F445190

General Info

Members Datasets Scaffolds Average Seq Length
443 287 886 262

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862281513|2862287807
Length 310
Sequence APRVPLRFAARFRTEKGVAYVTTRGLGSCASVSGGLRAVVKAVDAGSGRLYLAVAVGGFRRYATYRAATAAGIFTNTVFGLILVYTYTALWDQRPQLGGYELAQAVTYVWVGQSLFKTLANGGGGVEGELMERIRTGDIAVDLYRPADLQLWWLAADLGRSSFELLARGVPPFVLGALLFDLALPTDALTWLAFLVAVVLAMLVSFGIRYLVALSAFWLLDGTGVAQMVMFVGWFCSGMILPLNVFPGLLGEVVRALPWSALLQAPADVLLGEADPLGTYAFQAVWAVLLLAAGRLVQGMATRRVVVQGG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
49 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
54 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
55 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
56 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
57 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
58 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
72 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
73 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
74 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
75 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
76 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
77 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
78 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
79 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
124 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
214 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
215 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
216 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
217 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
218 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
224 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
225 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
226 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
227 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
228 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
229 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
230 2643221548 Streptomyces sp. Root55 Isolate Unclassified
231 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
232 2643221647 Streptomyces sp. Root369 Isolate Unclassified
233 2643221670 Streptomyces sp. Root431 Isolate Unclassified
234 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
235 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
236 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
237 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
238 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
239 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
240 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
241 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
242 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
243 2808606448 Streptomyces sp. 193411 Isolate Unclassified
244 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
245 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
246 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
247 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
248 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
249 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
250 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
251 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
252 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
253 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
254 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
255 2867369537 Streptomyces sp. Z26 Isolate Unclassified
256 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
257 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
258 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
259 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
260 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
261 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
262 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
263 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
264 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
265 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
266 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
267 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
268 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
269 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
270 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
271 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
272 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
273 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
