F445352

General Info

Members Datasets Scaffolds Average Seq Length
444 278 346 360

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0000043|Ga0496121_0000043_67649_68869
Length 406
Sequence VLRVANVYNKFNLQNFFYSPFYYLNIGNYRYLCIHKTNSKMSANNLFQPFQLKSLNLKNRIVMAPMTRSFSPNGVPGQDVADYYKRRAEGQVGLILSEGTVIDRPSSSYDPNIPHFYGTQALSGWQKVINEVHTAGGAMGPQIWHQGIMSNHHSGWLPSAPFEGPSGILAPDSHNGKALSEEDIADVIAAFAKAAVDAKRLGFETVELHGAHGYLIDQFFYHVTNQRTDKYNGKTIGERTRFAVEVIKEVRKQVGEDYPLIIRLSQFKPTDYNHKLATTPLEMEAWLTPMADAGIDIFHCSQRRFWEPEFEGDDLNFAGWAKKLTGKATITVGSIGLSGEFMAAFRGESSEPSSLDELLRRYDRGDFDLVAVGRPLLADPDWALKIKDERTSELKGFSKEALATLL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
6 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
7 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
8 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
9 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
10 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
11 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
12 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
13 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
14 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
15 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
16 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
17 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
18 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
19 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
20 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
21 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
22 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
23 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
24 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
25 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
26 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
27 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
28 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
29 2738541283 Pedobacter sp. OK701 Isolate Unclassified
30 2738541284 Pedobacter sp. YR016 Isolate Unclassified
31 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
32 2738541302 Pedobacter sp. CF074 Isolate Unclassified
33 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
34 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
35 2738543023 Pedobacter sp. OK628 Isolate Unclassified
36 2739367651 Pedobacter sp. OK291 Isolate Unclassified
37 2739367656 Pedobacter sp. CF523 Isolate Unclassified
38 2739367663 Pedobacter sp. YR510 Isolate Unclassified
39 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
40 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
41 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
42 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
43 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
44 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
45 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
46 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
47 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
48 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
49 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
50 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
51 2818991437 Pedobacter terrae 518 Isolate Unclassified
52 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
53 2818991444 Filimonas endophytica 3197 Isolate Unclassified
54 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
55 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
56 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
57 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
58 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
59 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
60 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
61 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
62 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
63 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
64 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
65 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
66 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
67 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
68 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
69 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
70 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
71 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
72 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
73 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
74 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
75 2914759650 Rhizosphaericola mali Isolate Rhizosphere
76 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
77 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
78 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
79 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
80 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
81 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
82 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
83 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
84 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
85 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
86 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
87 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
88 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
89 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
90 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
91 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
92 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
93 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
94 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
95 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
96 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
97 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
98 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
99 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
100 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
101 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
102 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
103 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
104 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
105 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
106 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
107 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
108 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
