metagRoot

F445287

General Info

Members	Datasets	Scaffolds	Average Seq Length
444	244	429	366

Family's Representative Sequence

Representative Sequence	3300025912\|Ga0207707_10247282\|Ga0207707_102472821
Length	424
Sequence	MSNGLPLKAPKPKLQAPEKHQISSTKTVTGADCDLVLGVSLELGLWSFIDRHSSLDTGAPFCYQTGVRRELLKDISRVVVKLGTGVLTDSRKQPDLAQLEQLVAQIAGQRKAGREVVIVSSGAVGAGMGALGYEKRPAELAELQACAAVGQSRLMSIYEKLFAKHDLHVAQVLLTHDDLEHHERHLNARNTLVTLLRHGVVPIINENDAISFTELKFGDNDRLSALVASLLPADLLLILTTVDGVIENFGKSNPKTISVIEHIDGAIEKMAGGTDSVTAVGGMKSKIEAAKIVVRSGIPLVIGSGKKKSLLARVIDGEDEGTLFVPQLTKLQGRKRWIAFFHYPKGALFVDEGAKQALREKGKSLLPPGIARCEGNFAAEDVVRICDLNGTEFARGIAAFSSSEINARTLQRVEVVHRDNLVIL

Samples

	Sample ID	Description	Type	Environment
1	2643221559	Lysobacter sp. Root559	Isolate	Unclassified
2	2643221573	Lysobacter sp. Root604	Isolate	Unclassified
3	2643221586	Lysobacter sp. Root667	Isolate	Unclassified
4	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
5	2643221695	Lysobacter sp. Root494	Isolate	Unclassified
6	2643221720	Lysobacter sp. Root916	Isolate	Unclassified
7	2738543009	Luteibacter sp. OK325	Isolate	Unclassified
8	2894414249	Luteimonas sp. LNNU 24178	Isolate	Rhizosphere
9	2895498888	Pseudoxanthomonas sp. SGD-10	Isolate	Rhizosphere
10	2895522137	Pseudoxanthomonas sp. SGNA-20	Isolate	Rhizosphere
11	2919404418	Luteibacter sp. 3190	Isolate	Unclassified
12	2919513703	Luteimonas sp. 3794	Isolate	Unclassified
13	2919675420	Luteimonas terrae 4099	Isolate	Unclassified
14	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
15	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
16	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
17	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
18	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
19	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
20	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
21	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
22	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
23	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
24	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
25	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
26	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
27	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
28	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
29	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
30	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
31	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
32	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
33	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
34	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
35	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
36	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
37	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
38	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
39	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
40	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
41	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
42	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
43	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
46	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
47	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
48	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
49	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
50	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
51	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
52	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
53	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
54	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
55	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
56	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
57	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
58	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
59	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
60	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
61	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
62	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
63	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
64	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
66	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
67	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
68	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
69	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
70	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
71	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
72	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
73	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
74	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
75	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
76	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
77	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
78	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
79	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
80	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
81	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
82	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
83	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
84	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
85	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
86	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
87	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
88	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
89	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
90	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
91	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
92	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
93	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
94	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
122	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
123	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
124	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
125	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
126	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
127	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
128	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
129	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
130	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
131	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
132	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
133	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
134	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
135	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
136	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
137	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
138	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
139	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
140	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
141	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
142	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
143	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
144	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
145	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
146	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
147	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
148	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
149	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
150	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
151	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
152	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
153	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
154	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
155	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
156	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
157	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
158	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
159	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
160	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
161	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
162	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
163	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
164	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
167	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
168	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
169	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
170	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
171	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
172	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
173	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
174	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
175	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
176	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
177	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
178	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
179	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
180	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
181	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
182	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
183	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
184	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
185	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
186	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
187	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
188	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
189	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
190	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
191	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
192	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
193	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
194	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
195	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
196	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
197	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
198	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
199	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
200	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
201	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
202	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
203	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
204	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
205	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
206	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
207	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
208	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
209	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
210	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
211	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
212	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
213	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
214	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
215	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
216	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
217	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
218	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
219	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
220	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
221	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
222	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
223	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
224	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
225	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
227	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
228	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
231	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
232	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
233	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
234	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
235	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
236	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
237	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
238	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
239	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
240	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
241	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
242	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
243	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
244	8003014200	Lysobacter changpingensis Cm-3-T8	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.85
Metatranscriptomes	0
Isolates	3.15

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.99
Nodule	0
Rhizoplane	0.45
Rhizosphere	72.97
Stem	0
Stem Tuber	0
Unclassified	10.59