274 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
275 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
276 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
277 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
278 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
279 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
280 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
281 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
282 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
283 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
284 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
285 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
286 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
287 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.1
Metatranscriptomes 0.23
Isolates 14.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.64
Nodule 0.45
Rhizoplane 6.77
Rhizosphere 75.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10020200 3300001989 Bacteria 2379
2 JGI24737J22298_10002194 3300001990 Bacteria 6958
3 rootH2_10039626 3300003320 Bacteria 3971
4 rootH2_10234439 3300003320 Bacteria 1123
5 rootL2_10116568 3300003322 Bacteria 4309
6 rootH1_10032102 3300003323 Bacteria 5559
7 JGI25160J50197_1003682 3300003354 Bacteria 6773
8 Ga0006562J51391_1109263 3300003578 Bacteria 8282
9 Ga0070682_100067044 3300005337 Bacteria 2285
10 Ga0070689_100343073 3300005340 Bacteria 1251
11 Ga0070668_100133139 3300005347 Bacteria 1997
12 Ga0070667_100019007 3300005367 Bacteria 5697
13 Ga0070709_10125399 3300005434 Bacteria 1746
14 Ga0070713_100140378 3300005436 Bacteria 2140
15 Ga0070698_100561672 3300005471 Bacteria 1081
16 Ga0070699_100110776 3300005518 Bacteria 2410
17 Ga0068856_100645555 3300005614 Bacteria 1079
18 Ga0068852_100369014 3300005616 Bacteria 1406
19 Ga0081455_10002734 3300005937 Bacteria 20806
20 Ga0075365_10183222 3300006038 Bacteria 1464
21 Ga0075368_10001870 3300006042 Bacteria 6761
22 Ga0075363_100004732 3300006048 Bacteria 5994
23 Ga0075363_100009251 3300006048 Bacteria 4628
24 Ga0075364_10010287 3300006051 Bacteria 5646
25 Ga0075364_10013390 3300006051 Bacteria 5040
26 Ga0075367_10032840 3300006178 Bacteria 2988
27 Ga0075370_10157947 3300006353 Bacteria 1330
28 Ga0075428_100063079 3300006844 Bacteria 4057
29 Ga0105251_10003022 3300009011 Bacteria 12546
30 Ga0105250_10045414 3300009092 Bacteria 1761
31 Ga0105245_10004191 3300009098 Bacteria 12802
32 Ga0114129_10054859 3300009147 Bacteria 5586
33 Ga0105238_10213265 3300009551 Bacteria 1907
34 Ga0105246_10151606 3300011119 Bacteria 1755
35 Ga0157372_10028325 3300013307 Bacteria 6113
36 Ga0157372_10293527 3300013307 Bacteria 1891
37 Ga0157372_10318337 3300013307 Bacteria 1811
38 Ga0157372_10558037 3300013307 Bacteria 1335
39 Ga0157375_10222060 3300013308 Bacteria 2048
40 Ga0182008_10080235 3300014497 Bacteria 1605
41 Ga0183367_1006 3300015688 Bacteria 648044
42 Ga0213875_10103874 3300021388 Bacteria 1326
43 Ga0207426_1005346 3300025302 Bacteria 5897
44 Ga0207426_1027992 3300025302 Bacteria 1871
45 Ga0207647_10035982 3300025904 Bacteria 3149
46 Ga0207699_10157020 3300025906 Bacteria 1511
47 Ga0207694_10160089 3300025924 Bacteria 1818
48 Ga0207691_10362044 3300025940 Bacteria 1240
49 Ga0207668_10281141 3300025972 Bacteria 1365
50 Ga0207658_10090184 3300025986 Bacteria 2375
51 Ga0207658_10278632 3300025986 Bacteria 1433
52 Ga0207678_10121223 3300026067 Bacteria 2232
53 Ga0207702_10621337 3300026078 Bacteria 1061
54 Ga0207674_10195707 3300026116 Bacteria 1971
55 Ga0209371_1011726 3300027312 Bacteria 2582
56 Ga0307517_10024558 3300028786 Bacteria 7417
57 Ga0307515_10032697 3300028794 Bacteria 8601
58 Ga0307515_10214382 3300028794 Bacteria 1760
59 Ga0307515_10306886 3300028794 Bacteria 1266
60 Ga0268256_1013526 3300030500 Bacteria 2466
61 Ga0307511_10001229 3300030521 Bacteria 27154
62 Ga0307511_10123057 3300030521 Bacteria 1595
63 Ga0307513_10015735 3300031456 Bacteria 9156
64 Ga0307509_10029413 3300031507 Bacteria 6098
65 Ga0307509_10124790 3300031507 Bacteria 2543
66 Ga0307508_10006583 3300031616 Bacteria 10909
67 Ga0307508_10120513 3300031616 Bacteria 2225
68 Ga0307508_10321993 3300031616 Bacteria 1138
69 Ga0307514_10102562 3300031649 Bacteria 2050
70 Ga0307516_10006276 3300031730 Bacteria 13973
71 Ga0307516_10022837 3300031730 Bacteria 6421
72 Ga0307518_10193457 3300031838 Bacteria 1360
73 Ga0307518_10281957 3300031838 Bacteria 1027
74 Ga0307410_10070801 3300031852 Bacteria 2417
75 Ga0307412_10517835 3300031911 Bacteria 996
76 Ga0307409_100233100 3300031995 Bacteria 1670
77 Ga0307414_10304502 3300032004 Bacteria 1350