109 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
112 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
113 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
114 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
115 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
121 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
122 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
123 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
135 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
140 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
141 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
146 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
171 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
181 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
182 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
212 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
213 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
253 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
254 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
255 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
256 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
257 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
265 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
269 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
273 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
274 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
275 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
276 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
277 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
278 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.7
Metatranscriptomes 0.23
Isolates 22.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 9.68
Nodule 1.13
Rhizoplane 0.68
Rhizosphere 68.69
Stem 0
Stem Tuber 0
Unclassified 19.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_261465 2162886007 Bacteria 1202
2 SwRhRL2b_contig_475676 2162886007 Bacteria 8397
3 JGI24741J21665_1003685 3300001915 Bacteria 3580
4 JGI25152J39213_1000054 3300002773 Bacteria 76796
5 JGI25150J39212_1000003 3300002774 Bacteria 508651
6 JGI25151J46595_10000002 3300003187 Bacteria 731381
7 JGI25153J46596_10000015 3300003215 Bacteria 289820
8 rootH2_10224681 3300003320 Bacteria 3447
9 rootL2_10012446 3300003322 Bacteria 12409
10 rootL2_10016756 3300003322 Bacteria 4107
11 rootL2_10019069 3300003322 Bacteria 5568
12 rootL2_10032417 3300003322 Bacteria 8795
13 rootL2_10103704 3300003322 Bacteria 4209
14 rootL2_10243909 3300003322 Bacteria 3419
15 rootH1_10086585 3300003323 Bacteria 15734
16 rootH1_10143231 3300003323 Bacteria 3820
17 rootH1_10257874 3300003323 Bacteria 3270
18 Ga0055535_1001254 3300003761 Bacteria 14023
19 Ga0055536_1000006 3300003781 Bacteria 347733
20 Ga0055534_1002866 3300003784 Bacteria 5728
21 Ga0055530_10003777 3300003791 Bacteria 8353
22 Ga0055531_10000006 3300003794 Bacteria 226600
23 Ga0065165_1012900 3300005262 Bacteria 3362
24 Ga0065714_10002298 3300005288 Bacteria 48008
25 Ga0065714_10002621 3300005288 Bacteria 31326
26 Ga0065714_10064492 3300005288 Bacteria 49867
27 Ga0065714_10064685 3300005288 Bacteria 23720
28 Ga0065714_10072480 3300005288 Bacteria 3360
29 Ga0065704_10000205 3300005289 Bacteria 128899
30 Ga0065704_10001103 3300005289 Bacteria 14777
31 Ga0065704_10076384 3300005289 Bacteria 5142
32 Ga0065715_10237125 3300005293 Bacteria 1172
33 Ga0070682_100000122 3300005337 Bacteria 69084
34 Ga0070660_100075281 3300005339 Bacteria 2643
35 Ga0070660_100136013 3300005339 Bacteria 1969
36 Ga0070659_100000731 3300005366 Bacteria 23826
37 Ga0070667_100248989 3300005367 Bacteria 1588
38 Ga0070684_100003839 3300005535 Bacteria 11361
39 Ga0075366_10000306 3300006195 Bacteria 22150
40 Ga0075366_10023758 3300006195 Bacteria 3572
41 Ga0099824_1000974 3300006942 Bacteria 38343
42 Ga0079104_1000179 3300006946 Bacteria 90381
43 Ga0099794_10060832 3300007265 Bacteria 1835
44 Ga0099795_10020169 3300007788 Bacteria 2168
45 Ga0105251_10059655 3300009011 Bacteria 1798
46 Ga0105244_10000004 3300009036 Bacteria 492478
47 Ga0105244_10000010 3300009036 Bacteria 265799
48 Ga0105244_10110845 3300009036 Bacteria 1335
49 Ga0105250_10007168 3300009092 Bacteria 4810
50 Ga0105240_10000006 3300009093 Bacteria 669662
51 Ga0105243_10000201 3300009148 Bacteria 69844
52 Ga0105243_10032815 3300009148 Bacteria 4013
53 Ga0105237_10183086 3300009545 Bacteria 2095
54 Ga0105238_10008705 3300009551 Bacteria 10153
55 Ga0105238_10454317 3300009551 Unclassified 1278
56 Ga0099796_10030563 3300010159 Bacteria 1749
57 Ga0105239_10001618 3300010375 Bacteria 29751
58 Ga0105239_10006819 3300010375 Bacteria 13173
59 Ga0105246_10228061 3300011119 Bacteria 1465
60 Ga0157373_10000002 3300013100 Bacteria 750094
61 Ga0157373_10000019 3300013100 Bacteria 166579
62 Ga0157373_10010113 3300013100 Bacteria 6949
63 Ga0157373_10010731 3300013100 Bacteria 6740
64 Ga0157373_10034038 3300013100 Bacteria 3660
65 Ga0157373_10044563 3300013100 Bacteria 3167
66 Ga0157371_10003762 3300013102 Bacteria 13577
67 Ga0157371_10010487 3300013102 Bacteria 7211
68 Ga0157371_10010623 3300013102 Bacteria 7152
69 Ga0157371_10045464 3300013102 Bacteria 3124
70 Ga0157370_10000136 3300013104 Bacteria 88390
71 Ga0157370_10000464 3300013104 Bacteria 50658
72 Ga0157370_10000724 3300013104 Bacteria 41344
73 Ga0157370_10015837 3300013104 Bacteria 7650
74 Ga0157370_10035737 3300013104 Bacteria 4827
75 Ga0157370_10070480 3300013104 Bacteria 3300
76 Ga0157370_10138974 3300013104 Bacteria 2263
77 Ga0157369_10000047 3300013105 Bacteria 172682
78 Ga0157369_10012719 3300013105 Bacteria 9544
79 Ga0157374_10238576 3300013296 Bacteria 1787
80 Ga0163162_10015433 3300013306 Bacteria 7465
81 Ga0157372_10130216 3300013307 Bacteria 2894
82 Ga0157372_10157628 3300013307 Bacteria 2622
83 Ga0157375_10000150 3300013308 Bacteria 68209
84 Ga0157375_10148106 3300013308 Bacteria 2480
85 Ga0182008_10000015 3300014497 Bacteria 243121
86 Ga0182008_10000069 3300014497 Bacteria 82281
87 Ga0182008_10000132 3300014497 Bacteria 56231
88 Ga0182008_10022977 3300014497 Bacteria 3190
89 Ga0182008_10057212 3300014497 Bacteria 1926
90 Ga0182006_1000016 3300015261 Bacteria 303558
91 Ga0182006_1000179 3300015261 Bacteria 66779
92 Ga0182006_1000182 3300015261 Bacteria 65171
93 Ga0182006_1000239 3300015261 Bacteria 51541
94 Ga0182007_10000005 3300015262 Bacteria 442702
95 Ga0182007_10009142 3300015262 Bacteria 4027
96 Ga0182007_10025650 3300015262 Bacteria 2051
