0209676_10097433 191
132 3300025292 Ga0209676_1040378 Ga0209676_10403783 191
133 3300025294 Ga0209025_1001787 Ga0209025_100178711 191
134 3300025294 Ga0209025_1003318 Ga0209025_100331816 191
135 3300025295 Ga0209564_1000681 Ga0209564_100068139 191
136 3300025297 Ga0209758_1021961 Ga0209758_10219614 191
137 3300025298 Ga0209050_1000003 Ga0209050_1000003497 191
138 3300025298 Ga0209050_1007355 Ga0209050_10073556 191
139 3300025299 Ga0209256_1000001 Ga0209256_1000001493 191
140 3300025302 Ga0207426_1001566 Ga0207426_10015667 191
141 3300025303 Ga0209051_1000003 Ga0209051_1000003497 191
142 3300025304 Ga0209257_1000018 Ga0209257_1000018497 191
143 3300025903 Ga0207680_10528435 Ga0207680_105284351 191
144 3300025913 Ga0207695_10001485 Ga0207695_1000148526 191
145 3300025918 Ga0207662_10125788 Ga0207662_101257882 191
146 3300025923 Ga0207681_10000857 Ga0207681_1000085716 191
147 3300025924 Ga0207694_10000783 Ga0207694_1000078318 191
148 3300025934 Ga0207686_10085160 Ga0207686_100851602 191
149 3300025935 Ga0207709_10310785 Ga0207709_103107852 191
150 3300025937 Ga0207669_10027163 Ga0207669_100271633 191
151 3300025949 Ga0207667_10044400 Ga0207667_100444005 191
152 3300025960 Ga0207651_10391312 Ga0207651_103913122 191
153 3300025960 Ga0207651_10703781 Ga0207651_107037811 191
154 3300025961 Ga0207712_10030412 Ga0207712_100304121 191
155 3300025981 Ga0207640_10005241 Ga0207640_100052415 191
156 3300025986 Ga0207658_10118594 Ga0207658_101185942 191
157 3300025986 Ga0207658_10155107 Ga0207658_101551073 191
158 3300026041 Ga0207639_10441273 Ga0207639_104412732 191
159 3300026089 Ga0207648_10036577 Ga0207648_100365777 191
160 3300026089 Ga0207648_10041762 Ga0207648_100417623 191
161 3300026118 Ga0207675_100029131 Ga0207675_1000291314 191
162 3300026121 Ga0207683_10107295 Ga0207683_101072953 191
163 3300026121 Ga0207683_10419594 Ga0207683_104195941 191
164 3300026142 Ga0207698_10878857 Ga0207698_108788571 191
165 3300027111 Ga0209281_1000307 Ga0209281_100030714 191
166 3300027614 Ga0209970_1000254 Ga0209970_10002547 191
167 3300028379 Ga0268266_10470340 Ga0268266_104703402 191
168 3300028794 Ga0307515_10040461 Ga0307515_100404612 191
169 3300028794 Ga0307515_10092079 Ga0307515_100920793 191
170 3300031456 Ga0307513_10050414 Ga0307513_100504143 191
171 3300031507 Ga0307509_10191835 Ga0307509_101918354 191
172 3300031548 Ga0307408_100425283 Ga0307408_1004252832 191
173 3300031730 Ga0307516_10172941 Ga0307516_101729412 191
174 3300031731 Ga0307405_10241810 Ga0307405_102418103 191
175 3300031731 Ga0307405_10289527 Ga0307405_102895272 191
176 3300031731 Ga0307405_10621562 Ga0307405_106215622 191
177 3300031901 Ga0307406_10141190 Ga0307406_101411902 191
178 3300031911 Ga0307412_10925720 Ga0307412_109257201 191
179 3300031995 Ga0307409_100469191 Ga0307409_1004691911 191
180 3300032004 Ga0307414_10327271 Ga0307414_103272711 191
181 3300035112 Ga0373932_0198042 Ga0373932_0198042_56_634 191