78 Ga0307507_10022380 3300033179 Bacteria 6983
79 Ga0307507_10220776 3300033179 Bacteria 1274
80 Ga0307510_10037031 3300033180 Bacteria 5421
81 Ga0436364_0847955 3300037853 Bacteria 10877
82 Ga0395901_0553963 3300038443 Bacteria 1165
83 Ga0439439_0001029 3300041406 Bacteria 5255
84 Ga0439439_0001604 3300041406 Bacteria 4565
85 Ga0451853_0139085 3300041512 Bacteria 4147
86 Ga0439433_0014510 3300041999 Bacteria 1735
87 Ga0439449_0026238 3300042007 Bacteria 2174
88 Ga0439455_0000400 3300042012 Bacteria 5740
89 Ga0439457_000407 3300042014 Bacteria 12286
90 Ga0439457_000984 3300042014 Bacteria 8566
91 Ga0439457_007438 3300042014 Bacteria 2627
92 Ga0439462_0024615 3300042015 Bacteria 1582
93 Ga0450894_000626 3300042131 Bacteria 5942
94 Ga0450898_001412 3300042134 Bacteria 3158
95 Ga0450899_000281 3300042135 Bacteria 5527
96 Ga0450903_000188 3300042138 Bacteria 13674
97 Ga0450906_006130 3300042145 Bacteria 2437
98 Ga0450908_003756 3300042184 Bacteria 2941
99 Ga0466969_0001153 3300044656 Bacteria 14228
100 Ga0466972_0003966 3300044658 Bacteria 7375
101 Ga0466972_0034097 3300044658 Bacteria 2496
102 Ga0466965_0047045 3300044683 Bacteria 2136
103 Ga0466966_0002049 3300044684 Bacteria 13087
104 Ga0466966_0032135 3300044684 Bacteria 3403
105 Ga0466961_0001282 3300044693 Bacteria 15475
106 Ga0466961_0002381 3300044693 Bacteria 11678
107 Ga0466961_0174061 3300044693 Bacteria 1338
108 Ga0466963_0042859 3300044694 Bacteria 2973
109 Ga0466963_0274210 3300044694 Bacteria 1185
110 Ga0466964_0009675 3300044706 Bacteria 3632
111 Ga0466971_0000390 3300044719 Bacteria 16952
112 Ga0466971_0013271 3300044719 Bacteria 3616
113 Ga0466971_0173956 3300044719 Bacteria 1011
114 Ga0466968_0003347 3300044735 Bacteria 5923
115 Ga0466970_0036424 3300044765 Bacteria 2606
116 Ga0466957_0084492 3300044842 Bacteria 1981
117 Ga0466959_0035951 3300045049 Bacteria 3660
118 Ga0466959_0043109 3300045049 Bacteria 3328
119 Ga0466958_0025766 3300045836 Bacteria 3470
120 Ga0466958_0138916 3300045836 Bacteria 1529
121 Ga0466967_0063181 3300045976 Bacteria 3289
122 Ga0466967_0071358 3300045976 Bacteria 3109
123 Ga0495617_058122 3300046452 Bacteria 1281
124 Ga0495627_015751 3300046453 Bacteria 2605
125 Ga0495627_048964 3300046453 Bacteria 1277
126 Ga0495592_0016849 3300046454 Bacteria 5549
127 Ga0495592_0109868 3300046454 Bacteria 1952
128 Ga0495603_0006806 3300046455 Bacteria 6856
129 Ga0495603_0013344 3300046455 Bacteria 4970
130 Ga0495603_0019677 3300046455 Bacteria 4087
131 Ga0495590_0035506 3300046457 Bacteria 1740
132 Ga0495629_0003305 3300046459 Bacteria 12181
133 Ga0495629_0024512 3300046459 Bacteria 4296
134 Ga0495629_0038602 3300046459 Bacteria 3363
135 Ga0495629_0159973 3300046459 Bacteria 1564
136 Ga0495638_0013816 3300046460 Bacteria 5482
137 Ga0495638_0124387 3300046460 Bacteria 1521
138 Ga0495651_0004255 3300046462 Bacteria 10975
139 Ga0495651_0036246 3300046462 Bacteria 3840
140 Ga0495605_0004512 3300046474 Bacteria 8155
141 Ga0495605_0042632 3300046474 Bacteria 2254
142 Ga0495662_0009566 3300046476 Bacteria 4752
143 Ga0495662_0010324 3300046476 Bacteria 4576
144 Ga0495662_0012653 3300046476 Bacteria 4114
145 Ga0495662_0112038 3300046476 Bacteria 1337
146 Ga0495662_0163965 3300046476 Bacteria 1095
147 Ga0495664_0003874 3300046477 Bacteria 8163
148 Ga0495585_0039000 3300046492 Bacteria 2672
149 Ga0495585_0110600 3300046492 Bacteria 1461
150 Ga0495594_0019368 3300046499 Bacteria 3615
151 Ga0495596_0026048 3300046500 Bacteria 2359
152 Ga0495583_0011011 3300046506 Bacteria 5216
153 Ga0495583_0062532 3300046506 Bacteria 1657
154 Ga0495606_0012056 3300046507 Bacteria 6975
155 Ga0495608_0116107 3300046511 Bacteria 1718
156 Ga0495610_0016927 3300046512 Bacteria 4175
157 Ga0495618_0180781 3300046514 Bacteria 1340
158 Ga0495620_0006445 3300046515 Bacteria 6448
159 Ga0495620_0018593 3300046515 Bacteria 3438
160 Ga0495620_0092012 3300046515 Bacteria 1216
161 Ga0495628_0020121 3300046516 Bacteria 5508
162 Ga0495628_0040829 3300046516 Bacteria 3706
163 Ga0495628_0101066 3300046516 Bacteria 2225
164 Ga0495630_0102805 3300046517 Bacteria 2162
165 Ga0495631_0099704 3300046518 Bacteria 1250
166 Ga0495632_0076734 3300046519 Bacteria 1598
167 Ga0495637_0020457 3300046520 Bacteria 3045
168 Ga0495648_0015858 3300046524 Bacteria 5447
169 Ga0495648_0020066 3300046524 Bacteria 4675
170 Ga0495666_0110904 3300046526 Bacteria 1288
171 Ga0495642_0033304 3300046528 Bacteria 2072
172 Ga0495652_0001620 3300046529 Bacteria 24570
173 Ga0495652_0028950 3300046529 Bacteria 4867
174 Ga0495652_0113651 3300046529 Bacteria 2173
175 Ga0495640_0007544 3300046533 Bacteria 8546
