F445132

General Info

Members Datasets Scaffolds Average Seq Length
443 201 443 339

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0009265|Ga0451577_0009265_815_1873
Length 352
Sequence MPNPTMRALVKEQAGPGMTLRDVPVPACGDNDALIRVHHAGVCGTDLHIWEWDRWASNRLRPPVTIGHEFAGEIAALGRDAEAAGLLSVGDLVTAEGHVVCGHCLQCRLGDAHLCRRTQIIGVDRDGAFAEYIAMPASNVMKLDGIPPEVGAIMDPMGNAVHTVLEGNAVVGARVLVLGCGPIGCFAVGVARAAGASLVLASDFNARRLELARAMGAHVTLDPGAEDVVARVRELTGGDGADLVCEFSGHPSGHAQAFAAARLGGRVNMLGTPARTTEVDFARDVIFKGLTLYGVTGRRMYRTWDEMQRFLRSGQLDPRPVVTHRFPMERMAEAIGVIKDGSAGKVILDVRA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
105 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
171 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
172 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
173 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
176 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
177 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
178 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
184 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
185 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
186 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
198 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.84
Rhizosphere 88.71
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_6764082 2162886012 Bacteria 2124
2 rootL2_10144645 3300003322 Bacteria 5575
3 Ga0065715_10010773 3300005293 Bacteria 3802
4 Ga0070683_100046257 3300005329 Bacteria 4019
5 Ga0070680_100000563 3300005336 Bacteria 25387
6 Ga0070680_100006317 3300005336 Bacteria 9001
7 Ga0070680_100063341 3300005336 Bacteria 3029
8 Ga0070687_100055149 3300005343 Bacteria 2074
9 Ga0070692_10095777 3300005345 Bacteria 1620
10 Ga0070668_100085184 3300005347 Bacteria 2484
11 Ga0070669_100021238 3300005353 Bacteria 4639
12 Ga0070671_100000547 3300005355 Bacteria 26607
13 Ga0070674_100001537 3300005356 Bacteria 12330
14 Ga0070673_100159589 3300005364 Bacteria 1917
15 Ga0070659_100134927 3300005366 Bacteria 2007
16 Ga0070667_100045430 3300005367 Bacteria 3693
17 Ga0070709_10000414 3300005434 Bacteria 25971
18 Ga0070709_10001086 3300005434 Bacteria 15054
19 Ga0070709_10169415 3300005434 Bacteria 1525
20 Ga0070701_10002346 3300005438 Bacteria 7265
21 Ga0070711_100000144 3300005439 Bacteria 38529
22 Ga0070711_100042817 3300005439 Bacteria 3063
23 Ga0070711_100072494 3300005439 Bacteria 2430
24 Ga0070705_100004179 3300005440 Bacteria 7053
25 Ga0070705_100021048 3300005440 Bacteria 3463
26 Ga0070705_100034159 3300005440 Bacteria 2841
27 Ga0070694_100005296 3300005444 Bacteria 7801
28 Ga0070694_100028871 3300005444 Bacteria 3614
29 Ga0070694_100036379 3300005444 Bacteria 3261
30 Ga0070694_100054667 3300005444 Bacteria 2705
31 Ga0070694_100141048 3300005444 Bacteria 1751
32 Ga0070708_100000841 3300005445 Bacteria 23088
33 Ga0070708_100027069 3300005445 Bacteria 4915
34 Ga0070708_100047328 3300005445 Bacteria 3799
35 Ga0070708_100078050 3300005445 Bacteria 2993
36 Ga0070708_100187249 3300005445 Bacteria 1936
37 Ga0070708_100313247 3300005445 Unclassified 1478
38 Ga0070662_100001030 3300005457 Bacteria 17011
39 Ga0070681_10201265 3300005458 Bacteria 1910
40 Ga0070685_10128833 3300005466 Bacteria 1580
41 Ga0070706_100004320 3300005467 Bacteria 13760
42 Ga0070706_100107831 3300005467 Bacteria 2591
43 Ga0070706_100117150 3300005467 Bacteria 2481