182 3300039447 Ga0436361_0007558 Ga0436361_0007558_4906_5490 191
183 3300039447 Ga0436361_0527730 Ga0436361_0527730_1095_1679 191
184 3300041452 Ga0451793_0954822 Ga0451793_0954822_115_699 191
185 3300041512 Ga0451853_1411835 Ga0451853_1411835_411_989 191
186 3300044656 Ga0466969_0013851 Ga0466969_0013851_1600_2175 191
187 3300044668 Ga0466980_0059249 Ga0466980_0059249_1509_2084 191
188 3300044684 Ga0466966_0001064 Ga0466966_0001064_3054_3629 191
189 3300044684 Ga0466966_0016926 Ga0466966_0016926_1973_2548 191
190 3300044693 Ga0466961_0033736 Ga0466961_0033736_2073_2648 191
191 3300044693 Ga0466961_0067855 Ga0466961_0067855_481_1056 191
192 3300044694 Ga0466963_0051381 Ga0466963_0051381_422_997 191
193 3300044719 Ga0466971_0000733 Ga0466971_0000733_7169_7744 191
194 3300044765 Ga0466970_0005023 Ga0466970_0005023_5771_6346 191
195 3300044842 Ga0466957_0008973 Ga0466957_0008973_2278_2853 191
196 3300044842 Ga0466957_0212576 Ga0466957_0212576_538_1173 191
197 3300045049 Ga0466959_0015142 Ga0466959_0015142_4201_4776 191
198 3300045049 Ga0466959_0052706 Ga0466959_0052706_1491_2066 191
199 3300046519 Ga0495632_0011146 Ga0495632_0011146_2640_3221 191
200 3300046528 Ga0495642_0036050 Ga0495642_0036050_1168_1743 191
201 3300046530 Ga0495654_0288647 Ga0495654_0288647_20_595 191
202 3300046537 Ga0495598_0036350 Ga0495598_0036350_645_1223 191
203 3300046539 Ga0495621_0078432 Ga0495621_0078432_135_713 191
204 3300046558 Ga0495633_0145402 Ga0495633_0145402_241_819 191
205 3300046615 Ga0495656_0277590 Ga0495656_0277590_104_688 191
206 3300046660 Ga0495625_0011691 Ga0495625_0011691_1875_2456 191
207 3300046694 Ga0495649_0007574 Ga0495649_0007574_5010_5591 191
208 3300047443 Ga0495687_006618 Ga0495687_006618_6281_6862 191
209 3300048903 Ga0496100_0179300 Ga0496100_0179300_111_695 191
210 3300048905 Ga0496102_0044287 Ga0496102_0044287_2717_3301 191
211 3300048905 Ga0496102_0312413 Ga0496102_0312413_103_687 191
212 3300048907 Ga0496104_0027782 Ga0496104_0027782_3574_4158 191
213 3300048908 Ga0496105_0063992 Ga0496105_0063992_282_866 191
214 3300048913 Ga0496110_0065678 Ga0496110_0065678_2299_2883 191
215 3300048917 Ga0496114_0161716 Ga0496114_0161716_608_1192 191
216 3300048920 Ga0496117_0169100 Ga0496117_0169100_501_1076 191
217 3300048924 Ga0496121_0112572 Ga0496121_0112572_316_909 191
218 3300048925 Ga0496122_0000754 Ga0496122_0000754_19136_19711 191
219 3300048926 Ga0496123_0000299 Ga0496123_0000299_53082_53657 191
220 3300048927 Ga0496124_0000038 Ga0496124_0000038_249998_250591 191
221 3300048927 Ga0496124_0024216 Ga0496124_0024216_3902_4477 191
222 3300050493 nmdc:mga0k408_85189_c1 nmdc:mga0k408_85189_c1_985_1563 191
223 3300050496 nmdc:mga07m45_28571_c1 nmdc:mga07m45_28571_c1_471_1049 191
224 3300050496 nmdc:mga07m45_286824_c1 nmdc:mga07m45_286824_c1_196_771 191
225 3300053086 Ga0500578_0073303 Ga0500578_0073303_1342_1923 191
226 3300053093 Ga0500651_0387474 Ga0500651_0387474_98_679 191