176 Ga0495640_0011237 3300046533 Bacteria 6893
177 Ga0495640_0017819 3300046533 Bacteria 5283
178 Ga0495640_0050044 3300046533 Bacteria 2880
179 Ga0495586_0041338 3300046535 Bacteria 2483
180 Ga0495586_0051395 3300046535 Bacteria 2231
181 Ga0495586_0195845 3300046535 Bacteria 1145
182 Ga0495587_0006682 3300046536 Bacteria 7512
183 Ga0495587_0146261 3300046536 Bacteria 1348
184 Ga0495597_0026970 3300046542 Bacteria 2637
185 Ga0495645_0126767 3300046543 Bacteria 1793
186 Ga0495622_0011156 3300046557 Bacteria 4149
187 Ga0495633_0132796 3300046558 Bacteria 1152
188 Ga0495667_0032061 3300046559 Bacteria 3524
189 Ga0495667_0067910 3300046559 Bacteria 2329
190 Ga0495667_0160802 3300046559 Bacteria 1445
191 Ga0495668_0011353 3300046616 Bacteria 5339
192 Ga0495668_0028699 3300046616 Bacteria 3146
193 Ga0495634_0003293 3300046642 Bacteria 13023
194 Ga0495634_0017275 3300046642 Bacteria 5151
195 Ga0495634_0114494 3300046642 Bacteria 1731
196 Ga0495625_0007831 3300046660 Bacteria 9210
197 Ga0495625_0010681 3300046660 Bacteria 7566
198 Ga0495625_0088133 3300046660 Bacteria 2150
199 Ga0495625_0252007 3300046660 Bacteria 1146
200 Ga0495635_0007997 3300046663 Bacteria 7389
201 Ga0495635_0031939 3300046663 Bacteria 3654
202 Ga0495635_0038382 3300046663 Bacteria 3316
203 Ga0495588_0001776 3300046674 Bacteria 9184
204 Ga0495588_0005095 3300046674 Bacteria 5839
205 Ga0495657_0004313 3300046675 Bacteria 11354
206 Ga0495657_0007690 3300046675 Bacteria 8297
207 Ga0495657_0020084 3300046675 Bacteria 4807
208 Ga0495657_0182261 3300046675 Bacteria 1288
209 Ga0495623_0007397 3300046679 Bacteria 7130
210 Ga0495646_0005855 3300046680 Bacteria 7796
211 Ga0495646_0039975 3300046680 Bacteria 2890
212 Ga0495646_0215779 3300046680 Bacteria 1039
213 Ga0495613_0002721 3300046689 Bacteria 13263
214 Ga0495613_0007698 3300046689 Bacteria 8012
215 Ga0495613_0033173 3300046689 Bacteria 3836
216 Ga0495613_0059153 3300046689 Bacteria 2810
217 Ga0495613_0091698 3300046689 Bacteria 2200
218 Ga0495624_0039992 3300046690 Bacteria 3005
219 Ga0495670_0021578 3300046691 Bacteria 3177
220 Ga0495671_0037126 3300046692 Bacteria 2465
221 Ga0495671_0046072 3300046692 Bacteria 2181
222 Ga0495649_0017018 3300046694 Bacteria 4113
223 Ga0495649_0035895 3300046694 Bacteria 2725
224 Ga0495649_0136561 3300046694 Bacteria 1292
225 Ga0495589_0007178 3300046794 Bacteria 5837
226 Ga0495589_0073322 3300046794 Bacteria 1671
227 Ga0495589_0150745 3300046794 Bacteria 1110
228 Ga0495600_0035992 3300046809 Bacteria 3217
229 Ga0495600_0083962 3300046809 Bacteria 2078
230 Ga0495600_0102178 3300046809 Bacteria 1868
231 Ga0495600_0114195 3300046809 Bacteria 1758
232 Ga0495600_0191625 3300046809 Bacteria 1314
233 Ga0495600_0343057 3300046809 Bacteria 936
234 Ga0495660_0030512 3300046810 Bacteria 3036
235 Ga0495581_0142722 3300047315 Bacteria 1397
236 Ga0495581_0267991 3300047315 Bacteria 999
237 Ga0495604_0001475 3300047317 Bacteria 19376
238 Ga0495604_0009368 3300047317 Bacteria 7746
239 Ga0495636_0003842 3300047318 Bacteria 5856
240 Ga0495636_0004020 3300047318 Bacteria 5748
241 Ga0495636_0011064 3300047318 Bacteria 3570
242 Ga0495636_0021519 3300047318 Bacteria 2604
243 Ga0495636_0040547 3300047318 Bacteria 1930
244 Ga0495676_0004973 3300047321 Bacteria 12190
245 Ga0495676_0011881 3300047321 Bacteria 7855
246 Ga0495676_0015672 3300047321 Bacteria 6740
247 Ga0495676_0035886 3300047321 Bacteria 4144
248 Ga0495676_0054109 3300047321 Bacteria 3192
249 Ga0495676_0151982 3300047321 Bacteria 1646
250 Ga0495680_0010306 3300047322 Bacteria 8337
251 Ga0495683_0154699 3300047323 Bacteria 1064
252 Ga0495687_002108 3300047443 Bacteria 16679
253 Ga0495687_003978 3300047443 Bacteria 10308
254 Ga0495675_0016735 3300047444 Bacteria 4637
255 Ga0495675_0026214 3300047444 Bacteria 3717
256 Ga0495675_0112797 3300047444 Bacteria 1696
257 Ga0495677_0017250 3300047445 Bacteria 2618
258 Ga0495685_000621 3300047447 Bacteria 10839
259 Ga0495685_002257 3300047447 Bacteria 6007
260 Ga0495685_013205 3300047447 Bacteria 2802
261 Ga0495685_016663 3300047447 Bacteria 2512
262 Ga0495681_0017233 3300047470 Bacteria 4020
263 Ga0495681_0025448 3300047470 Bacteria 3096
264 Ga0495681_0077583 3300047470 Bacteria 1490
265 Ga0495686_0018403 3300047472 Bacteria 4689
266 Ga0495593_0002888 3300047673 Bacteria 10358
267 Ga0495602_0020104 3300048088 Bacteria 6604
268 Ga0495602_0212705 3300048088 Bacteria 1466
269 Ga0495614_0000230 3300048089 Bacteria 21721
270 Ga0495614_0031608 3300048089 Bacteria 2278
271 Ga0495614_0032644 3300048089 Bacteria 2240
272 Ga0495614_0057334 3300048089 Bacteria 1672
273 Ga0495614_0182053 3300048089 Bacteria 945