44 Ga0070706_100228837 3300005467 Bacteria 1736
45 Ga0070707_100026761 3300005468 Bacteria 5479
46 Ga0070707_100028943 3300005468 Bacteria 5273
47 Ga0070707_100123305 3300005468 Bacteria 2516
48 Ga0070707_100141471 3300005468 Bacteria 2342
49 Ga0070707_100152827 3300005468 Bacteria 2247
50 Ga0070698_100000802 3300005471 Bacteria 34247
51 Ga0070698_100001501 3300005471 Bacteria 25921
52 Ga0070698_100330944 3300005471 Unclassified 1454
53 Ga0070699_100000710 3300005518 Bacteria 30896
54 Ga0070699_100007304 3300005518 Bacteria 9617
55 Ga0070699_100008262 3300005518 Bacteria 9027
56 Ga0070699_100010879 3300005518 Bacteria 7870
57 Ga0070699_100014082 3300005518 Bacteria 6881
58 Ga0070699_100073820 3300005518 Bacteria 2968
59 Ga0070699_100085372 3300005518 Bacteria 2755
60 Ga0070699_100091620 3300005518 Bacteria 2658
61 Ga0070697_100001210 3300005536 Bacteria 19508
62 Ga0070697_100009442 3300005536 Bacteria 7621
63 Ga0070697_100018508 3300005536 Bacteria 5492
64 Ga0070697_100042332 3300005536 Bacteria 3685
65 Ga0070697_100121954 3300005536 Bacteria 2181
66 Ga0070697_100191788 3300005536 Bacteria 1735
67 Ga0070672_100261260 3300005543 Bacteria 1460
68 Ga0070686_100127259 3300005544 Bacteria 1757
69 Ga0070695_100002748 3300005545 Bacteria 10205
70 Ga0070695_100003264 3300005545 Bacteria 9471
71 Ga0070695_100003470 3300005545 Bacteria 9213
72 Ga0070696_100003836 3300005546 Bacteria 10036
73 Ga0070696_100009108 3300005546 Bacteria 6651
74 Ga0070696_100011147 3300005546 Bacteria 6014
75 Ga0070696_100016401 3300005546 Bacteria 4988
76 Ga0070696_100056715 3300005546 Bacteria 2732
77 Ga0070696_100078767 3300005546 Bacteria 2331
78 Ga0070704_100005335 3300005549 Bacteria 7484
79 Ga0070704_100010284 3300005549 Bacteria 5689
80 Ga0070704_100039910 3300005549 Bacteria 3226
81 Ga0070704_100044696 3300005549 Bacteria 3079
82 Ga0070704_100112237 3300005549 Bacteria 2076
83 Ga0070664_100095176 3300005564 Bacteria 2583
84 Ga0068857_100000980 3300005577 Bacteria 21852
85 Ga0068857_100166605 3300005577 Bacteria 2001
86 Ga0068854_100001110 3300005578 Bacteria 16189
87 Ga0068854_100127631 3300005578 Bacteria 1939
88 Ga0068852_100163439 3300005616 Bacteria 2080
89 Ga0068859_100264190 3300005617 Bacteria 1813
90 Ga0068866_10002840 3300005718 Bacteria 7139
91 Ga0068870_10049717 3300005840 Bacteria 2213
92 Ga0068863_100092901 3300005841 Bacteria 2863
93 Ga0081455_10078098 3300005937 Bacteria 2721
94 Ga0068871_100111587 3300006358 Bacteria 2300
95 Ga0075428_100014281 3300006844 Bacteria 8831
96 Ga0075428_100014806 3300006844 Bacteria 8667
97 Ga0075428_100027550 3300006844 Bacteria 6287
98 Ga0075431_100006584 3300006847 Bacteria 11542
99 Ga0075431_100010519 3300006847 Bacteria 9302
100 Ga0075431_100034962 3300006847 Bacteria 5176
101 Ga0075431_100094954 3300006847 Bacteria 3078
102 Ga0075433_10000564 3300006852 Bacteria 24437
103 Ga0075433_10003642 3300006852 Bacteria 11911
104 Ga0075433_10008507 3300006852 Bacteria 8185
105 Ga0075433_10113777 3300006852 Bacteria 2401
106 Ga0075434_100003377 3300006871 Bacteria 14292
107 Ga0075434_100009731 3300006871 Bacteria 8986
108 Ga0075434_100013838 3300006871 Bacteria 7694
109 Ga0075434_100024727 3300006871 Bacteria 5873
110 Ga0075434_100027923 3300006871 Bacteria 5539
111 Ga0075434_100035434 3300006871 Bacteria 4933
112 Ga0075434_100036780 3300006871 Bacteria 4842
113 Ga0075434_100108678 3300006871 Bacteria 2784