227 3300053121 Ga0500607_107903 Ga0500607_107903_521_1099 191
228 3300053131 Ga0500652_015361 Ga0500652_015361_1287_1865 191
229 3300053136 Ga0500559_0001139 Ga0500559_0001139_2173_2748 191
230 3300053140 Ga0500573_0117510 Ga0500573_0117510_339_914 191
231 3300061719 Ga0466962_0002353 Ga0466962_0002353_5091_5666 191
232 iso_pu_bacteria 2501025501 2501072035 191
233 iso_pu_bacteria 2501025502 2501084346 191
234 iso_pu_bacteria 2501025504 2501411844 191
235 iso_pu_bacteria 2510917013 2511088573 191
236 iso_pu_bacteria 2510917014 2511100847 191
237 iso_pu_bacteria 2510917015 2511107394 191
238 iso_pu_bacteria 2513237082 2513553313 191
239 iso_pu_bacteria 2513237083 2513564204 191
240 iso_pu_bacteria 2515154189 2516023451 191
241 iso_pu_bacteria 2808606415 2809131788 191
242 iso_pu_bacteria 2808606419 2809151400 191
243 iso_pu_bacteria 2818991449 2819617722 191
244 iso_pu_bacteria 2883087390 2883094159 191
245 iso_pu_bacteria 8003955200 8003960685 191
246 3300003323 rootH1_10163813 rootH1_101638133 192
247 3300006195 Ga0075366_10005472 Ga0075366_100054723 192
248 3300025299 Ga0209256_1034815 Ga0209256_10348153 192
249 3300026118 Ga0207675_100109097 Ga0207675_1001090973 192
250 3300048909 Ga0496106_0000007 Ga0496106_0000007_116092_116670 192
251 3300048920 Ga0496117_0176578 Ga0496117_0176578_70_648 192
252 3300048921 Ga0496118_0023393 Ga0496118_0023393_950_1528 192
253 3300048924 Ga0496121_0010740 Ga0496121_0010740_459_1037 192
254 3300048927 Ga0496124_0206845 Ga0496124_0206845_605_1183 192
255 3300048929 Ga0496126_0000065 Ga0496126_0000065_74224_74802 192
256 3300050493 nmdc:mga0k408_218262_c1 nmdc:mga0k408_218262_c1_192_782 192
257 3300050493 nmdc:mga0k408_68524_c1 nmdc:mga0k408_68524_c1_441_1124 192
258 3300053103 Ga0500555_036537 Ga0500555_036537_692_1282 192
259 3300001990 JGI24737J22298_10058503 JGI24737J22298_100585031 193
260 3300002067 JGI24735J21928_10000397 JGI24735J21928_100003979 193
261 3300002704 JGI25155J39150_1000036 JGI25155J39150_100003661 193
262 3300002705 JGI25156J39149_1000047 JGI25156J39149_100004727 193
263 3300002738 JGI25154J39366_1000068 JGI25154J39366_100006827 193
264 3300002741 JGI25157J39369_1000066 JGI25157J39369_100006627 193
265 3300002987 JGI25159J45721_1000180 JGI25159J45721_10001806 193
266 3300003187 JGI25151J46595_10042401 JGI25151J46595_100424012 193
267 3300003215 JGI25153J46596_10052283 JGI25153J46596_100522832 193
268 3300003354 JGI25160J50197_1000145 JGI25160J50197_100014530 193
269 3300003374 JGI25161J50226_1000064 JGI25161J50226_100006452 193
270 3300005262 Ga0065165_1003471 Ga0065165_10034718 193
271 3300005262 Ga0065165_1004102 Ga0065165_10041026 193
272 3300005330 Ga0070690_100019734 Ga0070690_1000197344 193
273 3300005331 Ga0070670_100018204 Ga0070670_1000182046 193
274 3300005334 Ga0068869_100013548 Ga0068869_1000135482 193
275 3300005335 Ga0070666_10001894 Ga0070666_100018946 193
276 3300005338 Ga0068868_100006969 Ga0068868_1000069696 193