274 Ga0495626_0013113 3300048091 Bacteria 4317
275 Ga0496100_0136692 3300048903 Bacteria 1732
276 Ga0496101_0028407 3300048904 Bacteria 3904
277 Ga0496101_0191204 3300048904 Bacteria 1580
278 Ga0496102_0020974 3300048905 Bacteria 5777
279 Ga0496102_0754631 3300048905 Bacteria 896
280 Ga0496104_0015775 3300048907 Bacteria 6852
281 Ga0496106_0022624 3300048909 Bacteria 4672
282 Ga0496106_0057553 3300048909 Bacteria 2940
283 Ga0496107_0013014 3300048910 Bacteria 5813
284 Ga0496107_0035168 3300048910 Bacteria 3591
285 Ga0496108_0136799 3300048911 Bacteria 2108
286 Ga0496108_0141589 3300048911 Bacteria 2072
287 Ga0496108_0148232 3300048911 Bacteria 2024
288 Ga0496108_0150267 3300048911 Bacteria 2009
289 Ga0496109_0018585 3300048912 Bacteria 6107
290 Ga0496109_0141542 3300048912 Bacteria 2249
291 Ga0496109_0207037 3300048912 Bacteria 1844
292 Ga0496110_0038395 3300048913 Bacteria 4167
293 Ga0496110_0050032 3300048913 Bacteria 3669
294 Ga0496111_0089223 3300048914 Bacteria 2258
295 Ga0496112_0072606 3300048915 Bacteria 3402
296 Ga0496112_0284030 3300048915 Bacteria 1602
297 Ga0496113_0260079 3300048916 Bacteria 1386
298 Ga0496114_0005146 3300048917 Bacteria 10200
299 Ga0496114_0020736 3300048917 Bacteria 5335
300 Ga0496114_0030680 3300048917 Bacteria 4423
301 Ga0496114_0597058 3300048917 Bacteria 974
302 Ga0496115_0029289 3300048918 Bacteria 4323
303 Ga0496115_0565614 3300048918 Bacteria 907
304 Ga0501031_0053690 3300049568 Bacteria 2626
305 Ga0501032_0000872 3300049569 Bacteria 24521
306 Ga0501032_0055272 3300049569 Bacteria 2670
307 Ga0501033_0004555 3300049570 Bacteria 11096
308 Ga0501033_0010098 3300049570 Bacteria 7245
309 Ga0501033_0090202 3300049570 Bacteria 2242
310 Ga0501034_0003126 3300049571 Bacteria 19067
311 Ga0501034_0006032 3300049571 Bacteria 13097
312 Ga0501036_0001596 3300049572 Bacteria 17545
313 Ga0501037_0001427 3300049573 Bacteria 17526
314 Ga0501038_0001097 3300049574 Bacteria 24498
315 Ga0501038_0010363 3300049574 Bacteria 8528
316 Ga0501039_0011902 3300049575 Bacteria 6630
317 Ga0501040_0031583 3300049576 Bacteria 3580
318 Ga0501043_0000785 3300049579 Bacteria 28257
319 Ga0501043_0009599 3300049579 Bacteria 7581
320 Ga0501043_0144268 3300049579 Bacteria 1864
321 Ga0501046_0003286 3300049580 Bacteria 14854
322 Ga0501046_0168502 3300049580 Bacteria 1645
323 Ga0501047_0002504 3300049581 Bacteria 17509
324 Ga0501047_0003586 3300049581 Bacteria 14645
325 Ga0501047_0190055 3300049581 Bacteria 1917
326 Ga0501048_0004360 3300049582 Bacteria 10770
327 Ga0501067_0003477 3300049583 Bacteria 8656
328 Ga0501068_0003083 3300049584 Bacteria 8901
329 Ga0501070_0021829 3300049586 Bacteria 5364
330 Ga0501070_0270724 3300049586 Bacteria 1387
331 Ga0501070_0321091 3300049586 Bacteria 1259
332 Ga0501070_0543456 3300049586 Bacteria 931
333 Ga0501071_0001127 3300049587 Bacteria 14926
334 Ga0501073_0015148 3300049589 Bacteria 5592
335 Ga0501074_0013626 3300049590 Bacteria 5909
336 Ga0501077_0016294 3300049593 Bacteria 4683
337 Ga0501235_034497 3300049669 Bacteria 1148
338 Ga0501080_0025359 3300049742 Bacteria 5501
339 Ga0501083_0005707 3300049744 Bacteria 8808
340 Ga0501035_0002996 3300049822 Bacteria 16216
341 Ga0501035_0012083 3300049822 Bacteria 7983
342 Ga0501035_0015459 3300049822 Bacteria 7040
343 Ga0501035_0020910 3300049822 Bacteria 6014
344 Ga0501035_0060439 3300049822 Bacteria 3373
345 Ga0501044_0000976 3300049823 Bacteria 34361
346 Ga0501044_0002584 3300049823 Bacteria 20601
347 Ga0501044_0029299 3300049823 Bacteria 5805
348 Ga0501044_0239500 3300049823 Bacteria 1758
349 Ga0501044_0470573 3300049823 Bacteria 1161
350 Ga0501045_0460855 3300049824 Bacteria 945
351 nmdc:mga03n38_120686_c1 3300050490 Bacteria 1288
352 nmdc:mga0yw44_19618_c1 3300050492 Bacteria 3732
353 nmdc:mga0yw44_286866_c1 3300050492 Bacteria 1101
354 nmdc:mga06z11_26229_c1 3300050494 Bacteria 2771
355 nmdc:mga07m45_19873_c1 3300050496 Bacteria 1334
356 nmdc:mga05p37_207282_c1 3300050507 Bacteria 2371
357 nmdc:mga09592_131741_c1 3300050508 Bacteria 2152
358 nmdc:mga0qj67_62322_c1 3300050509 Bacteria 1357
359 nmdc:mga06r32_131428_c1 3300050510 Bacteria 2476
360 Ga0495601_0126671 3300053077 Bacteria 1661
361 Ga0495601_0179535 3300053077 Bacteria 1384
362 Ga0495612_0043433 3300053078 Bacteria 1836
363 Ga0495619_0111558 3300053085 Bacteria 1869
364 Ga0495619_0156388 3300053085 Bacteria 1573
365 Ga0500583_0078348 3300053092 Bacteria 1593
366 Ga0500560_002613 3300053107 Bacteria 3482
367 Ga0500614_014130 3300053123 Bacteria 1764
368 Ga0500573_0060994 3300053140 Bacteria 2160
369 Ga0500573_0119107 3300053140 Bacteria 1471
370 Ga0500574_022681 3300053141 Bacteria 1607