114 Ga0075429_100003889 3300006880 Bacteria 12755
115 Ga0075429_100022045 3300006880 Bacteria 5524
116 Ga0075436_100025451 3300006914 Bacteria 4073
117 Ga0075436_100052135 3300006914 Bacteria 2823
118 Ga0075436_100053831 3300006914 Bacteria 2778
119 Ga0075435_100018514 3300007076 Bacteria 5300
120 Ga0075435_100033560 3300007076 Bacteria 4059
121 Ga0075435_100065238 3300007076 Unclassified 2960
122 Ga0075435_100245836 3300007076 Bacteria 1522
123 Ga0099794_10000532 3300007265 Bacteria 12760
124 Ga0105240_10008993 3300009093 Bacteria 14194
125 Ga0114129_10000435 3300009147 Bacteria 49624
126 Ga0114129_10052466 3300009147 Bacteria 5723
127 Ga0114129_10127757 3300009147 Bacteria 3494
128 Ga0105243_10059134 3300009148 Bacteria 3058
129 Ga0105248_10021922 3300009177 Bacteria 7079
130 Ga0105249_10034321 3300009553 Bacteria 4597
131 Ga0105239_10015267 3300010375 Bacteria 8510
132 Ga0105239_10300487 3300010375 Bacteria 1808
133 Ga0105246_10007496 3300011119 Bacteria 6689
134 Ga0157371_10237833 3300013102 Bacteria 1309
135 Ga0163162_10011405 3300013306 Bacteria 8667
136 Ga0157375_10076220 3300013308 Bacteria 3380
137 Ga0157375_10302824 3300013308 Bacteria 1762
138 Ga0157376_10024731 3300014969 Bacteria 4721
139 Ga0157376_10129067 3300014969 Bacteria 2253
140 Ga0207653_10025784 3300025885 Bacteria 1881
141 Ga0207642_10002219 3300025899 Bacteria 6025
142 Ga0207680_10022760 3300025903 Bacteria 3413
143 Ga0207699_10003775 3300025906 Bacteria 7233
144 Ga0207699_10033717 3300025906 Bacteria 2896
145 Ga0207645_10003720 3300025907 Bacteria 11477
146 Ga0207643_10055890 3300025908 Bacteria 2245
147 Ga0207684_10005205 3300025910 Bacteria 12088
148 Ga0207684_10009933 3300025910 Bacteria 8390
149 Ga0207684_10080380 3300025910 Bacteria 2773
150 Ga0207707_10004162 3300025912 Bacteria 12818
151 Ga0207707_10161547 3300025912 Bacteria 1958
152 Ga0207707_10186090 3300025912 Bacteria 1812
153 Ga0207663_10000053 3300025916 Bacteria 62261
154 Ga0207663_10114614 3300025916 Bacteria 1835
155 Ga0207663_10143157 3300025916 Bacteria 1668
156 Ga0207660_10002194 3300025917 Bacteria 12918
157 Ga0207660_10057181 3300025917 Bacteria 2793
158 Ga0207660_10062333 3300025917 Bacteria 2686
159 Ga0207662_10072316 3300025918 Bacteria 2090
160 Ga0207649_10079305 3300025920 Bacteria 2121
161 Ga0207649_10117952 3300025920 Bacteria 1785
162 Ga0207652_10001085 3300025921 Bacteria 24651
163 Ga0207646_10004399 3300025922 Bacteria 15320
164 Ga0207646_10006287 3300025922 Bacteria 12316
165 Ga0207646_10015713 3300025922 Bacteria 7134
166 Ga0207687_10021454 3300025927 Bacteria 4292
167 Ga0207690_10115444 3300025932 Bacteria 1940
168 Ga0207706_10000005 3300025933 Bacteria 224460
169 Ga0207706_10034245 3300025933 Bacteria 4518
170 Ga0207709_10004217 3300025935 Bacteria 8338
171 Ga0207704_10113480 3300025938 Bacteria 1837
172 Ga0207704_10295617 3300025938 Bacteria 1238
173 Ga0207691_10071230 3300025940 Bacteria 3138
174 Ga0207711_10086077 3300025941 Bacteria 2755
175 Ga0207711_10218123 3300025941 Bacteria 1744
176 Ga0207689_10003763 3300025942 Bacteria 13820
177 Ga0207679_10043142 3300025945 Bacteria 3246
178 Ga0207651_10082603 3300025960 Bacteria 2320
179 Ga0207668_10082592 3300025972 Bacteria 2335
180 Ga0207640_10004284 3300025981 Bacteria 7723
181 Ga0207640_10169554 3300025981 Bacteria 1625
182 Ga0207678_10095040 3300026067 Unclassified 2547