277 3300005340 Ga0070689_100030657 Ga0070689_1000306573 193
278 3300005354 Ga0070675_100073929 Ga0070675_1000739291 193
279 3300005355 Ga0070671_100011195 Ga0070671_1000111953 193
280 3300005364 Ga0070673_100005983 Ga0070673_1000059833 193
281 3300005367 Ga0070667_100006860 Ga0070667_10000686011 193
282 3300005455 Ga0070663_100143161 Ga0070663_1001431612 193
283 3300005456 Ga0070678_100018456 Ga0070678_1000184561 193
284 3300005457 Ga0070662_100012439 Ga0070662_1000124394 193
285 3300005459 Ga0068867_100086323 Ga0068867_1000863232 193
286 3300005466 Ga0070685_10079074 Ga0070685_100790742 193
287 3300005543 Ga0070672_100268579 Ga0070672_1002685792 193
288 3300005548 Ga0070665_100058779 Ga0070665_1000587792 193
289 3300005548 Ga0070665_100983628 Ga0070665_1009836282 193
290 3300005617 Ga0068859_100001578 Ga0068859_1000015788 193
291 3300005618 Ga0068864_100031299 Ga0068864_1000312996 193
292 3300005834 Ga0068851_10065823 Ga0068851_100658232 193
293 3300005841 Ga0068863_100007440 Ga0068863_1000074409 193
294 3300005842 Ga0068858_100002011 Ga0068858_1000020117 193
295 3300005843 Ga0068860_100527012 Ga0068860_1005270122 193
296 3300006058 Ga0075432_10015578 Ga0075432_100155783 193
297 3300006177 Ga0075362_10040724 Ga0075362_100407242 193
298 3300006195 Ga0075366_10234680 Ga0075366_102346802 193
299 3300006237 Ga0097621_100001636 Ga0097621_10000163614 193
300 3300006353 Ga0075370_10008487 Ga0075370_100084871 193
301 3300006353 Ga0075370_10506262 Ga0075370_105062622 193
302 3300006358 Ga0068871_100018697 Ga0068871_1000186977 193
303 3300006881 Ga0068865_100286529 Ga0068865_1002865292 193
304 3300006931 Ga0097620_100001578 Ga0097620_1000015788 193
305 3300006946 Ga0079104_1028005 Ga0079104_10280052 193
306 3300009011 Ga0105251_10000441 Ga0105251_1000044142 193
307 3300009101 Ga0105247_10274756 Ga0105247_102747561 193
308 3300009177 Ga0105248_10145505 Ga0105248_101455051 193
309 3300009545 Ga0105237_10065330 Ga0105237_100653304 193
310 3300009551 Ga0105238_10332878 Ga0105238_103328782 193
311 3300013105 Ga0157369_10031706 Ga0157369_100317062 193
312 3300013296 Ga0157374_10099446 Ga0157374_100994463 193
313 3300013296 Ga0157374_10244114 Ga0157374_102441142 193
314 3300013297 Ga0157378_10042340 Ga0157378_100423405 193
315 3300013306 Ga0163162_10006479 Ga0163162_100064797 193
316 3300013308 Ga0157375_10014503 Ga0157375_100145035 193
317 3300014326 Ga0157380_10338449 Ga0157380_103384492 193
318 3300014745 Ga0157377_10497203 Ga0157377_104972032 193
319 3300017792 Ga0163161_10027227 Ga0163161_100272273 193
320 3300025206 Ga0209435_100001 Ga0209435_100001741 193
321 3300025208 Ga0209436_109304 Ga0209436_1093042 193
322 3300025245 Ga0207425_1000827 Ga0207425_100082718 193
323 3300025246 Ga0209646_1000001 Ga0209646_10000011110 193
324 3300025250 Ga0209026_1000003 Ga0209026_1000003741 193
325 3300025256 Ga0209759_1000001 Ga0209759_1000001741 193
326 3300025258 Ga0209129_1014043 Ga0209129_10140432 193
327 3300025263 Ga0209565_1000407 Ga0209565_100040735 193