97 Ga0182005_1000120 3300015265 Bacteria 57067
98 Ga0183373_1002 3300015682 Bacteria 990153
99 Ga0163161_10000007 3300017792 Bacteria 301614
100 Ga0163161_10000238 3300017792 Bacteria 50049
101 Ga0163161_10000838 3300017792 Bacteria 23986
102 Ga0163161_10002225 3300017792 Bacteria 13969
103 Ga0163161_10007400 3300017792 Bacteria 7584
104 Ga0163161_10015137 3300017792 Bacteria 5376
105 Ga0163161_10017174 3300017792 Bacteria 5060
106 Ga0163161_10059233 3300017792 Bacteria 2784
107 Ga0209436_100635 3300025208 Bacteria 14956
108 Ga0209258_101495 3300025242 Bacteria 7999
109 Ga0207425_1000003 3300025245 Bacteria 1145342
110 Ga0209148_1000453 3300025254 Bacteria 44659
111 Ga0209129_1000014 3300025258 Bacteria 509018
112 Ga0209675_1000094 3300025291 Bacteria 138083
113 Ga0209676_1000039 3300025292 Bacteria 443158
114 Ga0209025_1000007 3300025294 Bacteria 1145109
115 Ga0209758_1000012 3300025297 Bacteria 949866
116 Ga0209050_1000033 3300025298 Bacteria 442615
117 Ga0209257_1000071 3300025304 Bacteria 335832
118 Ga0209257_1000402 3300025304 Bacteria 84536
119 Ga0207655_1000008 3300025728 Bacteria 734289
120 Ga0207655_1000671 3300025728 Bacteria 40220
121 Ga0207655_1068977 3300025728 Bacteria 1323
122 Ga0207713_1055282 3300025735 Bacteria 1550
123 Ga0207695_10000017 3300025913 Bacteria 769384
124 Ga0207657_10137524 3300025919 Bacteria 1998
125 Ga0207694_10071360 3300025924 Bacteria 2714
126 Ga0207690_10000596 3300025932 Bacteria 23410
127 Ga0207709_10000736 3300025935 Bacteria 26029
128 Ga0207712_10089047 3300025961 Bacteria 2268
129 Ga0207658_10223614 3300025986 Bacteria 1585
130 Ga0209281_1000116 3300027111 Bacteria 209707
131 Ga0209588_1044153 3300027671 Bacteria 1441
132 Ga0265337_1031809 3300028556 Bacteria 1564
133 Ga0265326_10005547 3300028558 Bacteria 3977
134 Ga0265326_10006136 3300028558 Bacteria 3750
135 Ga0265326_10014020 3300028558 Bacteria 2335
136 Ga0265319_1000937 3300028563 Bacteria 18272
137 Ga0265319_1002341 3300028563 Bacteria 10431
138 Ga0265319_1015632 3300028563 Bacteria 2936
139 Ga0265319_1023759 3300028563 Bacteria 2216
140 Ga0265334_10004243 3300028573 Bacteria 6392
141 Ga0265334_10010052 3300028573 Bacteria 3998
142 Ga0265334_10039736 3300028573 Bacteria 1845
143 Ga0265318_10000101 3300028577 Bacteria 79709
144 Ga0265318_10005945 3300028577 Bacteria 5670
145 Ga0265318_10010002 3300028577 Bacteria 4151
146 Ga0265323_10001325 3300028653 Bacteria 12272
147 Ga0265323_10003752 3300028653 Bacteria 6642
148 Ga0265323_10006003 3300028653 Bacteria 5136
149 Ga0265323_10008580 3300028653 Bacteria 4209
150 Ga0265323_10010702 3300028653 Bacteria 3712
151 Ga0265323_10014351 3300028653 Bacteria 3142
152 Ga0265323_10027893 3300028653 Bacteria 2119
153 Ga0265323_10041418 3300028653 Bacteria 1671
154 Ga0265322_10002052 3300028654 Bacteria 6342
155 Ga0265322_10002513 3300028654 Bacteria 5650
156 Ga0265322_10044129 3300028654 Bacteria 1269
157 Ga0307517_10000280 3300028786 Bacteria 87903
158 Ga0307515_10000181 3300028794 Bacteria 154316
159 Ga0307515_10001233 3300028794 Bacteria 58397
160 Ga0307515_10036715 3300028794 Bacteria 7915
161 Ga0265338_10005329 3300028800 Bacteria 16832
162 Ga0265338_10030543 3300028800 Bacteria 5305
163 Ga0265338_10056801 3300028800 Bacteria 3467
164 Ga0265338_10141122 3300028800 Bacteria 1887
165 Ga0265338_10223882 3300028800 Bacteria 1403
166 Ga0265324_10002011 3300029957 Bacteria 10839
167 Ga0265324_10010225 3300029957 Bacteria 3627
168 Ga0316177_1193479 3300030731 Bacteria 3966
169 Ga0316183_1061567 3300030742 Bacteria 42572
170 Ga0265330_10001716 3300031235 Bacteria 12355
171 Ga0265330_10004545 3300031235 Bacteria 7025
172 Ga0265330_10008509 3300031235 Bacteria 4934
173 Ga0265328_10088241 3300031239 Bacteria 1145
174 Ga0265320_10038707 3300031240 Bacteria 2390
175 Ga0265325_10032382 3300031241 Bacteria 2791
176 Ga0265325_10066735 3300031241 Bacteria 1813
177 Ga0265325_10120429 3300031241 Bacteria 1266
178 Ga0265329_10000118 3300031242 Bacteria 37207
179 Ga0265329_10001338 3300031242 Bacteria 11985
180 Ga0265329_10005456 3300031242 Bacteria 5137
181 Ga0265329_10006275 3300031242 Bacteria 4725
182 Ga0265340_10002229 3300031247 Bacteria 11093
183 Ga0265339_10002821 3300031249 Bacteria 12329
184 Ga0265339_10003402 3300031249 Bacteria 11133
185 Ga0265339_10019745 3300031249 Bacteria 3949
186 Ga0265331_10013826 3300031250 Bacteria 4325
187 Ga0265327_10000091 3300031251 Bacteria 196369
188 Ga0265327_10017752 3300031251 Bacteria 4443
189 Ga0265327_10051481 3300031251 Bacteria 2150
190 Ga0265327_10053189 3300031251 Bacteria 2103
191 Ga0265316_10000208 3300031344 Bacteria 68236
192 Ga0265316_10001162 3300031344 Bacteria 28457
193 Ga0265316_10003493 3300031344 Bacteria 15863
194 Ga0265316_10009941 3300031344 Bacteria 8713
195 Ga0265316_10010004 3300031344 Bacteria 8675
196 Ga0265316_10012549 3300031344 Bacteria 7589
197 Ga0265316_10023079 3300031344 Bacteria 5231
198 Ga0265316_10033466 3300031344 Bacteria 4185
199 Ga0265316_10055952 3300031344 Bacteria 3083
200 Ga0265316_10124955 3300031344 Bacteria 1940
201 Ga0307513_10002772 3300031456 Bacteria 24100
202 Ga0307408_100000031 3300031548 Bacteria 214210
203 Ga0307408_100003051 3300031548 Bacteria 11566
204 Ga0265313_10002175 3300031595 Bacteria 17382
205 Ga0265313_10010582 3300031595 Bacteria 5813
206 Ga0265313_10066827 3300031595 Bacteria 1665
207 Ga0265314_10001033 3300031711 Bacteria 32400
208 Ga0265314_10001130 3300031711 Bacteria 30899
209 Ga0265314_10003597 3300031711 Bacteria 14919
210 Ga0265314_10015858 3300031711 Bacteria 5968
211 Ga0265314_10047689 3300031711 Bacteria 3012
212 Ga0265314_10144455 3300031711 Bacteria 1467
213 Ga0265342_10001046 3300031712 Bacteria 27124
214 Ga0265342_10005516 3300031712 Bacteria 9613
215 Ga0265342_10005778 3300031712 Bacteria 9351
216 Ga0265342_10014482 3300031712 Bacteria 5232
217 Ga0265342_10046034 3300031712 Bacteria 2623
218 Ga0307405_10000009 3300031731 Bacteria 259388
219 Ga0307413_10000015 3300031824 Bacteria 48618
220 Ga0307413_10118268 3300031824 Bacteria 1789
221 Ga0307410_10000126 3300031852 Bacteria 27166
222 Ga0307406_10001672 3300031901 Bacteria 12189
223 Ga0307407_10000001 3300031903 Bacteria 570048
224 Ga0307407_10000111 3300031903 Bacteria 26379
225 Ga0307407_10000724 3300031903 Bacteria 10775
226 Ga0307412_10000004 3300031911 Bacteria 544053
227 Ga0307412_10000022 3300031911 Bacteria 241533
228 Ga0307412_10000441 3300031911 Bacteria 25135
229 Ga0307412_10054922 3300031911 Bacteria 2646
230 Ga0307412_10068611 3300031911 Bacteria 2411
231 Ga0307416_100000003 3300032002 Bacteria 509060