371 Ga0500600_0107031 3300053149 Bacteria 1465
372 Ga0500600_0140547 3300053149 Bacteria 1216
373 Ga0500600_0168675 3300053149 Bacteria 1067
374 Ga0501084_0003883 3300054114 Bacteria 12160
375 Ga0501082_0047873 3300060353 Bacteria 3684
376 Ga0466962_0000359 3300061719 Bacteria 19575
377 Ga0466962_0087597 3300061719 Bacteria 1491
378 Ga0530510_0113542 3300061734 Bacteria 1985
379 2862287807 2862281513 Bacteria 9621493
380 2515854321 2515154155 Bacteria 7985436
381 2547407110 2547132111 Bacteria 8013147
382 2585309932 2582581313 Bacteria 10042643
383 2585315750 2582581314 Bacteria 11452267
384 2616697507 2616644814 Bacteria 11555299
385 2616900369 2616644941 Bacteria 8510691
386 2643765393 2643221548 Bacteria 8053412
387 2643944440 2643221587 Bacteria 7586415
388 2644264559 2643221647 Bacteria 10741251
389 2644385628 2643221670 Bacteria 6497041
390 2644431338 2643221677 Bacteria 7584031
391 2644462536 2643221682 Bacteria 6743283
392 2676476671 2675903058 Bacteria 6822861
393 2784588163 2784132148 Bacteria 8627943
394 2785343902 2784746763 Bacteria 9783172
395 2785368932 2784746768 Bacteria 10036182
396 2786670109 2786546132 Bacteria 10419719
397 2793977133 2791355406 Bacteria 11364898
398 2804847571 2802429296 Bacteria 7227771
399 2809231775 2808606448 Bacteria 8656184
400 2811848533 2808606982 Bacteria 7791042
401 2812480987 2811994917 Bacteria 7761064
402 2816426786 2816332119 Bacteria 8120218
403 2819693394 2818991463 Bacteria 7948711
404 2827630242 2827628540 Bacteria 6858585
405 2862184644 2862178590 Bacteria 8583590
406 2862293232 2862290372 Bacteria 7471434
407 2862390002 2862382967 Bacteria 10317375
408 2862708850 2862705112 Bacteria 6563286
409 2863405188 2863404153 Bacteria 9672205
410 2867348468 2867346516 Bacteria 7608576
411 2867371462 2867369537 Bacteria 6501581
412 2873156234 2873151551 Bacteria 8625867
413 2912720537 2912715099 Bacteria 9460473
414 2912760180 2912757875 Bacteria 7940295
415 2946050534 2946045630 Bacteria 8527308
416 2947230030 2947224130 Bacteria 9938529
417 2954386728 2954380949 Bacteria 10050426
418 2954676444 2954673503 Bacteria 9685905
419 2954687723 2954682443 Bacteria 9862841
420 2954697543 2954691527 Bacteria 10720516
421 2954704664 2954701450 Bacteria 10834262
422 2954716704 2954711539 Bacteria 10867210
423 2954726651 2954721474 Bacteria 10456478
424 2954735144 2954731030 Bacteria 10243860
425 2954745573 2954740390 Bacteria 10229294
426 2954754015 2954749733 Bacteria 10366972
427 2954764548 2954759201 Bacteria 9358192
428 2990062869 2990059506 Bacteria 9321252
429 2997601706 2997600082 Bacteria 9896405
430 3003003349 3002998708 Bacteria 11715108
431 3006321667 3006321560 Bacteria 8247479
432 3006492605 3006486233 Bacteria 8157040
433 3006496460 3006493962 Bacteria 8825450
434 8008559876 8008558824 Bacteria 10610750
435 8023631393 8023623736 Bacteria 8593882
436 8025417371 8025413630 Bacteria 7014048
437 8025533167 8025530807 Bacteria 8495698
438 8047898561 8047893842 Bacteria 11723082
439 8048132779 8048127548 Bacteria 11053136
440 8048360358 8048356638 Bacteria 11044339
441 8048375523 8048369669 Bacteria 11666822
442 8048382682 8048379754 Bacteria 11877923
443 8048413221 8048406513 Bacteria 8936924
444 JGI24739J22299_10020200
445 JGI24737J22298_10002194
446 rootH2_10039626
447 rootH2_10234439
448 rootL2_10116568
449 rootH1_10032102
450 JGI25160J50197_1003682
451 Ga0006562J51391_1109263
452 Ga0070682_100067044
453 Ga0070689_100343073
454 Ga0070668_100133139
455 Ga0070667_100019007
456 Ga0070709_10125399
457 Ga0070713_100140378
458 Ga0070698_100561672
459 Ga0070699_100110776
460 Ga0068856_100645555
461 Ga0068852_100369014
462 Ga0081455_10002734
463 Ga0075365_10183222
464 Ga0075368_10001870
465 Ga0075363_100004732
466 Ga0075363_100009251
467 Ga0075364_10010287
468 Ga0075364_10013390
469 Ga0075367_10032840
470 Ga0075370_10157947
471 Ga0075428_100063079
472 Ga0105251_10003022
473 Ga0105250_10045414
474 Ga0105245_10004191
475 Ga0114129_10054859
476 Ga0105238_10213265
477 Ga0105246_10151606
478 Ga0157372_10028325
479 Ga0157372_10293527
480 Ga0157372_10318337
481 Ga0157372_10558037
482 Ga0157375_10222060
483 Ga0182008_10080235
484 Ga0183367_1006
485 Ga0213875_10103874
486 Ga0207426_1005346
487 Ga0207426_1027992
488 Ga0207647_10035982
489 Ga0207699_10157020
490 Ga0207694_10160089
491 Ga0207691_10362044
492 Ga0207668_10281141
493 Ga0207658_10090184
494 Ga0207658_10278632
495 Ga0207678_10121223
496 Ga0207702_10621337
497 Ga0207674_10195707
498 Ga0209371_1011726
499 Ga0307517_10024558
500 Ga0307515_10032697
501 Ga0307515_10214382
502 Ga0307515_10306886
503 Ga0268256_1013526
504 Ga0307511_10001229