183 Ga0207678_10229110 3300026067 Bacteria 1591
184 Ga0207708_10019444 3300026075 Bacteria 5120
185 Ga0207641_10108556 3300026088 Bacteria 2456
186 Ga0207648_10000008 3300026089 Bacteria 208822
187 Ga0207674_10000558 3300026116 Bacteria 48845
188 Ga0207675_100179154 3300026118 Bacteria 2029
189 Ga0207683_10003917 3300026121 Bacteria 12907
190 Ga0207698_10265281 3300026142 Bacteria 1580
191 Ga0209588_1000472 3300027671 Bacteria 10330
192 Ga0209588_1003811 3300027671 Bacteria 4206
193 Ga0268264_10015541 3300028381 Bacteria 6240
194 Ga0307408_100024616 3300031548 Archaea 4113
195 Ga0307408_100088773 3300031548 Bacteria 2329
196 Ga0307408_100094230 3300031548 Bacteria 2267
197 Ga0307408_100145784 3300031548 Bacteria 1863
198 Ga0307405_10003049 3300031731 Bacteria 7589
199 Ga0307405_10056139 3300031731 Bacteria 2468
200 Ga0307413_10015203 3300031824 Bacteria 3938
201 Ga0307413_10034080 3300031824 Bacteria 2906
202 Ga0307413_10108732 3300031824 Bacteria 1851
203 Ga0307413_10178107 3300031824 Bacteria 1512
204 Ga0307413_10182373 3300031824 Unclassified 1498
205 Ga0307410_10004890 3300031852 Bacteria 7014
206 Ga0307410_10006210 3300031852 Bacteria 6425
207 Ga0307410_10025801 3300031852 Bacteria 3691
208 Ga0307410_10026310 3300031852 Bacteria 3661
209 Ga0307410_10070186 3300031852 Bacteria 2426
210 Ga0307410_10087067 3300031852 Bacteria 2208
211 Ga0307410_10136583 3300031852 Bacteria 1808
212 Ga0307410_10283957 3300031852 Bacteria 1300
213 Ga0307406_10012753 3300031901 Archaea 4796
214 Ga0307406_10019787 3300031901 Bacteria 3955
215 Ga0307406_10053159 3300031901 Bacteria 2579
216 Ga0307406_10077029 3300031901 Bacteria 2205
217 Ga0307407_10111127 3300031903 Bacteria 1720
218 Ga0307407_10212646 3300031903 Bacteria 1303
219 Ga0307412_10013570 3300031911 Bacteria 4781
220 Ga0307412_10145142 3300031911 Bacteria 1743
221 Ga0307409_100000536 3300031995 Bacteria 16412
222 Ga0307409_100017616 3300031995 Bacteria 4769
223 Ga0307409_100024072 3300031995 Bacteria 4238
224 Ga0307409_100033102 3300031995 Bacteria 3757
225 Ga0307409_100104718 3300031995 Bacteria 2357
226 Ga0307416_100001321 3300032002 Bacteria 13364
227 Ga0307416_100006664 3300032002 Bacteria 7246
228 Ga0307416_100007989 3300032002 Archaea 6775
229 Ga0307416_100021784 3300032002 Bacteria 4610
230 Ga0307416_100038204 3300032002 Bacteria 3702
231 Ga0307416_100065470 3300032002 Bacteria 2987
232 Ga0307414_10066895 3300032004 Bacteria 2571
233 Ga0307414_10076238 3300032004 Bacteria 2436
234 Ga0307414_10227803 3300032004 Bacteria 1535
235 Ga0307414_10258363 3300032004 Bacteria 1452
236 Ga0307411_10000590 3300032005 Bacteria 13013
237 Ga0307411_10015500 3300032005 Bacteria 4283
238 Ga0307411_10038149 3300032005 Bacteria 3027
239 Ga0307411_10116872 3300032005 Bacteria 1921
240 Ga0307411_10401259 3300032005 Bacteria 1133
241 Ga0307415_100007411 3300032126 Bacteria 6000
242 Ga0307415_100034713 3300032126 Bacteria 3287
243 Ga0307415_100042051 3300032126 Bacteria 3039
244 Ga0307415_100068538 3300032126 Bacteria 2483
245 Ga0373929_0008128 3300035085 Bacteria 1931
246 Ga0373961_0031639 3300035241 Bacteria 1479
247 Ga0373961_0071299 3300035241 Unclassified 1075
248 Ga0316574_0065589 3300035398 Bacteria 2286
249 Ga0373931_0011188 3300035691 Bacteria 4331
250 Ga0373931_0174294 3300035691 Bacteria 1269
251 Ga0373933_0096404 3300035724 Bacteria 1831
252 Ga0242420_003325 3300038996 Bacteria 2372