232 Ga0307416_100000008 3300032002 Bacteria 401343
233 Ga0307416_100018159 3300032002 Bacteria 4947
234 Ga0307416_100033201 3300032002 Bacteria 3909
235 Ga0307414_10000001 3300032004 Bacteria 1352954
236 Ga0307414_10000004 3300032004 Bacteria 472218
237 Ga0307414_10000477 3300032004 Bacteria 20980
238 Ga0307414_10010961 3300032004 Bacteria 5295
239 Ga0307414_10016123 3300032004 Bacteria 4533
240 Ga0307414_10040915 3300032004 Bacteria 3134
241 Ga0307414_10083718 3300032004 Bacteria 2343
242 Ga0307411_10000013 3300032005 Bacteria 145335
243 Ga0307510_10085911 3300033180 Bacteria 3020
244 Ga0436361_0658394 3300039447 Bacteria 19974
245 Ga0439466_0026252 3300041411 Bacteria 2027
246 Ga0439466_0064515 3300041411 Bacteria 1174
247 Ga0439465_0000033 3300041413 Bacteria 28385
248 Ga0439432_068586 3300042006 Bacteria 1084
249 Ga0439456_025011 3300042013 Bacteria 1268
250 Ga0466972_0020502 3300044658 Bacteria 3303
251 Ga0466960_0093602 3300044901 Bacteria 1536
252 Ga0495627_000002 3300046453 Bacteria 903861
253 Ga0495627_026361 3300046453 Bacteria 1874
254 Ga0495638_0150343 3300046460 Bacteria 1351
255 Ga0495585_0001680 3300046492 Bacteria 16912
256 Ga0495596_0001663 3300046500 Bacteria 12620
257 Ga0495606_0033143 3300046507 Bacteria 3567
258 Ga0495606_0038865 3300046507 Bacteria 3214
259 Ga0495606_0046060 3300046507 Bacteria 2885
260 Ga0495610_0000009 3300046512 Bacteria 554843
261 Ga0495610_0000696 3300046512 Bacteria 32341
262 Ga0495610_0107253 3300046512 Bacteria 1242
263 Ga0495616_0000021 3300046513 Bacteria 160303
264 Ga0495628_0153351 3300046516 Bacteria 1754
265 Ga0495632_0001871 3300046519 Bacteria 16890
266 Ga0495644_0021119 3300046523 Bacteria 2484
267 Ga0495648_0057019 3300046524 Bacteria 2346
268 Ga0495663_0000010 3300046525 Bacteria 161009
269 Ga0495654_0000056 3300046530 Bacteria 140658
270 Ga0495654_0060357 3300046530 Bacteria 1823
271 Ga0495609_0000134 3300046538 Bacteria 79757
272 Ga0495609_0006416 3300046538 Bacteria 6002
273 Ga0495622_0065609 3300046557 Bacteria 1678
274 Ga0495633_0000130 3300046558 Bacteria 100724
275 Ga0495633_0000199 3300046558 Bacteria 76789
276 Ga0495633_0000853 3300046558 Bacteria 26660
277 Ga0495633_0001745 3300046558 Bacteria 16176
278 Ga0495668_0000075 3300046616 Bacteria 163092
279 Ga0495668_0003376 3300046616 Bacteria 12017
280 Ga0495625_0000543 3300046660 Bacteria 55204
281 Ga0495625_0000647 3300046660 Bacteria 50043
282 Ga0495625_0002872 3300046660 Bacteria 18039
283 Ga0495625_0010104 3300046660 Bacteria 7840
284 Ga0495661_0033617 3300046665 Bacteria 3233
285 Ga0495671_0128031 3300046692 Bacteria 1238
286 Ga0495660_0000987 3300046810 Bacteria 20773
287 Ga0495687_000007 3300047443 Bacteria 552679
288 Ga0495686_0000151 3300047472 Bacteria 135048
289 Ga0495686_0001287 3300047472 Bacteria 28292
290 Ga0495686_0132720 3300047472 Bacteria 1475
291 Ga0496103_0063581 3300048906 Bacteria 2299
292 Ga0496113_0046893 3300048916 Bacteria 3210
293 Ga0496115_0006636 3300048918 Bacteria 8490
294 Ga0496116_0000006 3300048919 Bacteria 811937
295 Ga0496116_0000047 3300048919 Bacteria 315121
296 Ga0496117_0000023 3300048920 Bacteria 438585
297 Ga0496118_0000388 3300048921 Bacteria 74358
298 Ga0496118_0059309 3300048921 Bacteria 2851
299 Ga0496119_0000010 3300048922 Bacteria 438534
300 Ga0496121_0000043 3300048924 Bacteria 341882
301 Ga0496122_0000066 3300048925 Bacteria 231473
302 Ga0496122_0000091 3300048925 Bacteria 204567
303 Ga0496122_0002335 3300048925 Bacteria 27368
304 Ga0496122_0002426 3300048925 Bacteria 26509
305 Ga0496122_0002827 3300048925 Bacteria 23787
306 Ga0496122_0015442 3300048925 Bacteria 7300
307 Ga0496123_0000294 3300048926 Bacteria 97574
308 Ga0496123_0010777 3300048926 Bacteria 8022
309 Ga0496123_0018679 3300048926 Bacteria 5498
310 Ga0496124_0004895 3300048927 Bacteria 15407
311 Ga0496124_0022658 3300048927 Bacteria 5751
312 Ga0496125_0000050 3300048928 Bacteria 286703
313 Ga0496125_0000181 3300048928 Bacteria 138133
314 Ga0496125_0009481 3300048928 Bacteria 9993
315 Ga0496126_0001958 3300048929 Bacteria 29180
316 Ga0496126_0008002 3300048929 Bacteria 11478
317 Ga0496126_0010334 3300048929 Bacteria 9796
318 Ga0496126_0390438 3300048929 Bacteria 1131
319 Ga0501334_00472 3300049550 Bacteria 1843
320 Ga0501238_001395 3300049671 Bacteria 2799
321 Ga0501249_000027 3300049679 Bacteria 87387
322 Ga0501241_000006 3300049758 Bacteria 149999
323 Ga0501241_000800 3300049758 Bacteria 6685
324 Ga0501266_000005 3300049763 Bacteria 346750
325 Ga0501269_000276 3300049766 Bacteria 14341
326 Ga0501280_000336 3300049776 Bacteria 11746
327 nmdc:mga0k408_3918_c1 3300050493 Bacteria 7892
328 nmdc:mga0k408_63411_c1 3300050493 Bacteria 2150
329 Ga0495619_0031548 3300053085 Unclassified 3434
330 Ga0500643_037932 3300053087 Bacteria 1431
331 Ga0500644_0001295 3300053088 Bacteria 6797
332 Ga0500651_0000207 3300053093 Bacteria 36951
333 Ga0500641_0000027 3300053096 Bacteria 106908
334 Ga0500608_017745 3300053122 Bacteria 3238
335 Ga0500618_000005 3300053125 Bacteria 253092
336 Ga0500658_0000021 3300053134 Bacteria 133042
337 Ga0500559_0015763 3300053136 Bacteria 3192
338 Ga0500577_0008560 3300053142 Bacteria 2925
339 Ga0500604_0001333 3300053151 Bacteria 6867
340 Ga0500616_0001928 3300053153 Bacteria 18508
341 Ga0500622_0000022 3300053156 Bacteria 267246
342 Ga0500622_0000384 3300053156 Bacteria 42700
343 Ga0500624_000265 3300053157 Bacteria 18286
344 Ga0500627_0012072 3300053158 Bacteria 3221
345 Ga0500634_0089958 3300053161 Bacteria 1561
346 Ga0500636_0054516 3300053177 Bacteria 2344

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042006 Ga0439432_068586 Ga0439432_068586_209_1063 273
2 3300046460 Ga0495638_0150343 Ga0495638_0150343_412_1266 273
3 3300048929 Ga0496126_0390438 Ga0496126_0390438_17_871 273
4 3300046692 Ga0495671_0128031 Ga0495671_0128031_37_1047 290
5 3300046524 Ga0495648_0057019 Ga0495648_0057019_289_1428 304
6 3300053087 Ga0500643_037932 Ga0500643_037932_82_1221 304
7 3300014497 Ga0182008_10022977 Ga0182008_100229773 308
8 3300015262 Ga0182007_10025650 Ga0182007_100256502 308
9 3300025304 Ga0209257_1000402 Ga0209257_10004022 309
10 3300006195 Ga0075366_10023758 Ga0075366_100237582 314
11 3300050493 nmdc:mga0k408_63411_c1 nmdc:mga0k408_63411_c1_237_1319 314
12 iso_pu_bacteria 2775506901 2776260134 315
13 3300015261 Ga0182006_1000179 Ga0182006_100017917 316
14 3300009148 Ga0105243_10000201 Ga0105243_100002015 317
15 3300025935 Ga0207709_10000736 Ga0207709_1000073615 317
16 3300028577 Ga0265318_10000101 Ga0265318_1000010125 317
17 3300028800 Ga0265338_10056801 Ga0265338_100568012 317