328 3300025284 Ga0209130_1000094 Ga0209130_100009491 193
329 3300025291 Ga0209675_1001684 Ga0209675_10016843 193
330 3300025294 Ga0209025_1006838 Ga0209025_10068382 193
331 3300025297 Ga0209758_1008417 Ga0209758_10084174 193
332 3300025298 Ga0209050_1003124 Ga0209050_100312411 193
333 3300025302 Ga0207426_1000025 Ga0207426_1000025468 193
334 3300025302 Ga0207426_1001936 Ga0207426_100193612 193
335 3300025321 Ga0207656_10051223 Ga0207656_100512232 193
336 3300025735 Ga0207713_1004622 Ga0207713_10046222 193
337 3300025903 Ga0207680_10001380 Ga0207680_100013803 193
338 3300025903 Ga0207680_10417230 Ga0207680_104172301 193
339 3300025904 Ga0207647_10110520 Ga0207647_101105202 193
340 3300025920 Ga0207649_10194364 Ga0207649_101943642 193
341 3300025925 Ga0207650_10043676 Ga0207650_100436763 193
342 3300025931 Ga0207644_10024714 Ga0207644_100247142 193
343 3300025933 Ga0207706_10015989 Ga0207706_100159897 193
344 3300025936 Ga0207670_10055270 Ga0207670_100552703 193
345 3300025938 Ga0207704_10254338 Ga0207704_102543382 193
346 3300025940 Ga0207691_10278380 Ga0207691_102783802 193
347 3300025941 Ga0207711_10167294 Ga0207711_101672943 193
348 3300025942 Ga0207689_10021319 Ga0207689_100213192 193
349 3300025960 Ga0207651_10187066 Ga0207651_101870662 193
350 3300025986 Ga0207658_10004476 Ga0207658_1000447613 193
351 3300026023 Ga0207677_10000727 Ga0207677_100007273 193
352 3300026035 Ga0207703_10020058 Ga0207703_100200584 193
353 3300026067 Ga0207678_10257741 Ga0207678_102577412 193
354 3300026088 Ga0207641_10046661 Ga0207641_100466614 193
355 3300026089 Ga0207648_10104439 Ga0207648_101044393 193
356 3300026095 Ga0207676_10014820 Ga0207676_100148203 193
357 3300026121 Ga0207683_10000909 Ga0207683_1000090920 193
358 3300026142 Ga0207698_10011507 Ga0207698_100115073 193
359 3300028379 Ga0268266_10066478 Ga0268266_100664782 193
360 3300028379 Ga0268266_10231061 Ga0268266_102310612 193
361 3300028379 Ga0268266_10721972 Ga0268266_107219722 193
362 3300028381 Ga0268264_10607545 Ga0268264_106075452 193
363 3300028786 Ga0307517_10066414 Ga0307517_100664142 193
364 3300031548 Ga0307408_100000924 Ga0307408_10000092424 193
365 3300031616 Ga0307508_10173285 Ga0307508_101732853 193
366 3300031730 Ga0307516_10010173 Ga0307516_100101735 193
367 3300031731 Ga0307405_10073020 Ga0307405_100730203 193
368 3300031824 Ga0307413_10011939 Ga0307413_100119392 193
369 3300031852 Ga0307410_10008358 Ga0307410_100083584 193
370 3300031903 Ga0307407_10267054 Ga0307407_102670542 193
371 3300031911 Ga0307412_10008681 Ga0307412_100086813 193
372 3300032002 Ga0307416_100028450 Ga0307416_1000284504 193
373 3300032004 Ga0307414_10008452 Ga0307414_100084524 193
374 3300032005 Ga0307411_10139324 Ga0307411_101393242 193
375 3300037471 Ga0395905_0011597 Ga0395905_0011597_7486_8073 193
376 3300041451 Ga0451791_0972801 Ga0451791_0972801_365_955 193
377 3300042437 Ga0439444_0037299 Ga0439444_0037299_278_928 193