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25151J46595_10000032	3300003187	Bacteria	195408
2	JGI25151J46595_10015363	3300003187	Bacteria	3376
3	rootH2_10018598	3300003320	Bacteria	12285
4	rootH2_10086489	3300003320	Bacteria	2289
5	rootH1_10016988	3300003323	Bacteria	2598
6	rootH1_10094619	3300003323	Bacteria	6320
7	Ga0055526_1001840	3300003771	Bacteria	14675
8	Ga0055537_1000231	3300003773	Bacteria	40770
9	Ga0055524_1004408	3300003775	Bacteria	6494
10	Ga0055536_1001751	3300003781	Bacteria	12804
11	Ga0055536_1002005	3300003781	Bacteria	11676
12	Ga0055536_1003816	3300003781	Bacteria	7937
13	Ga0055536_1005072	3300003781	Bacteria	6534
14	Ga0055536_1015435	3300003781	Bacteria	2614
15	Ga0055534_1000026	3300003784	Bacteria	130908
16	Ga0055530_10002120	3300003791	Bacteria	13190
17	Ga0055530_10002124	3300003791	Bacteria	13177
18	Ga0055530_10002491	3300003791	Bacteria	11791
19	Ga0055531_10004847	3300003794	Bacteria	8028
20	Ga0055531_10005009	3300003794	Bacteria	7856
21	Ga0055531_10008561	3300003794	Bacteria	5370
22	Ga0055531_10008966	3300003794	Bacteria	5179
23	Ga0055531_10010451	3300003794	Bacteria	4609
24	Ga0055531_10011021	3300003794	Bacteria	4417
25	Ga0055531_10011065	3300003794	Bacteria	4403
26	Ga0055531_10011668	3300003794	Bacteria	4210
27	Ga0055531_10012793	3300003794	Bacteria	3915
28	Ga0055531_10014051	3300003794	Bacteria	3638
29	Ga0065165_1002100	3300005262	Bacteria	18232
30	Ga0065704_10070476	3300005289	Bacteria	23424
31	Ga0065704_10070915	3300005289	Bacteria	14696
32	Ga0070683_100182490	3300005329	Unclassified	1992
33	Ga0070690_100001178	3300005330	Bacteria	13454
34	Ga0070670_100029829	3300005331	Bacteria	4697
35	Ga0070666_10000005	3300005335	Bacteria	343092
36	Ga0070666_10058462	3300005335	Unclassified	2607
37	Ga0070660_100098463	3300005339	Bacteria	2315
38	Ga0070689_100000377	3300005340	Bacteria	26255
39	Ga0070689_100315882	3300005340	Unclassified	1303
40	Ga0070688_100022738	3300005365	Bacteria	3679
41	Ga0070667_100016300	3300005367	Bacteria	6147
42	Ga0070714_100080588	3300005435	Bacteria	2833
43	Ga0070711_100001874	3300005439	Bacteria	11750
44	Ga0070700_100159117	3300005441	Unclassified	1553
45	Ga0070708_100116784	3300005445	Bacteria	2457
46	Ga0070662_100116784	3300005457	Bacteria	2040
47	Ga0070681_10081759	3300005458	Bacteria	3186
48	Ga0068867_100152430	3300005459	Bacteria	1817
49	Ga0070685_10116079	3300005466	Bacteria	1656
50	Ga0070707_100060749	3300005468	Bacteria	3625
51	Ga0070699_100119662	3300005518	Bacteria	2315
52	Ga0068853_100073458	3300005539	Bacteria	2982
53	Ga0070686_100034981	3300005544	Bacteria	3100
54	Ga0070686_100093006	3300005544	Bacteria	2021
55	Ga0070686_100100510	3300005544	Bacteria	1953
56	Ga0070686_100104235	3300005544	Bacteria	1921
57	Ga0070686_100153813	3300005544	Unclassified	1613
58	Ga0070665_100000211	3300005548	Bacteria	100358
59	Ga0070665_100053747	3300005548	Bacteria	4039
60	Ga0070704_100003254	3300005549	Bacteria	9284
61	Ga0068855_100001359	3300005563	Bacteria	30323
62	Ga0068855_100008226	3300005563	Bacteria	12611
63	Ga0068856_100000172	3300005614	Bacteria	67506
64	Ga0068856_100162031	3300005614	Bacteria	2247
65	Ga0068856_100385314	3300005614	Bacteria	1421
66	Ga0070702_100193186	3300005615	Unclassified	1341
67	Ga0068859_100020653	3300005617	Bacteria	6609
68	Ga0068863_100021291	3300005841	Bacteria	6188
69	Ga0068858_100030619	3300005842	Bacteria	4997
70	Ga0068858_100138298	3300005842	Bacteria	2286
71	Ga0068860_100134833	3300005843	Bacteria	2371
72	Ga0068862_100046360	3300005844	Bacteria	3709
73	Ga0081539_10000597	3300005985	Bacteria	73805
74	Ga0075364_10113853	3300006051	Bacteria	1807
75	Ga0097621_100019204	3300006237	Bacteria	5242
76	Ga0097621_100053428	3300006237	Bacteria	3294
77	Ga0097620_100020652	3300006931	Bacteria	6609
78	Ga0075435_100098279	3300007076	Bacteria	2423
79	Ga0099794_10125644	3300007265	Bacteria	1293
80	Ga0105251_10000437	3300009011	Bacteria	40388
81	Ga0105240_10005588	3300009093	Bacteria	18681
82	Ga0105240_10072011	3300009093	Bacteria	4273
83	Ga0105240_10113239	3300009093	Unclassified	3278
84	Ga0105240_10297781	3300009093	Bacteria	1846
85	Ga0111539_10006264	3300009094	Bacteria	15359
86	Ga0111539_10061432	3300009094	Bacteria	4452
87	Ga0111539_10157307	3300009094	Bacteria	2659
88	Ga0105245_10074377	3300009098	Bacteria	3092
89	Ga0105247_10012056	3300009101	Bacteria	5193
90	Ga0105247_10024169	3300009101	Bacteria	3661
91	Ga0105242_10021648	3300009176	Bacteria	5050
92	Ga0105237_10395779	3300009545	Bacteria	1386
93	Ga0105238_10003835	3300009551	Bacteria	14930
94	Ga0105238_10004550	3300009551	Bacteria	13724
95	Ga0105238_10013121	3300009551	Bacteria	8362
96	Ga0105238_10021458	3300009551	Bacteria	6578
97	Ga0105238_10037805	3300009551	Bacteria	4905
98	Ga0105238_10099046	3300009551	Bacteria	2898
99	Ga0105238_10148272	3300009551	Bacteria	2322
100	Ga0105249_10030490	3300009553	Bacteria	4876
101	Ga0099796_10061667	3300010159	Unclassified	1331
102	Ga0105246_10056026	3300011119	Bacteria	2723
103	Ga0157371_10000400	3300013102	Bacteria	54327
104	Ga0157374_10080308	3300013296	Bacteria	3093
105	Ga0163162_10000489	3300013306	Bacteria	36741
106	Ga0157372_10069210	3300013307	Bacteria	3970
107	Ga0157375_10000045	3300013308	Bacteria	151387
108	Ga0163163_10000239	3300014325	Bacteria	56166
109	Ga0163163_10005152	3300014325	Bacteria	11269
110	Ga0163163_10153163	3300014325	Bacteria	2349
111	Ga0157380_10011386	3300014326	Bacteria	6428
112	Ga0157379_10148439	3300014968	Bacteria	2115
113	Ga0157379_10219001	3300014968	Bacteria	1725
114	Ga0182006_1000085	3300015261	Bacteria	117595
115	Ga0182007_10000098	3300015262	Bacteria	61202
116	Ga0182005_1000606	3300015265	Bacteria	17393
117	Ga0163161_10013348	3300017792	Bacteria	5715
118	Ga0163161_10064333	3300017792	Bacteria	2675
119	Ga0207425_1004886	3300025245	Bacteria	3926
120	Ga0209565_1000022	3300025263	Bacteria	390888
121	Ga0209673_1000110	3300025273	Bacteria	181173
122	Ga0209675_1000060	3300025291	Bacteria	184316
123	Ga0209675_1008691	3300025291	Bacteria	3688
124	Ga0209675_1014152	3300025291	Bacteria	2445
125	Ga0209676_1000034	3300025292	Bacteria	460125
126	Ga0209676_1000219	3300025292	Bacteria	125330
127	Ga0209676_1001097	3300025292	Bacteria	30146
128	Ga0209676_1001110	3300025292	Bacteria	29893
129	Ga0209676_1003546	3300025292	Bacteria	9477
130	Ga0209676_1004172	3300025292	Bacteria	8213
131	Ga0209676_1004330	3300025292	Bacteria	7965
132	Ga0209676_1004424	3300025292	Bacteria	7842
133	Ga0209025_1000005	3300025294	Bacteria	1272149
134	Ga0209025_1001408	3300025294	Bacteria	31877
135	Ga0209025_1017654	3300025294	Bacteria	4100
136	Ga0209564_1000304	3300025295	Bacteria	97304
137	Ga0209564_1005424	3300025295	Bacteria	7290
138	Ga0209050_1001060	3300025298	Bacteria	33818
139	Ga0209050_1001440	3300025298	Bacteria	25569
140	Ga0209050_1009770	3300025298	Bacteria	4843
141	Ga0209256_1001956	3300025299	Bacteria	18677
142	Ga0209256_1003717	3300025299	Bacteria	10342
143	Ga0209256_1020436	3300025299	Bacteria	2066
144	Ga0209051_1000763	3300025303	Bacteria	34226
145	Ga0209051_1008672	3300025303	Bacteria	5351
146	Ga0209257_1000255	3300025304	Bacteria	123098
147	Ga0209257_1000283	3300025304	Bacteria	113507
148	Ga0209257_1000942	3300025304	Bacteria	40190
149	Ga0209257_1003658	3300025304	Bacteria	12895
150	Ga0209257_1005663	3300025304	Bacteria	8625
151	Ga0209257_1005877	3300025304	Bacteria	8283
152	Ga0209257_1007996	3300025304	Bacteria	6176
153	Ga0209257_1008731	3300025304	Bacteria	5644
154	Ga0207713_1000792	3300025735	Bacteria	29285
155	Ga0207710_10035638	3300025900	Bacteria	2190
156	Ga0207688_10024490	3300025901	Bacteria	3310
157	Ga0207680_10000005	3300025903	Bacteria	660983
158	Ga0207680_10044565	3300025903	Unclassified	2610
159	Ga0207707_10247282	3300025912	Bacteria	1549
160	Ga0207695_10132823	3300025913	Bacteria	2445
161	Ga0207693_10264571	3300025915	Bacteria	1348
162	Ga0207663_10044211	3300025916	Unclassified	2733
163	Ga0207657_10189081	3300025919	Unclassified	1662
164	Ga0207694_10002498	3300025924	Bacteria	14951