18 3300031595 Ga0265313_10002175 Ga0265313_1000217513 317
19 3300031711 Ga0265314_10001033 Ga0265314_1000103331 317
20 3300044658 Ga0466972_0020502 Ga0466972_0020502_2227_3213 317
21 3300053088 Ga0500644_0001295 Ga0500644_0001295_3343_4365 317
22 3300053156 Ga0500622_0000384 Ga0500622_0000384_22908_23933 317
23 iso_pu_bacteria 2919420072 2919421706 317
24 iso_pu_bacteria 2919432681 2919434736 317
25 3300003320 rootH2_10224681 rootH2_102246812 318
26 3300003323 rootH1_10257874 rootH1_102578743 318
27 3300028558 Ga0265326_10014020 Ga0265326_100140202 318
28 3300031456 Ga0307513_10002772 Ga0307513_1000277216 318
29 3300047443 Ga0495687_000007 Ga0495687_000007_70655_71827 318
30 3300001915 JGI24741J21665_1003685 JGI24741J21665_10036853 319
31 3300003322 rootL2_10243909 rootL2_102439093 319
32 3300005289 Ga0065704_10076384 Ga0065704_100763845 319
33 3300005367 Ga0070667_100248989 Ga0070667_1002489892 319
34 3300007265 Ga0099794_10060832 Ga0099794_100608322 319
35 3300007788 Ga0099795_10020169 Ga0099795_100201692 319
36 3300009036 Ga0105244_10000010 Ga0105244_1000001073 319
37 3300009148 Ga0105243_10032815 Ga0105243_100328154 319
38 3300010159 Ga0099796_10030563 Ga0099796_100305632 319
39 3300013296 Ga0157374_10238576 Ga0157374_102385762 319
40 3300025728 Ga0207655_1000671 Ga0207655_100067125 319
41 3300025986 Ga0207658_10223614 Ga0207658_102236142 319
42 3300027671 Ga0209588_1044153 Ga0209588_10441532 319
43 3300031251 Ga0265327_10017752 Ga0265327_100177523 319
44 3300031711 Ga0265314_10144455 Ga0265314_101444551 319
45 3300039447 Ga0436361_0658394 Ga0436361_0658394_18303_19412 319
46 3300044901 Ga0466960_0093602 Ga0466960_0093602_233_1330 319
47 3300046513 Ga0495616_0000021 Ga0495616_0000021_296_1396 319
48 3300046616 Ga0495668_0003376 Ga0495668_0003376_9937_11037 319
49 3300048918 Ga0496115_0006636 Ga0496115_0006636_6166_7227 319
50 3300048925 Ga0496122_0000066 Ga0496122_0000066_66331_67392 319
51 3300053153 Ga0500616_0001928 Ga0500616_0001928_7659_8756 319
52 3300053158 Ga0500627_0012072 Ga0500627_0012072_364_1464 319
53 iso_pu_bacteria 2835312727 2835313819 319
54 2162886007 SwRhRL2b_contig_261465 SwRhRL2b_0099.00002320 320
55 2162886007 SwRhRL2b_contig_475676 SwRhRL2b_0167.00008690 320
56 3300002773 JGI25152J39213_1000054 JGI25152J39213_100005415 320
57 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003227 320
58 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002227 320
59 3300003215 JGI25153J46596_10000015 JGI25153J46596_1000001538 320
60 3300003322 rootL2_10012446 rootL2_100124466 320
61 3300003322 rootL2_10016756 rootL2_100167561 320
62 3300003322 rootL2_10019069 rootL2_100190693 320
63 3300003322 rootL2_10032417 rootL2_1003241710 320
64 3300003322 rootL2_10103704 rootL2_101037042 320
65 3300003323 rootH1_10086585 rootH1_1008658516 320
66 3300003323 rootH1_10143231 rootH1_101432312 320
67 3300003761 Ga0055535_1001254 Ga0055535_10012546 320
68 3300003781 Ga0055536_1000006 Ga0055536_1000006140 320
69 3300003784 Ga0055534_1002866 Ga0055534_10028664 320
70 3300003791 Ga0055530_10003777 Ga0055530_100037779 320
71 3300003794 Ga0055531_10000006 Ga0055531_1000000642 320
72 3300005262 Ga0065165_1012900 Ga0065165_10129003 320
73 3300005288 Ga0065714_10002298 Ga0065714_1000229819 320
74 3300005288 Ga0065714_10002621 Ga0065714_1000262110 320
75 3300005288 Ga0065714_10064492 Ga0065714_100644923 320
76 3300005288 Ga0065714_10064685 Ga0065714_100646854 320
77 3300005288 Ga0065714_10072480 Ga0065714_100724802 320
78 3300005289 Ga0065704_10000205 Ga0065704_100002055 320
79 3300005289 Ga0065704_10001103 Ga0065704_100011032 320
80 3300005293 Ga0065715_10237125 Ga0065715_102371251 320
81 3300005337 Ga0070682_100000122 Ga0070682_1000001227 320
82 3300005339 Ga0070660_100075281 Ga0070660_1000752814 320
83 3300005339 Ga0070660_100136013 Ga0070660_1001360132 320
84 3300005366 Ga0070659_100000731 Ga0070659_1000007314 320
85 3300005535 Ga0070684_100003839 Ga0070684_1000038395 320
86 3300006195 Ga0075366_10000306 Ga0075366_100003069 320
87 3300006942 Ga0099824_1000974 Ga0099824_100097414 320
88 3300006946 Ga0079104_1000179 Ga0079104_100017914 320
89 3300009011 Ga0105251_10059655 Ga0105251_100596552 320
90 3300009036 Ga0105244_10000004 Ga0105244_10000004332 320
91 3300009036 Ga0105244_10110845 Ga0105244_101108451 320
92 3300009092 Ga0105250_10007168 Ga0105250_100071685 320
93 3300009093 Ga0105240_10000006 Ga0105240_10000006426 320
94 3300009545 Ga0105237_10183086 Ga0105237_101830863 320
95 3300009551 Ga0105238_10008705 Ga0105238_100087056 320
96 3300009551 Ga0105238_10454317 Ga0105238_104543171 320
97 3300010375 Ga0105239_10001618 Ga0105239_100016185 320
98 3300010375 Ga0105239_10006819 Ga0105239_100068195 320
99 3300011119 Ga0105246_10228061 Ga0105246_102280611 320
100 3300013100 Ga0157373_10000002 Ga0157373_1000000291 320
101 3300013100 Ga0157373_10000019 Ga0157373_1000001985 320
102 3300013100 Ga0157373_10010113 Ga0157373_100101135 320
103 3300013100 Ga0157373_10010731 Ga0157373_100107312 320
104 3300013100 Ga0157373_10034038 Ga0157373_100340383 320
105 3300013100 Ga0157373_10044563 Ga0157373_100445634 320
106 3300013102 Ga0157371_10003762 Ga0157371_100037628 320
107 3300013102 Ga0157371_10010487 Ga0157371_100104877 320
108 3300013102 Ga0157371_10010623 Ga0157371_100106237 320
109 3300013102 Ga0157371_10045464 Ga0157371_100454642 320
110 3300013104 Ga0157370_10000136 Ga0157370_1000013656 320
111 3300013104 Ga0157370_10000464 Ga0157370_1000046446 320
112 3300013104 Ga0157370_10000724 Ga0157370_1000072424 320
113 3300013104 Ga0157370_10015837 Ga0157370_100158378 320
114 3300013104 Ga0157370_10035737 Ga0157370_100357373 320
115 3300013104 Ga0157370_10070480 Ga0157370_100704805 320
116 3300013104 Ga0157370_10138974 Ga0157370_101389742 320
117 3300013105 Ga0157369_10000047 Ga0157369_10000047108 320
118 3300013105 Ga0157369_10012719 Ga0157369_100127199 320
119 3300013306 Ga0163162_10015433 Ga0163162_100154337 320
120 3300013307 Ga0157372_10130216 Ga0157372_101302161 320
121 3300013307 Ga0157372_10157628 Ga0157372_101576282 320
122 3300013308 Ga0157375_10000150 Ga0157375_1000015041 320
123 3300013308 Ga0157375_10148106 Ga0157375_101481063 320
124 3300014497 Ga0182008_10000015 Ga0182008_1000001564 320
125 3300014497 Ga0182008_10000069 Ga0182008_1000006953 320
126 3300014497 Ga0182008_10000132 Ga0182008_1000013216 320
127 3300014497 Ga0182008_10057212 Ga0182008_100572122 320
128 3300015261 Ga0182006_1000016 Ga0182006_100001691 320
129 3300015261 Ga0182006_1000182 Ga0182006_100018218 320