253 Ga0242420_020800 3300038996 Bacteria 1170
254 Ga0439436_0040508 3300041404 Unclassified 1335
255 Ga0439439_0002597 3300041406 Bacteria 3864
256 Ga0451807_1289396 3300041486 Bacteria 1662
257 Ga0451853_3540105 3300041512 Bacteria 1544
258 Ga0450898_002186 3300042134 Bacteria 2712
259 Ga0451577_0009265 3300042876 Bacteria 9489
260 Ga0451577_0120949 3300042876 Bacteria 2345
261 Ga0451577_0204548 3300042876 Bacteria 1782
262 Ga0453683_0038029 3300044673 Bacteria 3026
263 Ga0453683_0079938 3300044673 Bacteria 2048
264 Ga0453683_0130944 3300044673 Bacteria 1581
265 Ga0453683_0279066 3300044673 Bacteria 1067
266 Ga0451576_0004983 3300045051 Bacteria 16893
267 Ga0451576_0023385 3300045051 Bacteria 6690
268 Ga0451576_0050446 3300045051 Bacteria 4363
269 Ga0451576_0072366 3300045051 Bacteria 3587
270 Ga0451576_0145395 3300045051 Bacteria 2472
271 Ga0451576_0687916 3300045051 Bacteria 1074
272 Ga0495603_0020520 3300046455 Bacteria 4004
273 Ga0495594_0036163 3300046499 Bacteria 2692
274 Ga0495594_0167566 3300046499 Bacteria 1249
275 Ga0495666_0003052 3300046526 Bacteria 8418
276 Ga0495640_0059091 3300046533 Bacteria 2613
277 Ga0495586_0004818 3300046535 Bacteria 7212
278 Ga0495621_0016813 3300046539 Bacteria 2355
279 Ga0495634_0006516 3300046642 Bacteria 8866
280 Ga0495659_0007269 3300046664 Bacteria 3511
281 Ga0495647_0013216 3300046681 Bacteria 2857
282 Ga0495658_0037955 3300046683 Bacteria 2665
283 Ga0495674_0111237 3300047319 Unclassified 2322
284 Ga0496101_0072196 3300048904 Bacteria 2533
285 Ga0496101_0142643 3300048904 Bacteria 1827
286 Ga0496101_0167650 3300048904 Bacteria 1687
287 Ga0496102_0034011 3300048905 Bacteria 4584
288 Ga0496102_0047872 3300048905 Bacteria 3887
289 Ga0496102_0055680 3300048905 Bacteria 3606
290 Ga0496102_0335734 3300048905 Bacteria 1423
291 Ga0496102_0369047 3300048905 Bacteria 1351
292 Ga0496103_0003742 3300048906 Bacteria 9250
293 Ga0496104_0017078 3300048907 Bacteria 6604
294 Ga0496104_0025928 3300048907 Bacteria 5406
295 Ga0496104_0115517 3300048907 Bacteria 2575
296 Ga0496104_0232299 3300048907 Bacteria 1756
297 Ga0496104_0241957 3300048907 Bacteria 1717
298 Ga0496105_0186386 3300048908 Bacteria 1698
299 Ga0496106_0013722 3300048909 Bacteria 5983
300 Ga0496106_0165888 3300048909 Bacteria 1748
301 Ga0496107_0064243 3300048910 Bacteria 2661
302 Ga0496107_0094153 3300048910 Bacteria 2192
303 Ga0496108_0010442 3300048911 Bacteria 7540
304 Ga0496108_0040916 3300048911 Bacteria 3866
305 Ga0496108_0053484 3300048911 Bacteria 3386
306 Ga0496108_0069822 3300048911 Bacteria 2964
307 Ga0496108_0088049 3300048911 Bacteria 2638
308 Ga0496109_0004745 3300048912 Bacteria 11363
309 Ga0496109_0017756 3300048912 Bacteria 6241
310 Ga0496109_0023345 3300048912 Bacteria 5489
311 Ga0496109_0058510 3300048912 Bacteria 3520
312 Ga0496109_0079579 3300048912 Bacteria 3020
313 Ga0496110_0047034 3300048913 Bacteria 3776
314 Ga0496110_0064126 3300048913 Bacteria 3246
315 Ga0496110_0206227 3300048913 Bacteria 1787
316 Ga0496111_0003464 3300048914 Bacteria 9763
317 Ga0496111_0122132 3300048914 Bacteria 1924
318 Ga0496111_0128097 3300048914 Bacteria 1877
319 Ga0496112_0015152 3300048915 Bacteria 7184
320 Ga0496112_0039079 3300048915 Bacteria 4635
321 Ga0496112_0057685 3300048915 Bacteria 3823
322 Ga0496112_0066197 3300048915 Bacteria 3565
323 Ga0496112_0268830 3300048915 Bacteria 1653