505 Ga0307511_10123057
506 Ga0307513_10015735
507 Ga0307509_10029413
508 Ga0307509_10124790
509 Ga0307508_10006583
510 Ga0307508_10120513
511 Ga0307508_10321993
512 Ga0307514_10102562
513 Ga0307516_10006276
514 Ga0307516_10022837
515 Ga0307518_10193457
516 Ga0307518_10281957
517 Ga0307410_10070801
518 Ga0307412_10517835
519 Ga0307409_100233100
520 Ga0307414_10304502
521 Ga0307507_10022380
522 Ga0307507_10220776
523 Ga0307510_10037031
524 Ga0436364_0847955
525 Ga0395901_0553963
526 Ga0439439_0001029
527 Ga0439439_0001604
528 Ga0451853_0139085
529 Ga0439433_0014510
530 Ga0439449_0026238
531 Ga0439455_0000400
532 Ga0439457_000407
533 Ga0439457_000984
534 Ga0439457_007438
535 Ga0439462_0024615
536 Ga0450894_000626
537 Ga0450898_001412
538 Ga0450899_000281
539 Ga0450903_000188
540 Ga0450906_006130
541 Ga0450908_003756
542 Ga0466969_0001153
543 Ga0466972_0003966
544 Ga0466972_0034097
545 Ga0466965_0047045
546 Ga0466966_0002049
547 Ga0466966_0032135
548 Ga0466961_0001282
549 Ga0466961_0002381
550 Ga0466961_0174061
551 Ga0466963_0042859
552 Ga0466963_0274210
553 Ga0466964_0009675
554 Ga0466971_0000390
555 Ga0466971_0013271
556 Ga0466971_0173956
557 Ga0466968_0003347
558 Ga0466970_0036424
559 Ga0466957_0084492
560 Ga0466959_0035951
561 Ga0466959_0043109
562 Ga0466958_0025766
563 Ga0466958_0138916
564 Ga0466967_0063181
565 Ga0466967_0071358
566 Ga0495617_058122
567 Ga0495627_015751
568 Ga0495627_048964
569 Ga0495592_0016849
570 Ga0495592_0109868
571 Ga0495603_0006806
572 Ga0495603_0013344
573 Ga0495603_0019677
574 Ga0495590_0035506
575 Ga0495629_0003305
576 Ga0495629_0024512
577 Ga0495629_0038602
578 Ga0495629_0159973
579 Ga0495638_0013816
580 Ga0495638_0124387
581 Ga0495651_0004255
582 Ga0495651_0036246
583 Ga0495605_0004512
584 Ga0495605_0042632
585 Ga0495662_0009566
586 Ga0495662_0010324
587 Ga0495662_0012653
588 Ga0495662_0112038
589 Ga0495662_0163965
590 Ga0495664_0003874
591 Ga0495585_0039000
592 Ga0495585_0110600
593 Ga0495594_0019368
594 Ga0495596_0026048
595 Ga0495583_0011011
596 Ga0495583_0062532
597 Ga0495606_0012056
598 Ga0495608_0116107
599 Ga0495610_0016927
600 Ga0495618_0180781
601 Ga0495620_0006445
602 Ga0495620_0018593
603 Ga0495620_0092012
604 Ga0495628_0020121
605 Ga0495628_0040829
606 Ga0495628_0101066
607 Ga0495630_0102805
608 Ga0495631_0099704
609 Ga0495632_0076734
610 Ga0495637_0020457
611 Ga0495648_0015858
612 Ga0495648_0020066
613 Ga0495666_0110904
614 Ga0495642_0033304
615 Ga0495652_0001620
616 Ga0495652_0028950
617 Ga0495652_0113651
618 Ga0495640_0007544
619 Ga0495640_0011237
620 Ga0495640_0017819
621 Ga0495640_0050044
622 Ga0495586_0041338
623 Ga0495586_0051395
624 Ga0495586_0195845
625 Ga0495587_0006682
626 Ga0495587_0146261
627 Ga0495597_0026970
628 Ga0495645_0126767
629 Ga0495622_0011156
630 Ga0495633_0132796
631 Ga0495667_0032061
632 Ga0495667_0067910
633 Ga0495667_0160802
634 Ga0495668_0011353
635 Ga0495668_0028699
636 Ga0495634_0003293
637 Ga0495634_0017275
638 Ga0495634_0114494
639 Ga0495625_0007831
640 Ga0495625_0010681
641 Ga0495625_0088133
642 Ga0495625_0252007
643 Ga0495635_0007997
644 Ga0495635_0031939
645 Ga0495635_0038382
646 Ga0495588_0001776
647 Ga0495588_0005095
648 Ga0495657_0004313
649 Ga0495657_0007690
650 Ga0495657_0020084
651 Ga0495657_0182261
652 Ga0495623_0007397
653 Ga0495646_0005855
654 Ga0495646_0039975
655 Ga0495646_0215779
656 Ga0495613_0002721
657 Ga0495613_0007698
658 Ga0495613_0033173
659 Ga0495613_0059153
660 Ga0495613_0091698
661 Ga0495624_0039992
662 Ga0495670_0021578
663 Ga0495671_0037126
664 Ga0495671_0046072
665 Ga0495649_0017018
666 Ga0495649_0035895
667 Ga0495649_0136561
668 Ga0495589_0007178
669 Ga0495589_0073322
670 Ga0495589_0150745
671 Ga0495600_0035992
672 Ga0495600_0083962
673 Ga0495600_0102178
674 Ga0495600_0114195
675 Ga0495600_0191625
676 Ga0495600_0343057
677 Ga0495660_0030512
678 Ga0495581_0142722
679 Ga0495581_0267991
680 Ga0495604_0001475
681 Ga0495604_0009368
682 Ga0495636_0003842
683 Ga0495636_0004020
684 Ga0495636_0011064
685 Ga0495636_0021519
686 Ga0495636_0040547
687 Ga0495676_0004973
688 Ga0495676_0011881
689 Ga0495676_0015672
690 Ga0495676_0035886
691 Ga0495676_0054109
692 Ga0495676_0151982
693 Ga0495680_0010306
694 Ga0495683_0154699
695 Ga0495687_002108
696 Ga0495687_003978
697 Ga0495675_0016735
698 Ga0495675_0026214
699 Ga0495675_0112797
700 Ga0495677_0017250
701 Ga0495685_000621
702 Ga0495685_002257
703 Ga0495685_013205
704 Ga0495685_016663
705 Ga0495681_0017233
706 Ga0495681_0025448
707 Ga0495681_0077583
708 Ga0495686_0018403
709 Ga0495593_0002888
710 Ga0495602_0020104
711 Ga0495602_0212705
712 Ga0495614_0000230
713 Ga0495614_0031608
714 Ga0495614_0032644