130 3300015261 Ga0182006_1000239 Ga0182006_10002395 320
131 3300015262 Ga0182007_10000005 Ga0182007_10000005193 320
132 3300015262 Ga0182007_10009142 Ga0182007_100091423 320
133 3300015265 Ga0182005_1000120 Ga0182005_100012047 320
134 3300015682 Ga0183373_1002 Ga0183373_1002780 320
135 3300017792 Ga0163161_10000007 Ga0163161_10000007213 320
136 3300017792 Ga0163161_10000238 Ga0163161_100002383 320
137 3300017792 Ga0163161_10000838 Ga0163161_100008383 320
138 3300017792 Ga0163161_10002225 Ga0163161_100022259 320
139 3300017792 Ga0163161_10007400 Ga0163161_100074007 320
140 3300017792 Ga0163161_10015137 Ga0163161_100151372 320
141 3300017792 Ga0163161_10017174 Ga0163161_100171743 320
142 3300017792 Ga0163161_10059233 Ga0163161_100592332 320
143 3300025208 Ga0209436_100635 Ga0209436_10063513 320
144 3300025242 Ga0209258_101495 Ga0209258_1014956 320
145 3300025245 Ga0207425_1000003 Ga0207425_1000003614 320
146 3300025254 Ga0209148_1000453 Ga0209148_10004533 320
147 3300025258 Ga0209129_1000014 Ga0209129_1000014219 320
148 3300025291 Ga0209675_1000094 Ga0209675_100009486 320
149 3300025292 Ga0209676_1000039 Ga0209676_1000039232 320
150 3300025294 Ga0209025_1000007 Ga0209025_1000007613 320
151 3300025297 Ga0209758_1000012 Ga0209758_1000012614 320
152 3300025298 Ga0209050_1000033 Ga0209050_1000033216 320
153 3300025304 Ga0209257_1000071 Ga0209257_1000071174 320
154 3300025728 Ga0207655_1000008 Ga0207655_1000008256 320
155 3300025728 Ga0207655_1068977 Ga0207655_10689772 320
156 3300025735 Ga0207713_1055282 Ga0207713_10552822 320
157 3300025913 Ga0207695_10000017 Ga0207695_10000017245 320
158 3300025919 Ga0207657_10137524 Ga0207657_101375242 320
159 3300025924 Ga0207694_10071360 Ga0207694_100713602 320
160 3300025932 Ga0207690_10000596 Ga0207690_100005964 320
161 3300025961 Ga0207712_10089047 Ga0207712_100890472 320
162 3300027111 Ga0209281_1000116 Ga0209281_1000116130 320
163 3300028556 Ga0265337_1031809 Ga0265337_10318091 320
164 3300028558 Ga0265326_10005547 Ga0265326_100055472 320
165 3300028558 Ga0265326_10006136 Ga0265326_100061364 320
166 3300028563 Ga0265319_1000937 Ga0265319_100093711 320
167 3300028563 Ga0265319_1002341 Ga0265319_10023414 320
168 3300028563 Ga0265319_1015632 Ga0265319_10156323 320
169 3300028563 Ga0265319_1023759 Ga0265319_10237592 320
170 3300028573 Ga0265334_10004243 Ga0265334_100042435 320
171 3300028573 Ga0265334_10010052 Ga0265334_100100523 320
172 3300028573 Ga0265334_10039736 Ga0265334_100397362 320
173 3300028577 Ga0265318_10005945 Ga0265318_100059452 320
174 3300028577 Ga0265318_10010002 Ga0265318_100100024 320
175 3300028653 Ga0265323_10001325 Ga0265323_100013254 320
176 3300028653 Ga0265323_10003752 Ga0265323_100037523 320
177 3300028653 Ga0265323_10006003 Ga0265323_100060032 320
178 3300028653 Ga0265323_10008580 Ga0265323_100085804 320
179 3300028653 Ga0265323_10010702 Ga0265323_100107023 320
180 3300028653 Ga0265323_10014351 Ga0265323_100143513 320
181 3300028653 Ga0265323_10027893 Ga0265323_100278932 320
182 3300028653 Ga0265323_10041418 Ga0265323_100414182 320
183 3300028654 Ga0265322_10002052 Ga0265322_100020523 320
184 3300028654 Ga0265322_10002513 Ga0265322_100025132 320
185 3300028654 Ga0265322_10044129 Ga0265322_100441291 320
186 3300028786 Ga0307517_10000280 Ga0307517_100002808 320
187 3300028794 Ga0307515_10000181 Ga0307515_1000018199 320
188 3300028794 Ga0307515_10001233 Ga0307515_1000123314 320
189 3300028794 Ga0307515_10036715 Ga0307515_100367158 320
190 3300028800 Ga0265338_10005329 Ga0265338_100053295 320
191 3300028800 Ga0265338_10030543 Ga0265338_100305433 320
192 3300028800 Ga0265338_10141122 Ga0265338_101411222 320
193 3300028800 Ga0265338_10223882 Ga0265338_102238821 320
194 3300029957 Ga0265324_10002011 Ga0265324_100020118 320
195 3300029957 Ga0265324_10010225 Ga0265324_100102252 320
196 3300030731 Ga0316177_1193479 Ga0316177_11934794 320
197 3300030742 Ga0316183_1061567 Ga0316183_106156721 320
198 3300031235 Ga0265330_10001716 Ga0265330_100017168 320
199 3300031235 Ga0265330_10004545 Ga0265330_100045452 320
200 3300031235 Ga0265330_10008509 Ga0265330_100085095 320
201 3300031239 Ga0265328_10088241 Ga0265328_100882411 320
202 3300031240 Ga0265320_10038707 Ga0265320_100387072 320
203 3300031241 Ga0265325_10032382 Ga0265325_100323822 320
204 3300031241 Ga0265325_10066735 Ga0265325_100667352 320
205 3300031241 Ga0265325_10120429 Ga0265325_101204292 320
206 3300031242 Ga0265329_10000118 Ga0265329_100001184 320
207 3300031242 Ga0265329_10001338 Ga0265329_100013385 320
208 3300031242 Ga0265329_10005456 Ga0265329_100054563 320
209 3300031242 Ga0265329_10006275 Ga0265329_100062752 320
210 3300031247 Ga0265340_10002229 Ga0265340_100022292 320
211 3300031249 Ga0265339_10002821 Ga0265339_100028216 320
212 3300031249 Ga0265339_10003402 Ga0265339_100034023 320
213 3300031249 Ga0265339_10019745 Ga0265339_100197455 320
214 3300031250 Ga0265331_10013826 Ga0265331_100138264 320
215 3300031251 Ga0265327_10000091 Ga0265327_10000091117 320
216 3300031251 Ga0265327_10051481 Ga0265327_100514812 320
217 3300031251 Ga0265327_10053189 Ga0265327_100531893 320
218 3300031344 Ga0265316_10000208 Ga0265316_1000020843 320
219 3300031344 Ga0265316_10001162 Ga0265316_1000116228 320
220 3300031344 Ga0265316_10003493 Ga0265316_100034939 320
221 3300031344 Ga0265316_10009941 Ga0265316_100099418 320
222 3300031344 Ga0265316_10010004 Ga0265316_100100042 320
223 3300031344 Ga0265316_10012549 Ga0265316_100125493 320
224 3300031344 Ga0265316_10023079 Ga0265316_100230792 320
225 3300031344 Ga0265316_10033466 Ga0265316_100334664 320
226 3300031344 Ga0265316_10055952 Ga0265316_100559522 320
227 3300031344 Ga0265316_10124955 Ga0265316_101249552 320
228 3300031548 Ga0307408_100000031 Ga0307408_10000003125 320
229 3300031548 Ga0307408_100003051 Ga0307408_1000030514 320
230 3300031595 Ga0265313_10010582 Ga0265313_100105822 320
231 3300031595 Ga0265313_10066827 Ga0265313_100668272 320
232 3300031711 Ga0265314_10001130 Ga0265314_1000113021 320
233 3300031711 Ga0265314_10003597 Ga0265314_1000359713 320
234 3300031711 Ga0265314_10015858 Ga0265314_100158583 320
235 3300031711 Ga0265314_10047689 Ga0265314_100476892 320
236 3300031712 Ga0265342_10001046 Ga0265342_1000104610 320
237 3300031712 Ga0265342_10005516 Ga0265342_100055166 320
238 3300031712 Ga0265342_10005778 Ga0265342_100057786 320
239 3300031712 Ga0265342_10014482 Ga0265342_100144825 320
240 3300031712 Ga0265342_10046034 Ga0265342_100460341 320
241 3300031731 Ga0307405_10000009 Ga0307405_1000000980 320
242 3300031824 Ga0307413_10000015 Ga0307413_1000001523 320