324 Ga0496113_0006748 3300048916 Bacteria 7317
325 Ga0496113_0009408 3300048916 Bacteria 6408
326 Ga0496113_0038327 3300048916 Bacteria 3523
327 Ga0496113_0068683 3300048916 Bacteria 2689
328 Ga0496114_0429923 3300048917 Bacteria 1170
329 Ga0496114_0464621 3300048917 Bacteria 1120
330 Ga0496115_0026526 3300048918 Bacteria 4523
331 Ga0501292_008887 3300049515 Unclassified 1480
332 Ga0501034_0010694 3300049571 Bacteria 9532
333 Ga0501034_0016611 3300049571 Bacteria 7548
334 Ga0501039_0024950 3300049575 Bacteria 4593
335 Ga0501040_0043658 3300049576 Bacteria 3057
336 Ga0501040_0069807 3300049576 Bacteria 2424
337 Ga0501040_0110819 3300049576 Bacteria 1919
338 Ga0501041_0056252 3300049577 Bacteria 2403
339 Ga0501042_0229720 3300049578 Bacteria 1338
340 Ga0501047_0080094 3300049581 Bacteria 3140
341 Ga0501047_0309209 3300049581 Bacteria 1421
342 Ga0501048_0084218 3300049582 Bacteria 2242
343 Ga0501067_0001446 3300049583 Bacteria 12899
344 Ga0501067_0014762 3300049583 Bacteria 4322
345 Ga0501067_0018790 3300049583 Bacteria 3826
346 Ga0501067_0079743 3300049583 Bacteria 1814
347 Ga0501068_0000058 3300049584 Bacteria 43525
348 Ga0501068_0004960 3300049584 Bacteria 7256
349 Ga0501069_0000727 3300049585 Bacteria 15324
350 Ga0501069_0046580 3300049585 Bacteria 2405
351 Ga0501069_0125703 3300049585 Bacteria 1466
352 Ga0501070_0011315 3300049586 Bacteria 7538
353 Ga0501070_0016680 3300049586 Bacteria 6167
354 Ga0501070_0016911 3300049586 Bacteria 6121
355 Ga0501070_0060973 3300049586 Bacteria 3126
356 Ga0501071_0000675 3300049587 Bacteria 17803
357 Ga0501071_0003403 3300049587 Bacteria 9941
358 Ga0501071_0091813 3300049587 Bacteria 2231
359 Ga0501072_0000375 3300049588 Bacteria 31924
360 Ga0501072_0026948 3300049588 Bacteria 4485
361 Ga0501073_0005051 3300049589 Bacteria 9892
362 Ga0501073_0048821 3300049589 Bacteria 2969
363 Ga0501074_0002224 3300049590 Bacteria 13455
364 Ga0501074_0009841 3300049590 Bacteria 6944
365 Ga0501075_0089220 3300049591 Bacteria 2338
366 Ga0501075_0102351 3300049591 Bacteria 2175
367 Ga0501076_0010112 3300049592 Bacteria 6987
368 Ga0501076_0154586 3300049592 Bacteria 1867
369 Ga0501076_0330078 3300049592 Bacteria 1251
370 Ga0501077_0001740 3300049593 Bacteria 13113
371 Ga0501077_0032025 3300049593 Bacteria 3345
372 Ga0501077_0036429 3300049593 Bacteria 3134
373 Ga0501209_042780 3300049656 Bacteria 1205
374 Ga0501216_000398 3300049660 Bacteria 5070
375 Ga0501217_025456 3300049661 Bacteria 1423
376 Ga0501233_016796 3300049668 Bacteria 1522
377 Ga0501235_026506 3300049669 Bacteria 1299
378 Ga0501247_007188 3300049677 Bacteria 1277
379 Ga0501256_004195 3300049685 Bacteria 1229
380 Ga0501234_004622 3300049707 Unclassified 2165
381 Ga0501245_014363 3300049708 Bacteria 1181
382 Ga0501079_0048725 3300049741 Bacteria 3269
383 Ga0501079_0063161 3300049741 Bacteria 2857
384 Ga0501080_0016606 3300049742 Bacteria 6800
385 Ga0501080_0082077 3300049742 Bacteria 2994
386 Ga0501080_0149773 3300049742 Bacteria 2157
387 Ga0501080_0288889 3300049742 Bacteria 1489
388 Ga0501081_0020536 3300049743 Bacteria 4402
389 Ga0501081_0027067 3300049743 Bacteria 3870
390 Ga0501081_0221709 3300049743 Bacteria 1375
391 Ga0501083_0001311 3300049744 Bacteria 16849
392 Ga0501083_0002456 3300049744 Bacteria 12689
393 Ga0501262_006821 3300049759 Unclassified 1372
394 Ga0501267_003101 3300049764 Unclassified 1501