165	Ga0207694_10003754	3300025924	Bacteria	12036
166	Ga0207694_10009159	3300025924	Bacteria	7472
167	Ga0207694_10013114	3300025924	Bacteria	6241
168	Ga0207694_10053164	3300025924	Bacteria	3140
169	Ga0207694_10065492	3300025924	Bacteria	2833
170	Ga0207650_10019045	3300025925	Bacteria	4824
171	Ga0207664_10111633	3300025929	Bacteria	2275
172	Ga0207686_10075233	3300025934	Unclassified	2185
173	Ga0207670_10000636	3300025936	Bacteria	18770
174	Ga0207670_10118649	3300025936	Unclassified	1919
175	Ga0207670_10139882	3300025936	Unclassified	1784
176	Ga0207667_10000933	3300025949	Bacteria	37283
177	Ga0207667_10015959	3300025949	Bacteria	8505
178	Ga0207712_10057386	3300025961	Bacteria	2747
179	Ga0207658_10009494	3300025986	Bacteria	6602
180	Ga0207677_10069929	3300026023	Bacteria	2471
181	Ga0207703_10033368	3300026035	Bacteria	4080
182	Ga0207708_10158535	3300026075	Bacteria	1786
183	Ga0207702_10004142	3300026078	Bacteria	12999
184	Ga0207674_10101338	3300026116	Bacteria	2860
185	Ga0268266_10000001	3300028379	Bacteria	4040580
186	Ga0268266_10000004	3300028379	Bacteria	1495817
187	Ga0268265_10128623	3300028380	Unclassified	2101
188	Ga0268264_10270549	3300028381	Bacteria	1587
189	Ga0265337_1001358	3300028556	Bacteria	12067
190	Ga0265337_1001384	3300028556	Bacteria	11913
191	Ga0265337_1004040	3300028556	Bacteria	6195
192	Ga0265337_1004847	3300028556	Bacteria	5498
193	Ga0265326_10005487	3300028558	Bacteria	3998
194	Ga0265326_10032884	3300028558	Unclassified	1477
195	Ga0265326_10033192	3300028558	Unclassified	1469
196	Ga0265319_1000051	3300028563	Bacteria	97169
197	Ga0265319_1028402	3300028563	Unclassified	1973
198	Ga0265334_10013758	3300028573	Bacteria	3382
199	Ga0265318_10051444	3300028577	Bacteria	1547
200	Ga0265323_10000237	3300028653	Bacteria	32647
201	Ga0265323_10001702	3300028653	Bacteria	10498
202	Ga0265322_10000313	3300028654	Bacteria	20460
203	Ga0265336_10000985	3300028666	Bacteria	14044
204	Ga0265336_10017303	3300028666	Bacteria	2348
205	Ga0265336_10023262	3300028666	Bacteria	1967
206	Ga0265338_10000029	3300028800	Bacteria	271824
207	Ga0265338_10000096	3300028800	Bacteria	164859
208	Ga0265338_10000197	3300028800	Bacteria	113587
209	Ga0265338_10000433	3300028800	Bacteria	75181
210	Ga0265338_10001868	3300028800	Bacteria	33087
211	Ga0265338_10002793	3300028800	Bacteria	25528
212	Ga0265338_10004653	3300028800	Bacteria	18438
213	Ga0265338_10006124	3300028800	Bacteria	15438
214	Ga0265338_10006293	3300028800	Bacteria	15174
215	Ga0265338_10006514	3300028800	Bacteria	14844
216	Ga0265338_10011251	3300028800	Bacteria	10362
217	Ga0265338_10017391	3300028800	Bacteria	7752
218	Ga0265338_10029314	3300028800	Bacteria	5457
219	Ga0265338_10029847	3300028800	Bacteria	5395
220	Ga0265338_10039145	3300028800	Bacteria	4479
221	Ga0265338_10040249	3300028800	Bacteria	4394
222	Ga0265338_10046024	3300028800	Bacteria	4003
223	Ga0265338_10061676	3300028800	Bacteria	3285
224	Ga0265338_10091833	3300028800	Bacteria	2506
225	Ga0265338_10103495	3300028800	Bacteria	2312
226	Ga0265338_10221026	3300028800	Bacteria	1415
227	Ga0265324_10000998	3300029957	Bacteria	17403
228	Ga0265324_10002564	3300029957	Bacteria	9174
229	Ga0265324_10004454	3300029957	Bacteria	6323
230	Ga0265324_10011492	3300029957	Bacteria	3371
231	Ga0265324_10016664	3300029957	Bacteria	2678
232	Ga0265324_10044384	3300029957	Bacteria	1532
233	Ga0316183_1029479	3300030742	Bacteria	1455
234	Ga0265332_10017223	3300031238	Bacteria	3188
235	Ga0265320_10000583	3300031240	Bacteria	28117
236	Ga0265320_10006602	3300031240	Bacteria	7292
237	Ga0265320_10010692	3300031240	Bacteria	5446
238	Ga0265320_10023263	3300031240	Bacteria	3300
239	Ga0265325_10019045	3300031241	Bacteria	3800
240	Ga0265325_10020358	3300031241	Bacteria	3657
241	Ga0265329_10001249	3300031242	Bacteria	12429
242	Ga0265329_10010089	3300031242	Bacteria	3486
243	Ga0265329_10012103	3300031242	Bacteria	3114
244	Ga0265340_10002492	3300031247	Bacteria	10465
245	Ga0265340_10015286	3300031247	Bacteria	3991
246	Ga0265339_10005661	3300031249	Bacteria	8294
247	Ga0265339_10015638	3300031249	Bacteria	4544
248	Ga0265339_10064640	3300031249	Bacteria	1963
249	Ga0265339_10109961	3300031249	Unclassified	1426
250	Ga0265331_10077702	3300031250	Bacteria	1546
251	Ga0265327_10001514	3300031251	Bacteria	28735
252	Ga0265327_10014271	3300031251	Bacteria	5205
253	Ga0265316_10004124	3300031344	Bacteria	14548
254	Ga0265316_10005037	3300031344	Bacteria	12965
255	Ga0265316_10006096	3300031344	Bacteria	11568
256	Ga0265316_10007560	3300031344	Bacteria	10225
257	Ga0265316_10014977	3300031344	Bacteria	6801
258	Ga0265316_10024937	3300031344	Bacteria	4999
259	Ga0265316_10040171	3300031344	Bacteria	3752
260	Ga0307408_100043152	3300031548	Bacteria	3208
261	Ga0307408_100108644	3300031548	Bacteria	2127
262	Ga0307408_100190917	3300031548	Bacteria	1650
263	Ga0265313_10001134	3300031595	Bacteria	25446
264	Ga0265313_10001377	3300031595	Bacteria	22818
265	Ga0265313_10012697	3300031595	Bacteria	5116
266	Ga0265313_10033157	3300031595	Bacteria	2628
267	Ga0307508_10003624	3300031616	Bacteria	15507
268	Ga0265314_10000148	3300031711	Bacteria	105207
269	Ga0265314_10009693	3300031711	Bacteria	8104
270	Ga0265314_10009981	3300031711	Bacteria	7965
271	Ga0265314_10012067	3300031711	Bacteria	7081
272	Ga0265314_10020102	3300031711	Bacteria	5157
273	Ga0265342_10005423	3300031712	Bacteria	9732
274	Ga0265342_10006026	3300031712	Bacteria	9104
275	Ga0265342_10009283	3300031712	Bacteria	6947
276	Ga0265342_10135788	3300031712	Unclassified	1375
277	Ga0307516_10001159	3300031730	Bacteria	36887
278	Ga0307413_10000718	3300031824	Bacteria	11373
279	Ga0307413_10080553	3300031824	Bacteria	2085
280	Ga0307406_10058820	3300031901	Bacteria	2471
281	Ga0307406_10118240	3300031901	Bacteria	1837
282	Ga0307510_10005230	3300033180	Bacteria	15426
283	Ga0307510_10021816	3300033180	Bacteria	7452
284	Ga0373930_0017996	3300034816	Bacteria	1353
285	Ga0373928_0000004	3300035084	Bacteria	45792
286	Ga0373929_0000339	3300035085	Bacteria	8701
287	Ga0373944_0000023	3300035089	Bacteria	27187
288	Ga0373949_0015098	3300035090	Bacteria	1722
289	Ga0373951_0014402	3300035091	Bacteria	1778
290	Ga0373932_0000001	3300035112	Bacteria	1459067
291	Ga0373945_0029108	3300035116	Bacteria	1939
292	Ga0373954_0025307	3300035118	Unclassified	2712
293	Ga0373962_0000262	3300035242	Bacteria	11256
294	Ga0373931_0000008	3300035691	Bacteria	362269
295	Ga0373935_0211744	3300035692	Bacteria	1343
296	Ga0373927_0024417	3300035695	Bacteria	3954
297	Ga0373947_0018885	3300035725	Bacteria	3972
298	Ga0373937_0193345	3300036401	Bacteria	1912
299	Ga0373925_0000077	3300037068	Bacteria	105383
300	Ga0373925_0004248	3300037068	Bacteria	10853
301	Ga0373925_0100077	3300037068	Bacteria	2227
302	Ga0373925_0158961	3300037068	Bacteria	1779
303	Ga0237819_00013	3300038705	Bacteria	59823
304	Ga0439439_0011861	3300041406	Bacteria	2101
305	Ga0439447_000596	3300041407	Bacteria	13491
306	Ga0439465_0029514	3300041413	Bacteria	1742
307	Ga0451791_0263420	3300041451	Bacteria	2856
308	Ga0451807_0681147	3300041486	Bacteria	3088
309	Ga0439445_0007409	3300042004	Bacteria	2545
310	Ga0439432_003311	3300042006	Bacteria	5989
311	Ga0439449_0000069	3300042007	Bacteria	32108
312	Ga0439449_0002047	3300042007	Bacteria	7940
313	Ga0450894_009519	3300042131	Bacteria	1261
314	Ga0451577_0000223	3300042876	Bacteria	116763
315	Ga0451577_0000302	3300042876	Bacteria	95860
316	Ga0451577_0007183	3300042876	Bacteria	10980
317	Ga0451577_0013657	3300042876	Bacteria	7594
318	Ga0451577_0195006	3300042876	Bacteria	1828
319	Ga0453684_0000722	3300044712	Bacteria	116763
320	Ga0453684_0001577	3300044712	Bacteria	63055
321	Ga0453684_0006245	3300044712	Bacteria	22828
322	Ga0453684_0021165	3300044712	Bacteria	9742
323	Ga0453684_0033381	3300044712	Bacteria	7178
324	Ga0451576_0008164	3300045051	Bacteria	12326
325	Ga0451576_0082107	3300045051	Bacteria	3352
326	Ga0451576_0095140	3300045051	Bacteria	3098
327	Ga0451576_0275157	3300045051	Bacteria	1760