243 3300031824 Ga0307413_10118268 Ga0307413_101182681 320
244 3300031852 Ga0307410_10000126 Ga0307410_1000012616 320
245 3300031901 Ga0307406_10001672 Ga0307406_100016724 320
246 3300031903 Ga0307407_10000001 Ga0307407_10000001256 320
247 3300031903 Ga0307407_10000111 Ga0307407_1000011119 320
248 3300031903 Ga0307407_10000724 Ga0307407_100007246 320
249 3300031911 Ga0307412_10000004 Ga0307412_10000004361 320
250 3300031911 Ga0307412_10000022 Ga0307412_10000022130 320
251 3300031911 Ga0307412_10000441 Ga0307412_100004414 320
252 3300031911 Ga0307412_10054922 Ga0307412_100549223 320
253 3300031911 Ga0307412_10068611 Ga0307412_100686111 320
254 3300032002 Ga0307416_100000003 Ga0307416_100000003436 320
255 3300032002 Ga0307416_100000008 Ga0307416_100000008133 320
256 3300032002 Ga0307416_100018159 Ga0307416_1000181595 320
257 3300032002 Ga0307416_100033201 Ga0307416_1000332015 320
258 3300032004 Ga0307414_10000001 Ga0307414_10000001817 320
259 3300032004 Ga0307414_10000004 Ga0307414_10000004415 320
260 3300032004 Ga0307414_10000477 Ga0307414_1000047716 320
261 3300032004 Ga0307414_10010961 Ga0307414_100109612 320
262 3300032004 Ga0307414_10016123 Ga0307414_100161235 320
263 3300032004 Ga0307414_10040915 Ga0307414_100409153 320
264 3300032004 Ga0307414_10083718 Ga0307414_100837183 320
265 3300032005 Ga0307411_10000013 Ga0307411_1000001324 320
266 3300033180 Ga0307510_10085911 Ga0307510_100859112 320
267 3300041411 Ga0439466_0026252 Ga0439466_0026252_458_1519 320
268 3300041411 Ga0439466_0064515 Ga0439466_0064515_44_1150 320
269 3300041413 Ga0439465_0000033 Ga0439465_0000033_6014_7075 320
270 3300042013 Ga0439456_025011 Ga0439456_025011_72_1172 320
271 3300046453 Ga0495627_000002 Ga0495627_000002_441731_442792 320
272 3300046453 Ga0495627_026361 Ga0495627_026361_750_1850 320
273 3300046492 Ga0495585_0001680 Ga0495585_0001680_11218_12321 320
274 3300046500 Ga0495596_0001663 Ga0495596_0001663_8527_9588 320
275 3300046507 Ga0495606_0033143 Ga0495606_0033143_142_1242 320
276 3300046507 Ga0495606_0038865 Ga0495606_0038865_1069_2175 320
277 3300046507 Ga0495606_0046060 Ga0495606_0046060_1068_2129 320
278 3300046512 Ga0495610_0000009 Ga0495610_0000009_336499_337560 320
279 3300046512 Ga0495610_0000696 Ga0495610_0000696_8699_9799 320
280 3300046512 Ga0495610_0107253 Ga0495610_0107253_112_1152 320
281 3300046516 Ga0495628_0153351 Ga0495628_0153351_426_1529 320
282 3300046519 Ga0495632_0001871 Ga0495632_0001871_15517_16578 320
283 3300046523 Ga0495644_0021119 Ga0495644_0021119_428_1534 320
284 3300046525 Ga0495663_0000010 Ga0495663_0000010_94920_95981 320
285 3300046530 Ga0495654_0000056 Ga0495654_0000056_77709_78770 320
286 3300046530 Ga0495654_0060357 Ga0495654_0060357_664_1767 320
287 3300046538 Ga0495609_0000134 Ga0495609_0000134_17629_18690 320
288 3300046538 Ga0495609_0006416 Ga0495609_0006416_3601_4704 320
289 3300046557 Ga0495622_0065609 Ga0495622_0065609_242_1345 320
290 3300046558 Ga0495633_0000130 Ga0495633_0000130_47744_48805 320
291 3300046558 Ga0495633_0000199 Ga0495633_0000199_74419_75519 320
292 3300046558 Ga0495633_0000853 Ga0495633_0000853_10439_11542 320
293 3300046558 Ga0495633_0001745 Ga0495633_0001745_6670_7731 320
294 3300046616 Ga0495668_0000075 Ga0495668_0000075_123272_124375 320
295 3300046660 Ga0495625_0000543 Ga0495625_0000543_46281_47342 320
296 3300046660 Ga0495625_0000647 Ga0495625_0000647_6311_7414 320
297 3300046660 Ga0495625_0002872 Ga0495625_0002872_6593_7696 320
298 3300046660 Ga0495625_0010104 Ga0495625_0010104_704_1807 320
299 3300046665 Ga0495661_0033617 Ga0495661_0033617_1480_2580 320
300 3300046810 Ga0495660_0000987 Ga0495660_0000987_11143_12249 320
301 3300047472 Ga0495686_0000151 Ga0495686_0000151_43783_44844 320
302 3300047472 Ga0495686_0001287 Ga0495686_0001287_13155_14261 320
303 3300047472 Ga0495686_0132720 Ga0495686_0132720_298_1404 320
304 3300048906 Ga0496103_0063581 Ga0496103_0063581_553_1614 320
305 3300048916 Ga0496113_0046893 Ga0496113_0046893_400_1461 320
306 3300048919 Ga0496116_0000006 Ga0496116_0000006_675997_677058 320
307 3300048919 Ga0496116_0000047 Ga0496116_0000047_209149_210189 320
308 3300048920 Ga0496117_0000023 Ga0496117_0000023_225277_226338 320
309 3300048921 Ga0496118_0000388 Ga0496118_0000388_32005_33066 320
310 3300048921 Ga0496118_0059309 Ga0496118_0059309_826_1932 320
311 3300048922 Ga0496119_0000010 Ga0496119_0000010_212258_213319 320
312 3300048924 Ga0496121_0000043 Ga0496121_0000043_67649_68869 320
313 3300048925 Ga0496122_0000091 Ga0496122_0000091_24087_25148 320
314 3300048925 Ga0496122_0002335 Ga0496122_0002335_18968_20029 320
315 3300048925 Ga0496122_0002426 Ga0496122_0002426_21434_22495 320
316 3300048925 Ga0496122_0002827 Ga0496122_0002827_20500_21600 320
317 3300048925 Ga0496122_0015442 Ga0496122_0015442_3614_4675 320
318 3300048926 Ga0496123_0000294 Ga0496123_0000294_55964_57025 320
319 3300048926 Ga0496123_0010777 Ga0496123_0010777_3721_4821 320
320 3300048926 Ga0496123_0018679 Ga0496123_0018679_1754_2815 320
321 3300048927 Ga0496124_0004895 Ga0496124_0004895_5525_6586 320
322 3300048927 Ga0496124_0022658 Ga0496124_0022658_3857_4963 320
323 3300048928 Ga0496125_0000050 Ga0496125_0000050_109341_110447 320
324 3300048928 Ga0496125_0000181 Ga0496125_0000181_96878_97939 320
325 3300048928 Ga0496125_0009481 Ga0496125_0009481_1499_2560 320
326 3300048929 Ga0496126_0001958 Ga0496126_0001958_13086_14147 320
327 3300048929 Ga0496126_0008002 Ga0496126_0008002_3908_4948 320
328 3300048929 Ga0496126_0010334 Ga0496126_0010334_3016_4116 320
329 3300049550 Ga0501334_00472 Ga0501334_00472_448_1554 320
330 3300049671 Ga0501238_001395 Ga0501238_001395_1386_2492 320
331 3300049679 Ga0501249_000027 Ga0501249_000027_60879_61982 320
332 3300049758 Ga0501241_000006 Ga0501241_000006_67870_68931 320
333 3300049758 Ga0501241_000800 Ga0501241_000800_990_2090 320
334 3300049763 Ga0501266_000005 Ga0501266_000005_76661_77764 320
335 3300049766 Ga0501269_000276 Ga0501269_000276_9053_10114 320
336 3300049776 Ga0501280_000336 Ga0501280_000336_5040_6146 320
337 3300050493 nmdc:mga0k408_3918_c1 nmdc:mga0k408_3918_c1_6313_7416 320
338 3300053085 Ga0495619_0031548 Ga0495619_0031548_333_1454 320
339 3300053093 Ga0500651_0000207 Ga0500651_0000207_1269_2369 320
340 3300053096 Ga0500641_0000027 Ga0500641_0000027_11986_13092 320
341 3300053122 Ga0500608_017745 Ga0500608_017745_1486_2589 320
342 3300053125 Ga0500618_000005 Ga0500618_000005_166527_167630 320
343 3300053134 Ga0500658_0000021 Ga0500658_0000021_79724_80827 320
344 3300053136 Ga0500559_0015763 Ga0500559_0015763_131_1231 320