395 Ga0501271_002508 3300049768 Bacteria 1642
396 Ga0501272_006614 3300049769 Bacteria 1240
397 Ga0501045_0123952 3300049824 Bacteria 1919
398 Ga0501045_0150344 3300049824 Bacteria 1732
399 nmdc:mga05p37_212897_c1 3300050507 Bacteria 2335
400 nmdc:mga05p37_3026_c1 3300050507 Bacteria 19522
401 nmdc:mga09592_17931_c1 3300050508 Bacteria 5800
402 nmdc:mga09592_36241_c1 3300050508 Bacteria 4132
403 nmdc:mga06r32_105091_c1 3300050510 Bacteria 2774
404 nmdc:mga06r32_2021_c1 3300050510 Bacteria 18145
405 nmdc:mga06r32_206333_c1 3300050510 Bacteria 1953
406 nmdc:mga0n895_10607_c1 3300050512 Bacteria 8155
407 nmdc:mga0n895_12275_c1 3300050512 Bacteria 7678
408 nmdc:mga0n895_128267_c1 3300050512 Bacteria 2561
409 nmdc:mga0n895_33062_c1 3300050512 Bacteria 4968
410 nmdc:mga0n895_5323_c1 3300050512 Bacteria 10718
411 nmdc:mga0n895_8552_c1 3300050512 Bacteria 8874
412 nmdc:mga0n895_99489_c1 3300050512 Bacteria 2916
413 nmdc:mga0rr50_202688_c1 3300050513 Bacteria 1631
414 nmdc:mga0rr50_383882_c1 3300050513 Bacteria 1185
415 nmdc:mga0rr50_50081_c1 3300050513 Unclassified 1381
416 nmdc:mga0rr50_69932_c1 3300050513 Archaea 2673
417 nmdc:mga0rr50_96991_c1 3300050513 Bacteria 2308
418 nmdc:mga08x19_3606_c1 3300050514 Bacteria 9222
419 nmdc:mga08x19_56866_c1 3300050514 Bacteria 2526
420 nmdc:mga08x19_8536_c1 3300050514 Bacteria 6105
421 nmdc:mga08x19_9853_c1 3300050514 Bacteria 5726
422 nmdc:mga0a205_10498_c1 3300050515 Bacteria 8510
423 nmdc:mga0a205_1721_c1 3300050515 Bacteria 18891
424 nmdc:mga0a205_30733_c1 3300050515 Bacteria 3507
425 nmdc:mga0a205_33177_c1 3300050515 Bacteria 4950
426 nmdc:mga0a205_5363_c1 3300050515 Bacteria 11557
427 nmdc:mga0a205_76131_c1 3300050515 Bacteria 3242
428 Ga0501084_0000920 3300054114 Bacteria 22738
429 Ga0501084_0001573 3300054114 Bacteria 18077
430 Ga0501084_0015255 3300054114 Bacteria 6372
431 Ga0590071_000618 3300059421 Bacteria 10198
432 Ga0590071_003412 3300059421 Bacteria 3904
433 Ga0590071_013429 3300059421 Bacteria 1917
434 Ga0590071_018369 3300059421 Bacteria 1644
435 Ga0590074_000946 3300059423 Bacteria 4561
436 Ga0590075_016658 3300059424 Bacteria 1808
437 Ga0590077_002684 3300059426 Bacteria 3756
438 Ga0501082_0009431 3300060353 Bacteria 8400
439 Ga0501082_0051800 3300060353 Bacteria 3538
440 Ga0501082_0057429 3300060353 Bacteria 3353
441 Ga0501082_0117085 3300060353 Bacteria 2308
442 Ga0501082_0351939 3300060353 Bacteria 1284
443 Ga0530510_0157383 3300061734 Bacteria 1680

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025941 Ga0207711_10218123 Ga0207711_102181232 283
2 3300044673 Ga0453683_0130944 Ga0453683_0130944_697_1548 283
3 3300035241 Ga0373961_0071299 Ga0373961_0071299_16_876 286
4 3300048917 Ga0496114_0464621 Ga0496114_0464621_80_946 288
5 3300050510 nmdc:mga06r32_206333_c1 nmdc:mga06r32_206333_c1_119_997 292
6 3300049583 Ga0501067_0079743 Ga0501067_0079743_146_1030 294
7 3300025938 Ga0207704_10295617 Ga0207704_102956172 308
8 3300005434 Ga0070709_10000414 Ga0070709_1000041417 311
9 3300045051 Ga0451576_0050446 Ga0451576_0050446_1371_2318 315
10 3300050512 nmdc:mga0n895_99489_c1 nmdc:mga0n895_99489_c1_1348_2295 315
11 3300050515 nmdc:mga0a205_5363_c1 nmdc:mga0a205_5363_c1_8394_9341 315
12 3300025941 Ga0207711_10086077 Ga0207711_100860772 317
13 3300042876 Ga0451577_0204548 Ga0451577_0204548_179_1135 318
14 3300048907 Ga0496104_0232299 Ga0496104_0232299_584_1540 318