328	Ga0451576_0434528	3300045051	Bacteria	1378
329	Ga0451576_0650092	3300045051	Bacteria	1108
330	Ga0495592_0000633	3300046454	Bacteria	24512
331	Ga0495638_0036914	3300046460	Bacteria	3110
332	Ga0495650_0000247	3300046471	Bacteria	106616
333	Ga0495582_0007386	3300046473	Bacteria	6086
334	Ga0495664_0176469	3300046477	Bacteria	1296
335	Ga0495607_0000120	3300046501	Bacteria	82667
336	Ga0495606_0043668	3300046507	Bacteria	2987
337	Ga0495608_0140454	3300046511	Bacteria	1542
338	Ga0495610_0005449	3300046512	Bacteria	9036
339	Ga0495618_0109248	3300046514	Unclassified	1771
340	Ga0495628_0040754	3300046516	Bacteria	3709
341	Ga0495630_0000135	3300046517	Bacteria	58009
342	Ga0495630_0006017	3300046517	Bacteria	8587
343	Ga0495630_0027377	3300046517	Bacteria	4229
344	Ga0495630_0041602	3300046517	Bacteria	3432
345	Ga0495630_0132250	3300046517	Unclassified	1895
346	Ga0495631_0001288	3300046518	Bacteria	15397
347	Ga0495632_0000004	3300046519	Bacteria	381372
348	Ga0495666_0005709	3300046526	Bacteria	6272
349	Ga0495666_0071565	3300046526	Bacteria	1648
350	Ga0495586_0000033	3300046535	Bacteria	89808
351	Ga0495586_0003878	3300046535	Bacteria	8010
352	Ga0495609_0007444	3300046538	Bacteria	5467
353	Ga0495645_0062242	3300046543	Bacteria	2703
354	Ga0495645_0097529	3300046543	Bacteria	2093
355	Ga0495667_0112152	3300046559	Unclassified	1762
356	Ga0495656_0009765	3300046615	Bacteria	3462
357	Ga0495668_0003460	3300046616	Bacteria	11788
358	Ga0495634_0005152	3300046642	Bacteria	10092
359	Ga0495625_0005535	3300046660	Bacteria	11474
360	Ga0495625_0027839	3300046660	Bacteria	4246
361	Ga0495657_0044518	3300046675	Bacteria	3019
362	Ga0495599_0020240	3300046678	Unclassified	4144
363	Ga0495658_0028671	3300046683	Bacteria	3007
364	Ga0495658_0049459	3300046683	Bacteria	2375
365	Ga0495613_0140075	3300046689	Bacteria	1729
366	Ga0495671_0000492	3300046692	Bacteria	30463
367	Ga0495660_0000092	3300046810	Bacteria	96197
368	Ga0495660_0000583	3300046810	Bacteria	29142
369	Ga0495581_0072607	3300047315	Unclassified	1991
370	Ga0495636_0012391	3300047318	Bacteria	3375
371	Ga0495674_0001612	3300047319	Bacteria	22109
372	Ga0495674_0025026	3300047319	Bacteria	5478
373	Ga0495674_0047086	3300047319	Bacteria	3825
374	Ga0495672_0000527	3300047320	Bacteria	43714
375	Ga0495672_0059425	3300047320	Bacteria	2212
376	Ga0495676_0011983	3300047321	Bacteria	7822
377	Ga0495673_0000004	3300047469	Bacteria	1354526
378	Ga0496116_0023354	3300048919	Bacteria	4607
379	Ga0496117_0002719	3300048920	Bacteria	21740
380	Ga0496117_0014855	3300048920	Bacteria	6681
381	Ga0496118_0000497	3300048921	Bacteria	65119
382	Ga0496118_0020892	3300048921	Bacteria	5789
383	Ga0496118_0055531	3300048921	Bacteria	2987
384	Ga0496118_0080933	3300048921	Bacteria	2283
385	Ga0496119_0001795	3300048922	Bacteria	24973
386	Ga0496119_0004827	3300048922	Bacteria	13209
387	Ga0496120_0001136	3300048923	Bacteria	34341
388	Ga0496120_0002058	3300048923	Bacteria	21712
389	Ga0496121_0002194	3300048924	Bacteria	30543
390	Ga0496121_0118618	3300048924	Bacteria	2002
391	Ga0496122_0002792	3300048925	Bacteria	24001
392	Ga0496122_0006517	3300048925	Bacteria	13369
393	Ga0496123_0000436	3300048926	Bacteria	74963
394	Ga0496123_0037964	3300048926	Bacteria	3393
395	Ga0496124_0000813	3300048927	Bacteria	50733
396	Ga0496124_0006068	3300048927	Bacteria	13293
397	Ga0496124_0022699	3300048927	Bacteria	5746
398	Ga0496124_0037232	3300048927	Bacteria	4233
399	Ga0496124_0060597	3300048927	Bacteria	3174
400	Ga0496124_0080477	3300048927	Bacteria	2681
401	Ga0496124_0120374	3300048927	Bacteria	2098
402	Ga0496125_0001835	3300048928	Bacteria	29344
403	Ga0496125_0014271	3300048928	Bacteria	7743
404	Ga0496125_0014514	3300048928	Bacteria	7668
405	Ga0496126_0002251	3300048929	Bacteria	26628
406	Ga0501042_0384042	3300049578	Unclassified	1017
407	Ga0501043_0007450	3300049579	Bacteria	8691
408	Ga0501225_0005742	3300049705	Bacteria	3633
409	Ga0501083_0044760	3300049744	Bacteria	2996
410	Ga0501035_0330402	3300049822	Bacteria	1279
411	Ga0501044_0010418	3300049823	Bacteria	10089
412	nmdc:mga00v17_137924_c1	3300050491	Bacteria	1563
413	nmdc:mga00v17_29478_c1	3300050491	Bacteria	3221
414	nmdc:mga00v17_43065_c1	3300050491	Bacteria	2718
415	nmdc:mga00v17_48108_c1	3300050491	Bacteria	2584
416	nmdc:mga00v17_87224_c1	3300050491	Bacteria	1956
417	nmdc:mga05p37_183516_c1	3300050507	Bacteria	2544
418	nmdc:mga09592_210362_c1	3300050508	Unclassified	1685
419	nmdc:mga06r32_275636_c1	3300050510	Bacteria	1669
420	nmdc:mga08y16_195924_c1	3300050511	Bacteria	2094
421	nmdc:mga08y16_24719_c1	3300050511	Bacteria	6340
422	nmdc:mga0rr50_108693_c1	3300050513	Bacteria	2191
423	nmdc:mga0a205_86291_c2	3300050515	Bacteria	1797
424	Ga0500643_001826	3300053087	Bacteria	11631
425	Ga0500651_0001118	3300053093	Bacteria	13279
426	Ga0500650_0017118	3300053098	Unclassified	3124
427	Ga0500555_000973	3300053103	Bacteria	9908
428	Ga0500568_0005219	3300053139	Bacteria	6764
429	Ga0530510_0142880	3300061734	Unclassified	1764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049578	Ga0501042_0384042	Ga0501042_0384042_27_974	290
2	3300046678	Ga0495599_0020240	Ga0495599_0020240_2524_3624	329
3	3300010159	Ga0099796_10061667	Ga0099796_100616671	333
4	3300005563	Ga0068855_100001359	Ga0068855_10000135916	334
5	3300025949	Ga0207667_10000933	Ga0207667_1000093314	334
6	3300028653	Ga0265323_10001702	Ga0265323_100017022	334
7	3300031242	Ga0265329_10010089	Ga0265329_100100892	334
8	3300031712	Ga0265342_10005423	Ga0265342_100054238	334
9	3300005466	Ga0070685_10116079	Ga0070685_101160792	338
10	3300005614	Ga0068856_100385314	Ga0068856_1003853142	339
11	3300034816	Ga0373930_0017996	Ga0373930_0017996_108_1145	339
12	3300035084	Ga0373928_0000004	Ga0373928_0000004_725_1762	339
13	3300035085	Ga0373929_0000339	Ga0373929_0000339_3688_4725	339
14	3300035089	Ga0373944_0000023	Ga0373944_0000023_4515_5552	339
15	3300035090	Ga0373949_0015098	Ga0373949_0015098_136_1173	339
16	3300035091	Ga0373951_0014402	Ga0373951_0014402_289_1326	339
17	3300035112	Ga0373932_0000001	Ga0373932_0000001_867227_868264	339
18	3300035116	Ga0373945_0029108	Ga0373945_0029108_717_1754	339
19	3300035242	Ga0373962_0000262	Ga0373962_0000262_6471_7508	339
20	3300035691	Ga0373931_0000008	Ga0373931_0000008_333802_334839	339
21	3300035692	Ga0373935_0211744	Ga0373935_0211744_135_1172	339
22	3300035695	Ga0373927_0024417	Ga0373927_0024417_194_1231	339
23	3300035725	Ga0373947_0018885	Ga0373947_0018885_237_1274	339
24	3300037068	Ga0373925_0000077	Ga0373925_0000077_7908_8945	339
25	3300005329	Ga0070683_100182490	Ga0070683_1001824902	340
26	3300005339	Ga0070660_100098463	Ga0070660_1000984632	340
27	3300005563	Ga0068855_100008226	Ga0068855_10000822610	340
28	3300013307	Ga0157372_10069210	Ga0157372_100692105	340
29	3300025919	Ga0207657_10189081	Ga0207657_101890812	340
30	3300025949	Ga0207667_10015959	Ga0207667_100159595	340
31	3300028800	Ga0265338_10006514	Ga0265338_100065149	340
32	3300029957	Ga0265324_10000998	Ga0265324_1000099822	340
33	3300031548	Ga0307408_100108644	Ga0307408_1001086442	340
34	3300046473	Ga0495582_0007386	Ga0495582_0007386_3781_4884	340
35	3300046514	Ga0495618_0109248	Ga0495618_0109248_76_1179	340
36	3300046517	Ga0495630_0000135	Ga0495630_0000135_9515_10618	340
37	3300046526	Ga0495666_0005709	Ga0495666_0005709_668_1771	340
38	3300046535	Ga0495586_0000033	Ga0495586_0000033_39315_40418	340
39	3300046642	Ga0495634_0005152	Ga0495634_0005152_6968_8071	340
40	3300046683	Ga0495658_0028671	Ga0495658_0028671_679_1782	340
41	3300047315	Ga0495581_0072607	Ga0495581_0072607_790_1893	340
42	3300047319	Ga0495674_0001612	Ga0495674_0001612_12225_13328	340
43	3300047321	Ga0495676_0011983	Ga0495676_0011983_379_1482	340
44	3300005544	Ga0070686_100153813	Ga0070686_1001538133	341
45	3300028800	Ga0265338_10000029	Ga0265338_10000029142	341
46	3300029957	Ga0265324_10011492	Ga0265324_100114923	341
47	3300031250	Ga0265331_10077702	Ga0265331_100777022	341
48	3300042876	Ga0451577_0195006	Ga0451577_0195006_716_1759	341