345 3300053142 Ga0500577_0008560 Ga0500577_0008560_1122_2219 320
346 3300053151 Ga0500604_0001333 Ga0500604_0001333_5720_6784 320
347 3300053156 Ga0500622_0000022 Ga0500622_0000022_259678_260742 320
348 3300053157 Ga0500624_000265 Ga0500624_000265_3747_4850 320
349 3300053161 Ga0500634_0089958 Ga0500634_0089958_76_1179 320
350 3300053177 Ga0500636_0054516 Ga0500636_0054516_215_1315 320
351 iso_pu_bacteria 2511231000 2511234574 320
352 iso_pu_bacteria 2513020052 2513235735 320
353 iso_pu_bacteria 2519899754 2520878865 320
354 iso_pu_bacteria 2582581278 2585144646 320
355 iso_pu_bacteria 2582581281 2585156842 320
356 iso_pu_bacteria 2582581282 2585161075 320
357 iso_pu_bacteria 2582581873 2585424539 320
358 iso_pu_bacteria 2585427687 2586208813 320
359 iso_pu_bacteria 2585428045 2587677888 320
360 iso_pu_bacteria 2585428060 2587747019 320
361 iso_pu_bacteria 2585428061 2587753674 320
362 iso_pu_bacteria 2585428115 2587944295 320
363 iso_pu_bacteria 2585428182 2588209777 320
364 iso_pu_bacteria 2585428183 2588215075 320
365 iso_pu_bacteria 2585428184 2588218267 320
366 iso_pu_bacteria 2585428185 2588222420 320
367 iso_pu_bacteria 2585428187 2588233978 320
368 iso_pu_bacteria 2588253712 2588444750 320
369 iso_pu_bacteria 2588254255 2590604147 320
370 iso_pu_bacteria 2588254257 2590612841 320
371 iso_pu_bacteria 2643221600 2644011418 320
372 iso_pu_bacteria 2643221667 2644369824 320
373 iso_pu_bacteria 2643221716 2644642335 320
374 iso_pu_bacteria 2643221725 2644685213 320
375 iso_pu_bacteria 2728369107 2729199502 320
376 iso_pu_bacteria 2738541273 2738700470 320
377 iso_pu_bacteria 2738541279 2738731990 320
378 iso_pu_bacteria 2738541283 2738757596 320
379 iso_pu_bacteria 2738541284 2738762951 320
380 iso_pu_bacteria 2738541285 2738764555 320
381 iso_pu_bacteria 2738541302 2738854839 320
382 iso_pu_bacteria 2738543007 2739213570 320
383 iso_pu_bacteria 2738543014 2739254219 320
384 iso_pu_bacteria 2738543023 2739304663 320
385 iso_pu_bacteria 2739367651 2739587045 320
386 iso_pu_bacteria 2739367656 2739618231 320
387 iso_pu_bacteria 2739367663 2739646338 320
388 iso_pu_bacteria 2739367857 2740000842 320
389 iso_pu_bacteria 2739367858 2740005658 320
390 iso_pu_bacteria 2739367874 2740057239 320
391 iso_pu_bacteria 2751185877 2753670985 320
392 iso_pu_bacteria 2765235839 2765573530 320
393 iso_pu_bacteria 2772190705 2772604044 320
394 iso_pu_bacteria 2775506739 2775672343 320
395 iso_pu_bacteria 2775506987 2776614559 320
396 iso_pu_bacteria 2802428842 2802654126 320
397 iso_pu_bacteria 2816332188 2816873894 320
398 iso_pu_bacteria 2816332280 2817415845 320
399 iso_pu_bacteria 2818991437 2819547496 320
400 iso_pu_bacteria 2818991442 2819577877 320
401 iso_pu_bacteria 2818991444 2819589239 320
402 iso_pu_bacteria 2821136567 2821139023 320
403 iso_pu_bacteria 2842083920 2842084854 320
404 iso_pu_bacteria 2842722452 2842726521 320
405 iso_pu_bacteria 2842903701 2842904225 320
406 iso_pu_bacteria 2842909656 2842911285 320
407 iso_pu_bacteria 2848858292 2848860639 320
408 iso_pu_bacteria 2849281842 2849286492 320
409 iso_pu_bacteria 2852627209 2852627689 320
410 iso_pu_bacteria 2857613821 2857614581 320
411 iso_pu_bacteria 2857618242 2857619030 320
412 iso_pu_bacteria 2871720351 2871721640 320
413 iso_pu_bacteria 2881247448 2881249064 320
414 iso_pu_bacteria 2881359912 2881360489 320
415 iso_pu_bacteria 2889290771 2889295879 320
416 iso_pu_bacteria 2903895155 2903896202 320
417 iso_pu_bacteria 2904419702 2904419871 320
418 iso_pu_bacteria 2904445276 2904448927 320
419 iso_pu_bacteria 2904467357 2904472457 320
420 iso_pu_bacteria 2904555929 2904556661 320
421 iso_pu_bacteria 2905999023 2906000218 320
422 iso_pu_bacteria 2914759650 2914759682 320
423 iso_pu_bacteria 2919097161 2919099027 320
424 iso_pu_bacteria 2919191525 2919194011 320
425 iso_pu_bacteria 2919399522 2919400011 320
426 iso_pu_bacteria 2919683626 2919686079 320
427 iso_pu_bacteria 2929150217 2929153084 320
428 iso_pu_bacteria 2929239360 2929243770 320
429 iso_pu_bacteria 2945924605 2945928189 320
430 iso_pu_bacteria 2946019816 2946022118 320
431 iso_pu_bacteria 2954016120 2954020035 320
432 iso_pu_bacteria 2958458903 2958460855 320
433 iso_pu_bacteria 2958512119 2958512534 320
434 iso_pu_bacteria 2977243572 2977245544 320
435 iso_pu_bacteria 2977268062 2977269759 320
436 iso_pu_bacteria 2984572630 2984576594 320
437 iso_pu_bacteria 2984606641 2984610050 320
438 iso_pu_bacteria 2993372514 2993372890 320
439 iso_pu_bacteria 2993480792 2993483570 320
440 iso_pu_bacteria 2995392953 2995394315 320
441 iso_pu_bacteria 3000017691 3000018511 320
442 iso_pu_bacteria 8054307821 8054309891 320
443 iso_pu_bacteria 8055419101 8055421526 320
444 iso_pu_bacteria 8055592153 8055594001 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

45

393

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e5h-assembly1.cif.gz_A old yellow enzyme 5 (pcoye5) from pseudomonas chloritidismutans 0.8425 1 319
8e5h-assembly1.cif.gz_A old yellow enzyme 5 (pcoye5) from pseudomonas chloritidismutans 0.8375 1 319
1vyp-assembly1.cif.gz_X structure of pentaerythritol tetranitrate reductase w102f mutant and complexed with picric acid 0.8105 1 316
3p67-assembly1.cif.gz_A t26s mutant of pentaerythritol tetranitrate reductase containing a bound acetate molecule 0.8098 1 316
1vys-assembly1.cif.gz_X structure of pentaerythritol tetranitrate reductase w102y mutant and complexed with picric acid 0.8087 9 316
ID Description Score Start End Superfamily
af_Q4CNI1_1_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8372 1 178 3.20.20.70
5k1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8053 1 320 3.20.20.70
4ot7A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8044 13 316 3.20.20.70
5k1wA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.803 1 320 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8008 1 316 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2N9AJS4-F1-model_v4 NADH:flavin oxidoreductase/NADH oxidase N-terminal domain-containing protein 0.9943 93 172 GO:0005829
GO:0010181
GO:0016491
AF-A0A0X3ANV1-F1-model_v4 NADH:flavin oxidoreductase / NADH oxidase family protein 0.9858 131 245 GO:0009056
GO:0010181
GO:0016491
AF-A0A519Y922-F1-model_v4 12-oxophytodienoate reductase 0.9851 92 320 GO:0009056
GO:0010181
GO:0016491
AF-A0A4R5EDS6-F1-model_v4 12-oxophytodienoate reductase 0.9847 51 213 GO:0009056
GO:0010181
GO:0016491
AF-A0A4Q3SM20-F1-model_v4 deleted 0.9792 51 320

Feature Viewer

pLDDT pTM Quality
86.4 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map