715 Ga0495614_0057334
716 Ga0495614_0182053
717 Ga0495626_0013113
718 Ga0496100_0136692
719 Ga0496101_0028407
720 Ga0496101_0191204
721 Ga0496102_0020974
722 Ga0496102_0754631
723 Ga0496104_0015775
724 Ga0496106_0022624
725 Ga0496106_0057553
726 Ga0496107_0013014
727 Ga0496107_0035168
728 Ga0496108_0136799
729 Ga0496108_0141589
730 Ga0496108_0148232
731 Ga0496108_0150267
732 Ga0496109_0018585
733 Ga0496109_0141542
734 Ga0496109_0207037
735 Ga0496110_0038395
736 Ga0496110_0050032
737 Ga0496111_0089223
738 Ga0496112_0072606
739 Ga0496112_0284030
740 Ga0496113_0260079
741 Ga0496114_0005146
742 Ga0496114_0020736
743 Ga0496114_0030680
744 Ga0496114_0597058
745 Ga0496115_0029289
746 Ga0496115_0565614
747 Ga0501031_0053690
748 Ga0501032_0000872
749 Ga0501032_0055272
750 Ga0501033_0004555
751 Ga0501033_0010098
752 Ga0501033_0090202
753 Ga0501034_0003126
754 Ga0501034_0006032
755 Ga0501036_0001596
756 Ga0501037_0001427
757 Ga0501038_0001097
758 Ga0501038_0010363
759 Ga0501039_0011902
760 Ga0501040_0031583
761 Ga0501043_0000785
762 Ga0501043_0009599
763 Ga0501043_0144268
764 Ga0501046_0003286
765 Ga0501046_0168502
766 Ga0501047_0002504
767 Ga0501047_0003586
768 Ga0501047_0190055
769 Ga0501048_0004360
770 Ga0501067_0003477
771 Ga0501068_0003083
772 Ga0501070_0021829
773 Ga0501070_0270724
774 Ga0501070_0321091
775 Ga0501070_0543456
776 Ga0501071_0001127
777 Ga0501073_0015148
778 Ga0501074_0013626
779 Ga0501077_0016294
780 Ga0501235_034497
781 Ga0501080_0025359
782 Ga0501083_0005707
783 Ga0501035_0002996
784 Ga0501035_0012083
785 Ga0501035_0015459
786 Ga0501035_0020910
787 Ga0501035_0060439
788 Ga0501044_0000976
789 Ga0501044_0002584
790 Ga0501044_0029299
791 Ga0501044_0239500
792 Ga0501044_0470573
793 Ga0501045_0460855
794 nmdc:mga03n38_120686_c1
795 nmdc:mga0yw44_19618_c1
796 nmdc:mga0yw44_286866_c1
797 nmdc:mga06z11_26229_c1
798 nmdc:mga07m45_19873_c1
799 nmdc:mga05p37_207282_c1
800 nmdc:mga09592_131741_c1
801 nmdc:mga0qj67_62322_c1
802 nmdc:mga06r32_131428_c1
803 Ga0495601_0126671
804 Ga0495601_0179535
805 Ga0495612_0043433
806 Ga0495619_0111558
807 Ga0495619_0156388
808 Ga0500583_0078348
809 Ga0500560_002613
810 Ga0500614_014130
811 Ga0500573_0060994
812 Ga0500573_0119107
813 Ga0500574_022681
814 Ga0500600_0107031
815 Ga0500600_0140547
816 Ga0500600_0168675
817 Ga0501084_0003883
818 Ga0501082_0047873
819 Ga0466962_0000359
820 Ga0466962_0087597
821 Ga0530510_0113542
822 2862287807
823 2515854321
824 2547407110
825 2585309932
826 2585315750
827 2616697507
828 2616900369
829 2643765393
830 2643944440
831 2644264559
832 2644385628
833 2644431338
834 2644462536
835 2676476671
836 2784588163
837 2785343902
838 2785368932
839 2786670109
840 2793977133
841 2804847571
842 2809231775
843 2811848533
844 2812480987
845 2816426786
846 2819693394
847 2827630242
848 2862184644
849 2862293232
850 2862390002
851 2862708850
852 2863405188
853 2867348468
854 2867371462
855 2873156234
856 2912720537
857 2912760180
858 2946050534
859 2947230030
860 2954386728
861 2954676444
862 2954687723
863 2954697543
864 2954704664
865 2954716704
866 2954726651
867 2954735144
868 2954745573
869 2954754015
870 2954764548
871 2990062869
872 2997601706
873 3003003349
874 3006321667
875 3006492605
876 3006496460
877 8008559876
878 8023631393
879 8025417371
880 8025533167
881 8047898561
882 8048132779
883 8048360358
884 8048375523
885 8048382682
886 8048413221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06182

ABC2_membrane_6

ABC-2 family transporter protein

72

309

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6438 6 260
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.6222 6 260
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.6137 6 260
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.6113 6 260
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.6013 6 260
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6934 56 253 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6563 55 252 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6517 55 251 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5344 56 253 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5078 55 252 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A4D4L5S3-F1-model_v4 Transporter 0.9853 1 228 GO:0016020
AF-A0A4R8DB71-F1-model_v4 ABC-2 type transport system permease protein 0.9833 1 265 GO:0016020
AF-A0A2W2GTB0-F1-model_v4 ABC transporter permease 0.9833 2 265 GO:0016020
AF-A0A370VM73-F1-model_v4 ABC transporter permease 0.9813 3 265 GO:0016020
AF-A0A4R8DB71-F1-model_v4 ABC-2 type transport system permease protein 0.9796 1 265 GO:0016020

Map