49	3300044712	Ga0453684_0006245	Ga0453684_0006245_15177_16220	341
50	3300005439	Ga0070711_100001874	Ga0070711_10000187411	342
51	3300005614	Ga0068856_100162031	Ga0068856_1001620312	342
52	3300025916	Ga0207663_10044211	Ga0207663_100442111	342
53	3300009093	Ga0105240_10113239	Ga0105240_101132393	343
54	3300009176	Ga0105242_10021648	Ga0105242_100216482	344
55	3300013308	Ga0157375_10000045	Ga0157375_10000045103	344
56	3300025903	Ga0207680_10044565	Ga0207680_100445652	344
57	3300025934	Ga0207686_10075233	Ga0207686_100752332	344
58	3300037068	Ga0373925_0100077	Ga0373925_0100077_1013_2095	344
59	3300031240	Ga0265320_10010692	Ga0265320_100106927	345
60	3300009101	Ga0105247_10024169	Ga0105247_100241692	346
61	3300011119	Ga0105246_10056026	Ga0105246_100560262	346
62	3300014968	Ga0157379_10148439	Ga0157379_101484392	346
63	3300028800	Ga0265338_10039145	Ga0265338_100391454	346
64	3300028800	Ga0265338_10061676	Ga0265338_100616763	346
65	3300003323	rootH1_10094619	rootH1_100946191	347
66	3300005518	Ga0070699_100119662	Ga0070699_1001196622	347
67	3300028800	Ga0265338_10001868	Ga0265338_1000186830	347
68	3300031616	Ga0307508_10003624	Ga0307508_1000362412	347
69	3300031711	Ga0265314_10012067	Ga0265314_100120671	347
70	3300031730	Ga0307516_10001159	Ga0307516_1000115913	347
71	3300047320	Ga0495672_0059425	Ga0495672_0059425_687_1769	347
72	3300042131	Ga0450894_009519	Ga0450894_009519_54_1196	349
73	3300005335	Ga0070666_10058462	Ga0070666_100584621	350
74	3300005544	Ga0070686_100034981	Ga0070686_1000349811	350
75	3300009094	Ga0111539_10157307	Ga0111539_101573072	350
76	3300048920	Ga0496117_0014855	Ga0496117_0014855_2827_3978	350
77	3300048921	Ga0496118_0000497	Ga0496118_0000497_61264_62415	350
78	3300061734	Ga0530510_0142880	Ga0530510_0142880_437_1564	350
79	3300005289	Ga0065704_10070476	Ga0065704_1007047617	351
80	3300005331	Ga0070670_100029829	Ga0070670_1000298295	351
81	3300005468	Ga0070707_100060749	Ga0070707_1000607492	351
82	3300009011	Ga0105251_10000437	Ga0105251_1000043724	351
83	3300009093	Ga0105240_10297781	Ga0105240_102977811	351
84	3300009551	Ga0105238_10013121	Ga0105238_100131212	351
85	3300025735	Ga0207713_1000792	Ga0207713_100079223	351
86	3300025924	Ga0207694_10002498	Ga0207694_100024989	351
87	3300025925	Ga0207650_10019045	Ga0207650_100190452	351
88	3300028800	Ga0265338_10029847	Ga0265338_100298474	351
89	3300031249	Ga0265339_10005661	Ga0265339_100056618	351
90	3300048920	Ga0496117_0002719	Ga0496117_0002719_5743_6933	351
91	3300048922	Ga0496119_0004827	Ga0496119_0004827_4508_5698	351
92	3300048923	Ga0496120_0001136	Ga0496120_0001136_4613_5803	351
93	3300048925	Ga0496122_0006517	Ga0496122_0006517_7485_8675	351
94	3300048926	Ga0496123_0000436	Ga0496123_0000436_54617_55807	351
95	3300048927	Ga0496124_0006068	Ga0496124_0006068_4578_5768	351
96	3300049744	Ga0501083_0044760	Ga0501083_0044760_985_2058	351
97	3300050515	nmdc:mga0a205_86291_c2	nmdc:mga0a205_86291_c2_562_1707	351
98	3300003320	rootH2_10018598	rootH2_1001859814	352
99	3300003320	rootH2_10086489	rootH2_100864892	352
100	3300003323	rootH1_10016988	rootH1_100169882	352
101	3300005330	Ga0070690_100001178	Ga0070690_10000117815	352
102	3300005340	Ga0070689_100000377	Ga0070689_10000037718	352
103	3300005340	Ga0070689_100315882	Ga0070689_1003158822	352
104	3300005365	Ga0070688_100022738	Ga0070688_1000227384	352
105	3300005435	Ga0070714_100080588	Ga0070714_1000805882	352
106	3300005458	Ga0070681_10081759	Ga0070681_100817593	352
107	3300005539	Ga0068853_100073458	Ga0068853_1000734581	352
108	3300005544	Ga0070686_100104235	Ga0070686_1001042352	352
109	3300005614	Ga0068856_100000172	Ga0068856_10000017233	352
110	3300005841	Ga0068863_100021291	Ga0068863_1000212913	352
111	3300007265	Ga0099794_10125644	Ga0099794_101256441	352
112	3300009093	Ga0105240_10005588	Ga0105240_1000558817	352
113	3300009093	Ga0105240_10072011	Ga0105240_100720112	352
114	3300009094	Ga0111539_10006264	Ga0111539_100062645	352
115	3300009094	Ga0111539_10061432	Ga0111539_100614325	352
116	3300009545	Ga0105237_10395779	Ga0105237_103957791	352
117	3300009551	Ga0105238_10004550	Ga0105238_1000455013	352
118	3300009551	Ga0105238_10021458	Ga0105238_100214584	352
119	3300009551	Ga0105238_10099046	Ga0105238_100990464	352
120	3300013296	Ga0157374_10080308	Ga0157374_100803084	352
121	3300014325	Ga0163163_10153163	Ga0163163_101531632	352
122	3300025913	Ga0207695_10132823	Ga0207695_101328231	352
123	3300025915	Ga0207693_10264571	Ga0207693_102645711	352
124	3300025924	Ga0207694_10003754	Ga0207694_1000375410	352
125	3300025924	Ga0207694_10053164	Ga0207694_100531642	352
126	3300025924	Ga0207694_10065492	Ga0207694_100654922	352
127	3300025929	Ga0207664_10111633	Ga0207664_101116331	352
128	3300025936	Ga0207670_10000636	Ga0207670_100006363	352
129	3300025936	Ga0207670_10118649	Ga0207670_101186492	352
130	3300025936	Ga0207670_10139882	Ga0207670_101398822	352
131	3300026078	Ga0207702_10004142	Ga0207702_1000414215	352
132	3300026116	Ga0207674_10101338	Ga0207674_101013382	352
133	3300028380	Ga0268265_10128623	Ga0268265_101286232	352
134	3300028556	Ga0265337_1001358	Ga0265337_10013585	352
135	3300028556	Ga0265337_1001384	Ga0265337_10013842	352
136	3300028556	Ga0265337_1004040	Ga0265337_10040408	352
137	3300028558	Ga0265326_10005487	Ga0265326_100054874	352
138	3300028558	Ga0265326_10032884	Ga0265326_100328842	352
139	3300028558	Ga0265326_10033192	Ga0265326_100331922	352
140	3300028563	Ga0265319_1000051	Ga0265319_100005119	352
141	3300028563	Ga0265319_1028402	Ga0265319_10284022	352
142	3300028573	Ga0265334_10013758	Ga0265334_100137584	352
143	3300028577	Ga0265318_10051444	Ga0265318_100514442	352
144	3300028653	Ga0265323_10000237	Ga0265323_100002374	352
145	3300028666	Ga0265336_10000985	Ga0265336_100009859	352
146	3300028666	Ga0265336_10017303	Ga0265336_100173032	352
147	3300028666	Ga0265336_10023262	Ga0265336_100232622	352
148	3300028800	Ga0265338_10000096	Ga0265338_1000009680	352
149	3300028800	Ga0265338_10000197	Ga0265338_1000019713	352
150	3300028800	Ga0265338_10000433	Ga0265338_1000043328	352
151	3300028800	Ga0265338_10002793	Ga0265338_100027938	352
152	3300028800	Ga0265338_10004653	Ga0265338_100046536	352
153	3300028800	Ga0265338_10006124	Ga0265338_100061242	352
154	3300028800	Ga0265338_10006293	Ga0265338_100062935	352
155	3300028800	Ga0265338_10011251	Ga0265338_100112512	352
156	3300028800	Ga0265338_10017391	Ga0265338_100173915	352
157	3300028800	Ga0265338_10029314	Ga0265338_100293143	352
158	3300028800	Ga0265338_10040249	Ga0265338_100402493	352
159	3300028800	Ga0265338_10046024	Ga0265338_100460242	352
160	3300028800	Ga0265338_10091833	Ga0265338_100918333	352
161	3300028800	Ga0265338_10103495	Ga0265338_101034952	352
162	3300028800	Ga0265338_10221026	Ga0265338_102210261	352
163	3300029957	Ga0265324_10002564	Ga0265324_100025641	352
164	3300029957	Ga0265324_10016664	Ga0265324_100166642	352
165	3300029957	Ga0265324_10044384	Ga0265324_100443842	352
166	3300031238	Ga0265332_10017223	Ga0265332_100172233	352
167	3300031240	Ga0265320_10000583	Ga0265320_1000058319	352
168	3300031240	Ga0265320_10023263	Ga0265320_100232635	352
169	3300031241	Ga0265325_10019045	Ga0265325_100190454	352
170	3300031241	Ga0265325_10020358	Ga0265325_100203584	352
171	3300031242	Ga0265329_10001249	Ga0265329_100012492	352
172	3300031247	Ga0265340_10002492	Ga0265340_100024924	352
173	3300031247	Ga0265340_10015286	Ga0265340_100152863	352
174	3300031249	Ga0265339_10015638	Ga0265339_100156383	352
175	3300031249	Ga0265339_10109961	Ga0265339_101099612	352
176	3300031251	Ga0265327_10001514	Ga0265327_1000151410	352
177	3300031251	Ga0265327_10014271	Ga0265327_100142713	352
178	3300031344	Ga0265316_10004124	Ga0265316_1000412415	352
179	3300031344	Ga0265316_10005037	Ga0265316_1000503711	352
180	3300031344	Ga0265316_10007560	Ga0265316_100075603	352
181	3300031344	Ga0265316_10014977	Ga0265316_100149775	352
182	3300031344	Ga0265316_10024937	Ga0265316_100249375	352
183	3300031344	Ga0265316_10040171	Ga0265316_100401713	352