378 3300042439 Ga0439464_0046887 Ga0439464_0046887_234_884 193
379 3300046457 Ga0495590_0000720 Ga0495590_0000720_11381_11962 193
380 3300046459 Ga0495629_0012922 Ga0495629_0012922_2915_3496 193
381 3300046463 Ga0495653_0000611 Ga0495653_0000611_6321_6902 193
382 3300046463 Ga0495653_0348237 Ga0495653_0348237_111_692 193
383 3300046472 Ga0495580_0429400 Ga0495580_0429400_113_694 193
384 3300046477 Ga0495664_0156070 Ga0495664_0156070_474_1055 193
385 3300046491 Ga0495584_0039565 Ga0495584_0039565_206_787 193
386 3300046500 Ga0495596_0058651 Ga0495596_0058651_247_828 193
387 3300046507 Ga0495606_0112402 Ga0495606_0112402_247_828 193
388 3300046507 Ga0495606_0403289 Ga0495606_0403289_42_623 193
389 3300046511 Ga0495608_0351614 Ga0495608_0351614_236_817 193
390 3300046516 Ga0495628_0111883 Ga0495628_0111883_1159_1740 193
391 3300046517 Ga0495630_0006575 Ga0495630_0006575_4985_5566 193
392 3300046529 Ga0495652_0060304 Ga0495652_0060304_830_1411 193
393 3300046531 Ga0495665_0000611 Ga0495665_0000611_17456_18037 193
394 3300046536 Ga0495587_0382966 Ga0495587_0382966_63_644 193
395 3300046542 Ga0495597_0008841 Ga0495597_0008841_1226_1807 193
396 3300046543 Ga0495645_0169508 Ga0495645_0169508_328_909 193
397 3300046663 Ga0495635_0069926 Ga0495635_0069926_138_719 193
398 3300046679 Ga0495623_0003087 Ga0495623_0003087_6198_6779 193
399 3300046680 Ga0495646_0007551 Ga0495646_0007551_3013_3594 193
400 3300046690 Ga0495624_0001310 Ga0495624_0001310_5132_5713 193
401 3300046694 Ga0495649_0262071 Ga0495649_0262071_52_633 193
402 3300046809 Ga0495600_0034781 Ga0495600_0034781_910_1491 193
403 3300047317 Ga0495604_0005252 Ga0495604_0005252_7085_7666 193
404 3300047319 Ga0495674_0016719 Ga0495674_0016719_4284_4865 193
405 3300047322 Ga0495680_0014328 Ga0495680_0014328_1459_2040 193
406 3300047323 Ga0495683_0001539 Ga0495683_0001539_12091_12672 193
407 3300047443 Ga0495687_000005 Ga0495687_000005_455129_455710 193
408 3300047444 Ga0495675_0113030 Ga0495675_0113030_58_639 193
409 3300047444 Ga0495675_0426935 Ga0495675_0426935_24_605 193
410 3300047673 Ga0495593_0000030 Ga0495593_0000030_715_1296 193
411 3300047673 Ga0495593_0292420 Ga0495593_0292420_70_651 193
412 3300048088 Ga0495602_0029124 Ga0495602_0029124_4277_4858 193
413 3300048088 Ga0495602_0095177 Ga0495602_0095177_1383_1964 193
414 3300048903 Ga0496100_0000423 Ga0496100_0000423_6105_6686 193
415 3300048904 Ga0496101_0005062 Ga0496101_0005062_1496_2077 193
416 3300048904 Ga0496101_0532613 Ga0496101_0532613_142_723 193
417 3300048906 Ga0496103_0000956 Ga0496103_0000956_3169_3750 193
418 3300048907 Ga0496104_0034000 Ga0496104_0034000_514_1095 193
419 3300048907 Ga0496104_0210952 Ga0496104_0210952_142_723 193
420 3300048908 Ga0496105_0042325 Ga0496105_0042325_1751_2344 193
421 3300048908 Ga0496105_0157717 Ga0496105_0157717_924_1505 193
422 3300048909 Ga0496106_0002841 Ga0496106_0002841_2451_3032 193
423 3300048910 Ga0496107_0530437 Ga0496107_0530437_178_759 193