184	3300031595	Ga0265313_10001377	Ga0265313_1000137718	352
185	3300031595	Ga0265313_10012697	Ga0265313_100126974	352
186	3300031711	Ga0265314_10000148	Ga0265314_1000014866	352
187	3300031711	Ga0265314_10009693	Ga0265314_100096939	352
188	3300031711	Ga0265314_10009981	Ga0265314_100099812	352
189	3300031711	Ga0265314_10020102	Ga0265314_100201023	352
190	3300031712	Ga0265342_10006026	Ga0265342_100060263	352
191	3300031712	Ga0265342_10135788	Ga0265342_101357882	352
192	3300035118	Ga0373954_0025307	Ga0373954_0025307_1084_2160	352
193	3300036401	Ga0373937_0193345	Ga0373937_0193345_101_1177	352
194	3300037068	Ga0373925_0158961	Ga0373925_0158961_264_1340	352
195	3300042876	Ga0451577_0000302	Ga0451577_0000302_93869_94945	352
196	3300042876	Ga0451577_0007183	Ga0451577_0007183_1539_2618	352
197	3300044712	Ga0453684_0021165	Ga0453684_0021165_1626_2702	352
198	3300044712	Ga0453684_0033381	Ga0453684_0033381_17_1093	352
199	3300045051	Ga0451576_0008164	Ga0451576_0008164_10047_11123	352
200	3300045051	Ga0451576_0082107	Ga0451576_0082107_1329_2405	352
201	3300045051	Ga0451576_0095140	Ga0451576_0095140_594_1670	352
202	3300045051	Ga0451576_0275157	Ga0451576_0275157_233_1309	352
203	3300045051	Ga0451576_0434528	Ga0451576_0434528_62_1138	352
204	3300045051	Ga0451576_0650092	Ga0451576_0650092_13_1089	352
205	3300046511	Ga0495608_0140454	Ga0495608_0140454_269_1345	352
206	3300046516	Ga0495628_0040754	Ga0495628_0040754_780_1856	352
207	3300046517	Ga0495630_0027377	Ga0495630_0027377_1690_2766	352
208	3300046517	Ga0495630_0041602	Ga0495630_0041602_741_1817	352
209	3300046517	Ga0495630_0132250	Ga0495630_0132250_91_1167	352
210	3300046543	Ga0495645_0062242	Ga0495645_0062242_1009_2085	352
211	3300046543	Ga0495645_0097529	Ga0495645_0097529_299_1375	352
212	3300046559	Ga0495667_0112152	Ga0495667_0112152_39_1115	352
213	3300046675	Ga0495657_0044518	Ga0495657_0044518_409_1485	352
214	3300046683	Ga0495658_0049459	Ga0495658_0049459_115_1191	352
215	3300046689	Ga0495613_0140075	Ga0495613_0140075_476_1552	352
216	3300047319	Ga0495674_0047086	Ga0495674_0047086_1076_2152	352
217	3300049822	Ga0501035_0330402	Ga0501035_0330402_171_1247	352
218	3300050508	nmdc:mga09592_210362_c1	nmdc:mga09592_210362_c1_98_1174	352
219	3300050510	nmdc:mga06r32_275636_c1	nmdc:mga06r32_275636_c1_503_1579	352
220	3300050511	nmdc:mga08y16_24719_c1	nmdc:mga08y16_24719_c1_4089_5165	352
221	3300050513	nmdc:mga0rr50_108693_c1	nmdc:mga0rr50_108693_c1_1080_2156	352
222	3300053098	Ga0500650_0017118	Ga0500650_0017118_381_1457	352
223	3300005544	Ga0070686_100100510	Ga0070686_1001005102	353
224	3300005549	Ga0070704_100003254	Ga0070704_1000032548	353
225	3300005842	Ga0068858_100138298	Ga0068858_1001382981	353
226	3300046477	Ga0495664_0176469	Ga0495664_0176469_167_1246	353
227	3300014326	Ga0157380_10011386	Ga0157380_100113865	354
228	3300050507	nmdc:mga05p37_183516_c1	nmdc:mga05p37_183516_c1_779_1864	354
229	3300005441	Ga0070700_100159117	Ga0070700_1001591171	355
230	3300005459	Ga0068867_100152430	Ga0068867_1001524301	355
231	3300005615	Ga0070702_100193186	Ga0070702_1001931861	355
232	3300006237	Ga0097621_100019204	Ga0097621_1000192042	355
233	3300007076	Ga0075435_100098279	Ga0075435_1000982792	355
234	3300009098	Ga0105245_10074377	Ga0105245_100743772	355
235	3300025912	Ga0207707_10247282	Ga0207707_102472821	355
236	3300026023	Ga0207677_10069929	Ga0207677_100699292	355
237	3300026075	Ga0207708_10158535	Ga0207708_101585351	355
238	3300042876	Ga0451577_0013657	Ga0451577_0013657_3863_4981	356
239	3300044712	Ga0453684_0001577	Ga0453684_0001577_44079_45197	356
240	3300014325	Ga0163163_10000239	Ga0163163_1000023929	357
241	3300028654	Ga0265322_10000313	Ga0265322_1000031312	357
242	3300031344	Ga0265316_10006096	Ga0265316_100060962	357
243	3300041451	Ga0451791_0263420	Ga0451791_0263420_1402_2520	357
244	3300041486	Ga0451807_0681147	Ga0451807_0681147_907_2025	357
245	3300005262	Ga0065165_1002100	Ga0065165_10021002	359
246	3300029957	Ga0265324_10004454	Ga0265324_100044544	359
247	3300037068	Ga0373925_0004248	Ga0373925_0004248_38_1138	359
248	3300046538	Ga0495609_0007444	Ga0495609_0007444_2436_3557	359
249	3300046692	Ga0495671_0000492	Ga0495671_0000492_28331_29452	359
250	3300050511	nmdc:mga08y16_195924_c1	nmdc:mga08y16_195924_c1_622_1734	359
251	3300053103	Ga0500555_000973	Ga0500555_000973_8717_9838	359
252	3300031242	Ga0265329_10012103	Ga0265329_100121033	360
253	3300031249	Ga0265339_10064640	Ga0265339_100646402	360
254	3300031595	Ga0265313_10001134	Ga0265313_1000113411	360
255	3300031595	Ga0265313_10033157	Ga0265313_100331572	360
256	3300031712	Ga0265342_10009283	Ga0265342_100092833	360
257	3300050491	nmdc:mga00v17_29478_c1	nmdc:mga00v17_29478_c1_1416_2564	360
258	3300005335	Ga0070666_10000005	Ga0070666_10000005102	362
259	3300005548	Ga0070665_100053747	Ga0070665_1000537473	362
260	3300009551	Ga0105238_10003835	Ga0105238_1000383514	362
261	3300013306	Ga0163162_10000489	Ga0163162_1000048910	362
262	3300025903	Ga0207680_10000005	Ga0207680_10000005459	362
263	3300025924	Ga0207694_10009159	Ga0207694_100091595	362
264	3300028379	Ga0268266_10000004	Ga0268266_100000041073	362
265	3300033180	Ga0307510_10021816	Ga0307510_100218166	362
266	3300046471	Ga0495650_0000247	Ga0495650_0000247_6082_7215	362
267	3300046501	Ga0495607_0000120	Ga0495607_0000120_78_1199	362
268	3300046810	Ga0495660_0000092	Ga0495660_0000092_82891_84012	362
269	3300009101	Ga0105247_10012056	Ga0105247_100120563	363
270	3300015261	Ga0182006_1000085	Ga0182006_100008547	363
271	3300025900	Ga0207710_10035638	Ga0207710_100356382	363
272	3300028556	Ga0265337_1004847	Ga0265337_10048472	363
273	3300046454	Ga0495592_0000633	Ga0495592_0000633_16348_17538	363
274	3300046517	Ga0495630_0006017	Ga0495630_0006017_5545_6735	363
275	3300046526	Ga0495666_0071565	Ga0495666_0071565_276_1466	363
276	3300046535	Ga0495586_0003878	Ga0495586_0003878_5755_6945	363
277	3300046810	Ga0495660_0000583	Ga0495660_0000583_20584_21705	363
278	3300047319	Ga0495674_0025026	Ga0495674_0025026_3172_4362	363
279	3300047469	Ga0495673_0000004	Ga0495673_0000004_88615_89736	363
280	3300048924	Ga0496121_0002194	Ga0496121_0002194_22075_23196	363
281	3300050491	nmdc:mga00v17_137924_c1	nmdc:mga00v17_137924_c1_214_1362	363
282	3300009551	Ga0105238_10148272	Ga0105238_101482722	364
283	3300013102	Ga0157371_10000400	Ga0157371_100004008	364
284	3300015262	Ga0182007_10000098	Ga0182007_1000009850	364
285	3300015265	Ga0182005_1000606	Ga0182005_100060611	364
286	3300031240	Ga0265320_10006602	Ga0265320_100066022	364
287	3300048919	Ga0496116_0023354	Ga0496116_0023354_1197_2345	364
288	3300048921	Ga0496118_0055531	Ga0496118_0055531_1234_2382	364
289	3300048921	Ga0496118_0080933	Ga0496118_0080933_571_1719	364
290	3300048922	Ga0496119_0001795	Ga0496119_0001795_17690_18838	364
291	3300048923	Ga0496120_0002058	Ga0496120_0002058_6152_7300	364
292	3300048924	Ga0496121_0118618	Ga0496121_0118618_763_1911	364
293	3300048925	Ga0496122_0002792	Ga0496122_0002792_760_1908	364
294	3300048926	Ga0496123_0037964	Ga0496123_0037964_26_1174	364
295	3300048927	Ga0496124_0037232	Ga0496124_0037232_1219_2367	364
296	3300048927	Ga0496124_0080477	Ga0496124_0080477_1419_2567	364
297	3300048928	Ga0496125_0001835	Ga0496125_0001835_6074_7222	364
298	3300048928	Ga0496125_0014271	Ga0496125_0014271_3211_4359	364
299	3300048928	Ga0496125_0014514	Ga0496125_0014514_3285_4433	364
300	3300048929	Ga0496126_0002251	Ga0496126_0002251_6129_7277	364
301	3300049823	Ga0501044_0010418	Ga0501044_0010418_5120_6250	364
302	3300003771	Ga0055526_1001840	Ga0055526_10018404	365
303	3300003773	Ga0055537_1000231	Ga0055537_100023128	365
304	3300003781	Ga0055536_1005072	Ga0055536_10050723	365
305	3300003784	Ga0055534_1000026	Ga0055534_100002628	365
306	3300003791	Ga0055530_10002120	Ga0055530_100021209	365
307	3300003791	Ga0055530_10002124	Ga0055530_100021243	365
308	3300003794	Ga0055531_10010451	Ga0055531_100104514	365
309	3300003794	Ga0055531_10011668	Ga0055531_100116682	365
310	3300005367	Ga0070667_100016300	Ga0070667_1000163002	365
311	3300005548	Ga0070665_100000211	Ga0070665_10000021184	365
312	3300014968	Ga0157379_10219001	Ga0157379_102190012	365
313	3300025263	Ga0209565_1000022	Ga0209565_1000022176	365
314	3300025273	Ga0209673_1000110	Ga0209673_100011080	365
315	3300025291	Ga0209675_1000060	Ga0209675_1000060134	365
316	3300025292	Ga0209676_1000219	Ga0209676_100021958	365
317	3300025295	Ga0209564_1000304	Ga0209564_100030475	365
318	3300025298	Ga0209050_1001440	Ga0209050_100144014	365
319	3300025299	Ga0209256_1020436	Ga0209256_10204362	365
320	3300025303	Ga0209051_1000763	Ga0209051_100076321	365
321	3300025304	Ga0209257_1000942	Ga0209257_100094224	365
322	3300025304	Ga0209257_1007996	Ga0209257_10079965	365
323	3300025986	Ga0207658_10009494	Ga0207658_100094943	365
324	3300028379	Ga0268266_10000001	Ga0268266_100000012115	365
325	3300046660	Ga0495625_0027839	Ga0495625_0027839_1635_2786	365
326	3300047320	Ga0495672_0000527	Ga0495672_0000527_29606_30757	365
327	3300048921	Ga0496118_0020892	Ga0496118_0020892_654_1805	365
328	3300048927	Ga0496124_0000813	Ga0496124_0000813_44170_45321	365
329	3300048927	Ga0496124_0060597	Ga0496124_0060597_645_1796	365
330	3300048927	Ga0496124_0120374	Ga0496124_0120374_303_1454	365
331	3300050491	nmdc:mga00v17_87224_c1	nmdc:mga00v17_87224_c1_408_1559	365
332	3300053087	Ga0500643_001826	Ga0500643_001826_5798_6928	365
333	3300053139	Ga0500568_0005219	Ga0500568_0005219_5114_6244	365
334	iso_pu_bacteria	2919404418	2919406070	365
335	3300003794	Ga0055531_10008561	Ga0055531_100085613	366
336	3300053093	Ga0500651_0001118	Ga0500651_0001118_2506_3660	367
337	iso_pu_bacteria	2738543009	2739229458	367
338	3300017792	Ga0163161_10013348	Ga0163161_100133483	368
339	3300046512	Ga0495610_0005449	Ga0495610_0005449_4649_5800	368
340	3300046518	Ga0495631_0001288	Ga0495631_0001288_3554_4705	368
341	3300048927	Ga0496124_0022699	Ga0496124_0022699_3460_4635	368
342	3300025292	Ga0209676_1003546	Ga0209676_10035462	369
343	3300003781	Ga0055536_1002005	Ga0055536_10020054	370
344	3300005289	Ga0065704_10070915	Ga0065704_100709159	370
345	3300005457	Ga0070662_100116784	Ga0070662_1001167841	370
346	3300005544	Ga0070686_100093006	Ga0070686_1000930062	370
347	3300005617	Ga0068859_100020653	Ga0068859_1000206536	370
348	3300005842	Ga0068858_100030619	Ga0068858_1000306192	370
349	3300005843	Ga0068860_100134833	Ga0068860_1001348332	370
350	3300005844	Ga0068862_100046360	Ga0068862_1000463605	370
351	3300005985	Ga0081539_10000597	Ga0081539_1000059742	370
352	3300006931	Ga0097620_100020652	Ga0097620_1000206526	370
353	3300009553	Ga0105249_10030490	Ga0105249_100304902	370
354	3300014325	Ga0163163_10005152	Ga0163163_100051526	370
355	3300017792	Ga0163161_10064333	Ga0163161_100643332	370
356	3300025292	Ga0209676_1000034	Ga0209676_1000034420	370
357	3300025901	Ga0207688_10024490	Ga0207688_100244902	370
358	3300025961	Ga0207712_10057386	Ga0207712_100573862	370
359	3300026035	Ga0207703_10033368	Ga0207703_100333685	370
360	3300028381	Ga0268264_10270549	Ga0268264_102705492	370
361	3300042006	Ga0439432_003311	Ga0439432_003311_2083_3213	370
362	3300042876	Ga0451577_0000223	Ga0451577_0000223_86255_87409	370
363	3300044712	Ga0453684_0000722	Ga0453684_0000722_86255_87409	370
364	3300046519	Ga0495632_0000004	Ga0495632_0000004_178429_179550	371
365	3300033180	Ga0307510_10005230	Ga0307510_1000523010	372
366	3300046507	Ga0495606_0043668	Ga0495606_0043668_1327_2460	372
367	3300046660	Ga0495625_0005535	Ga0495625_0005535_2537_3670	372
368	iso_pu_bacteria	2643221695	2644528982	372
369	iso_pu_bacteria	2919513703	2919516230	373
370	iso_pu_bacteria	2919675420	2919676925	373
371	iso_pu_bacteria	2895498888	2895498953	374
372	iso_pu_bacteria	2895522137	2895524942	374
373	iso_pu_bacteria	2894414249	2894415237	375
374	3300031548	Ga0307408_100190917	Ga0307408_1001909172	376
375	3300031824	Ga0307413_10080553	Ga0307413_100805532	376
376	3300031901	Ga0307406_10118240	Ga0307406_101182402	376
377	iso_pu_bacteria	8003014200	8003016223	376
378	3300006051	Ga0075364_10113853	Ga0075364_101138531	377
379	3300030742	Ga0316183_1029479	Ga0316183_10294791	377
380	3300041413	Ga0439465_0029514	Ga0439465_0029514_272_1462	377
381	3300042004	Ga0439445_0007409	Ga0439445_0007409_452_1642	377
382	3300042007	Ga0439449_0000069	Ga0439449_0000069_6926_8116	377
383	3300042007	Ga0439449_0002047	Ga0439449_0002047_1472_2605	377
384	3300049705	Ga0501225_0005742	Ga0501225_0005742_191_1342	377
385	3300050491	nmdc:mga00v17_43065_c1	nmdc:mga00v17_43065_c1_263_1411	377
386	3300050491	nmdc:mga00v17_48108_c1	nmdc:mga00v17_48108_c1_745_1893	377
387	3300031824	Ga0307413_10000718	Ga0307413_100007188	378
388	3300003775	Ga0055524_1004408	Ga0055524_10044085	379
389	3300003781	Ga0055536_1003816	Ga0055536_10038163	379
390	3300003781	Ga0055536_1015435	Ga0055536_10154352	379
391	3300003791	Ga0055530_10002491	Ga0055530_100024915	379
392	3300003794	Ga0055531_10004847	Ga0055531_100048473	379
393	3300003794	Ga0055531_10008966	Ga0055531_100089662	379
394	3300003794	Ga0055531_10012793	Ga0055531_100127932	379
395	3300005445	Ga0070708_100116784	Ga0070708_1001167842	379
396	3300025291	Ga0209675_1008691	Ga0209675_10086912	379
397	3300025292	Ga0209676_1001097	Ga0209676_100109716	379
398	3300025292	Ga0209676_1004172	Ga0209676_10041726	379
399	3300025294	Ga0209025_1001408	Ga0209025_100140822	379
400	3300025295	Ga0209564_1005424	Ga0209564_10054243	379
401	3300025298	Ga0209050_1001060	Ga0209050_100106014	379
402	3300025299	Ga0209256_1003717	Ga0209256_10037175	379
403	3300025303	Ga0209051_1008672	Ga0209051_10086722	379
404	3300025304	Ga0209257_1000283	Ga0209257_100028335	379
405	3300025304	Ga0209257_1005663	Ga0209257_10056634	379
406	3300025304	Ga0209257_1005877	Ga0209257_10058776	379
407	3300025304	Ga0209257_1008731	Ga0209257_10087313	379
408	3300038705	Ga0237819_00013	Ga0237819_00013_14111_15277	379
409	3300003781	Ga0055536_1001751	Ga0055536_10017514	380
410	3300003794	Ga0055531_10005009	Ga0055531_100050096	380
411	3300003794	Ga0055531_10011021	Ga0055531_100110214	380
412	3300003794	Ga0055531_10011065	Ga0055531_100110652	380
413	3300003794	Ga0055531_10014051	Ga0055531_100140514	380
414	3300025291	Ga0209675_1014152	Ga0209675_10141522	380
415	3300025292	Ga0209676_1001110	Ga0209676_100111020	380
416	3300025292	Ga0209676_1004330	Ga0209676_10043303	380
417	3300025292	Ga0209676_1004424	Ga0209676_10044243	380
418	3300025298	Ga0209050_1009770	Ga0209050_10097703	380
419	3300025299	Ga0209256_1001956	Ga0209256_100195615	380
420	3300025304	Ga0209257_1000255	Ga0209257_100025592	380
421	3300025304	Ga0209257_1003658	Ga0209257_10036589	380
422	3300049579	Ga0501043_0007450	Ga0501043_0007450_7407_8549	380
423	3300006237	Ga0097621_100053428	Ga0097621_1000534283	381
424	3300009551	Ga0105238_10037805	Ga0105238_100378053	381
425	3300025924	Ga0207694_10013114	Ga0207694_100131144	381
426	3300031824	Ga0307413_10000718	Ga0307413_100007187	382
427	iso_pu_bacteria	2643221573	2643878494	387
428	iso_pu_bacteria	2643221720	2644659802	387
429	3300046615	Ga0495656_0009765	Ga0495656_0009765_1986_3152	388
430	3300047318	Ga0495636_0012391	Ga0495636_0012391_1546_2712	388
431	iso_pu_bacteria	2643221586	2643941078	390
432	3300046460	Ga0495638_0036914	Ga0495638_0036914_1075_2262	392
433	iso_pu_bacteria	2643221559	2643818825	392
434	3300041406	Ga0439439_0011861	Ga0439439_0011861_617_1810	395
435	3300003187	JGI25151J46595_10015363	JGI25151J46595_100153632	397
436	3300025294	Ga0209025_1017654	Ga0209025_10176543	397
437	3300031548	Ga0307408_100043152	Ga0307408_1000431522	401
438	3300031901	Ga0307406_10058820	Ga0307406_100588202	403
439	3300041407	Ga0439447_000596	Ga0439447_000596_6682_7923	408
440	3300046616	Ga0495668_0003460	Ga0495668_0003460_1803_3044	408
441	iso_pu_bacteria	2643221593	2643975932	414
442	3300003187	JGI25151J46595_10000032	JGI25151J46595_10000032130	418
443	3300025245	Ga0207425_1004886	Ga0207425_10048862	418
444	3300025294	Ga0209025_1000005	Ga0209025_1000005162	418