424 3300048911 Ga0496108_0153125 Ga0496108_0153125_845_1438 193
425 3300048912 Ga0496109_0341574 Ga0496109_0341574_142_723 193
426 3300048913 Ga0496110_0231575 Ga0496110_0231575_293_874 193
427 3300048914 Ga0496111_0093677 Ga0496111_0093677_229_810 193
428 3300048915 Ga0496112_0003805 Ga0496112_0003805_8662_9243 193
429 3300048916 Ga0496113_0015766 Ga0496113_0015766_4364_4945 193
430 3300048919 Ga0496116_0002039 Ga0496116_0002039_12361_12942 193
431 3300048920 Ga0496117_0212525 Ga0496117_0212525_77_658 193
432 3300048921 Ga0496118_0003312 Ga0496118_0003312_19108_19689 193
433 3300048922 Ga0496119_0171230 Ga0496119_0171230_405_986 193
434 3300048924 Ga0496121_0002835 Ga0496121_0002835_2512_3093 193
435 3300048925 Ga0496122_0097002 Ga0496122_0097002_37_618 193
436 3300048927 Ga0496124_0014943 Ga0496124_0014943_2214_2795 193
437 3300048928 Ga0496125_0010493 Ga0496125_0010493_1368_1949 193
438 3300048928 Ga0496125_0012850 Ga0496125_0012850_1768_2370 193
439 3300050493 nmdc:mga0k408_141942_c1 nmdc:mga0k408_141942_c1_475_1059 193
440 3300050493 nmdc:mga0k408_501518_c1 nmdc:mga0k408_501518_c1_26_616 193
441 3300050496 nmdc:mga07m45_2719_c1 nmdc:mga07m45_2719_c1_4075_4659 193
442 3300053078 Ga0495612_0324289 Ga0495612_0324289_33_626 193
443 3300053098 Ga0500650_0027940 Ga0500650_0027940_461_1054 193
444 iso_pu_bacteria 2857357740 2857361312 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

14

158

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.9355 4 189
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.9072 4 189
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.8897 5 187
3zoe-assembly1.cif.gz_A crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8836 19 189
2r6v-assembly1.cif.gz_A crystal structure of fmn-binding protein (np_142786.1) from pyrococcus horikoshii at 1.35 a resolution 0.8677 14 189
ID Description Score Start End Superfamily
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9666 1 188 2.30.110.10
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9616 1 188 2.30.110.10
3hmzA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9214 4 189 2.30.110.10
3hmzA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8931 4 189 2.30.110.10
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8807 5 187 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A3D8K2U8-F1-model_v4 Flavin reductase family protein 0.9885 1 191 GO:0010181
GO:0016646
AF-A0A0B6RK68-F1-model_v4 Putative flavoredoxin 0.9849 1 191 GO:0010181
GO:0016646
AF-A0A6J5CVW3-F1-model_v4 Flavin reductase like domain-containing protein 0.9845 1 192 GO:0010181
GO:0016646
AF-A0A1N6TKR0-F1-model_v4 NADH-FMN oxidoreductase RutF, flavin reductase (DIM6/NTAB) family 0.9845 1 190 GO:0010181
GO:0016646
AF-A0A0S9NQW0-F1-model_v4 Flavin reductase like domain-containing protein 0.9838 5 192 GO:0010181
GO:0016646

Feature Viewer

pLDDT pTM Quality
92.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map