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

76

304

0.94 PF01472

PUA

PUA domain

346

418

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2ako-assembly2.cif.gz_D	crystal structure of glutamate 5-kinase from campylobacter jejuni	0.9172	23	271
2ako-assembly2.cif.gz_D	crystal structure of glutamate 5-kinase from campylobacter jejuni	0.9062	23	271
2w21-assembly1.cif.gz_A-2	crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli.	0.9003	20	274
2w21-assembly1.cif.gz_A-2	crystal structure of the aminoacid kinase domain of the glutamate 5 kinase of escherichia coli.	0.8968	20	274
7v9a-assembly1.cif.gz_C	biogenesis module of human telomerase holoenzyme	0.8791	291	354

ID	Description	Score	Start	End	Superfamily
2j5tB02	Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain	0.9768	291	385	2.30.130.10
2j5tB02	Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain	0.9566	291	385	2.30.130.10
af_O13810_285_387_2.30.130.10	Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain	0.9497	284	385	2.30.130.10
af_Q54LB6_223_322_2.30.130.10	Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain	0.9376	285	385	2.30.130.10
af_P38690_314_419_2.30.130.10	Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain	0.9335	290	383	2.30.130.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2J1D516-F1-model_v4	deleted	0.9812	288	385
AF-A0A2M6ZVJ6-F1-model_v4	Glutamate 5-kinase	0.9751	274	385	GO:0003723 GO:0004349 GO:0005524 GO:0005829 GO:0006561
AF-X2JRI1-F1-model_v4	deleted	0.9705	277	385
AF-A0A376VPC5-F1-model_v4	Glutamate 5-kinase (EC 2.7.2.11)	0.9694	283	388	GO:0003723 GO:0004349 GO:0005524 GO:0005829 GO:0006561
AF-A0A534U6K2-F1-model_v4	Glutamate 5-kinase (EC 2.7.2.11)	0.9642	282	388	GO:0003723 GO:0004349 GO:0005524 GO:0005829 GO:0006561

Feature Viewer

pLDDT	pTM	Quality
84.63	0.77	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F445287

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00696

AA_kinase

Amino acid kinase family

76

304

0.94

PF01472

PUA

PUA domain

346

418

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map