15 3300048911 Ga0496108_0069822 Ga0496108_0069822_1497_2453 318
16 3300048912 Ga0496109_0004745 Ga0496109_0004745_9366_10322 318
17 3300048914 Ga0496111_0122132 Ga0496111_0122132_206_1162 318
18 3300048915 Ga0496112_0015152 Ga0496112_0015152_5486_6442 318
19 3300048916 Ga0496113_0006748 Ga0496113_0006748_807_1763 318
20 3300049515 Ga0501292_008887 Ga0501292_008887_189_1145 318
21 3300049656 Ga0501209_042780 Ga0501209_042780_76_1032 318
22 3300049661 Ga0501217_025456 Ga0501217_025456_379_1335 318
23 3300049668 Ga0501233_016796 Ga0501233_016796_231_1187 318
24 3300049685 Ga0501256_004195 Ga0501256_004195_224_1180 318
25 3300049707 Ga0501234_004622 Ga0501234_004622_629_1585 318
26 3300049759 Ga0501262_006821 Ga0501262_006821_286_1242 318
27 3300049768 Ga0501271_002508 Ga0501271_002508_233_1189 318
28 3300049769 Ga0501272_006614 Ga0501272_006614_47_1003 318
29 3300048917 Ga0496114_0429923 Ga0496114_0429923_45_1004 319
30 3300049669 Ga0501235_026506 Ga0501235_026506_15_974 319
31 3300049592 Ga0501076_0154586 Ga0501076_0154586_323_1351 329
32 3300049743 Ga0501081_0027067 Ga0501081_0027067_1832_2860 329
33 3300005440 Ga0070705_100021048 Ga0070705_1000210483 331
34 3300005518 Ga0070699_100085372 Ga0070699_1000853722 331
35 3300005546 Ga0070696_100009108 Ga0070696_1000091083 331
36 3300005549 Ga0070704_100010284 Ga0070704_1000102843 331
37 3300006852 Ga0075433_10113777 Ga0075433_101137772 331
38 3300045051 Ga0451576_0145395 Ga0451576_0145395_543_1571 331
39 3300050515 nmdc:mga0a205_76131_c1 nmdc:mga0a205_76131_c1_485_1513 331
40 3300005546 Ga0070696_100056715 Ga0070696_1000567153 332
41 3300035398 Ga0316574_0065589 Ga0316574_0065589_521_1564 332
42 3300048907 Ga0496104_0115517 Ga0496104_0115517_145_1143 332
43 3300048911 Ga0496108_0053484 Ga0496108_0053484_304_1302 332
44 3300048912 Ga0496109_0058510 Ga0496109_0058510_246_1244 332
45 3300048913 Ga0496110_0064126 Ga0496110_0064126_2200_3198 332
46 3300048915 Ga0496112_0066197 Ga0496112_0066197_2340_3338 332
47 3300048916 Ga0496113_0038327 Ga0496113_0038327_2331_3329 332
48 3300005444 Ga0070694_100141048 Ga0070694_1001410482 333
49 3300049586 Ga0501070_0016911 Ga0501070_0016911_1493_2497 333
50 3300005347 Ga0070668_100085184 Ga0070668_1000851843 334
51 3300005353 Ga0070669_100021238 Ga0070669_1000212383 334
52 3300005356 Ga0070674_100001537 Ga0070674_1000015378 334
53 3300005364 Ga0070673_100159589 Ga0070673_1001595892 334
54 3300005434 Ga0070709_10001086 Ga0070709_100010864 334
55 3300005439 Ga0070711_100000144 Ga0070711_10000014412 334
56 3300005440 Ga0070705_100004179 Ga0070705_1000041796 334
57 3300005457 Ga0070662_100001030 Ga0070662_10000103010 334
58 3300005471 Ga0070698_100001501 Ga0070698_10000150114 334
59 3300005518 Ga0070699_100000710 Ga0070699_1000007103 334
60 3300005518 Ga0070699_100091620 Ga0070699_1000916202 334
61 3300005545 Ga0070695_100003264 Ga0070695_10000326410 334
62 3300005546 Ga0070696_100003836 Ga0070696_1000038361 334
63 3300005549 Ga0070704_100044696 Ga0070704_1000446961 334
64 3300005577 Ga0068857_100000980 Ga0068857_10000098013 334
65 3300005578 Ga0068854_100001110 Ga0068854_1000011102 334
66 3300005616 Ga0068852_100163439 Ga0068852_1001634392 334
67 3300005617 Ga0068859_100264190 Ga0068859_1002641902 334
68 3300005718 Ga0068866_10002840 Ga0068866_100028405 334
69 3300005840 Ga0068870_10049717 Ga0068870_100497172 334
70 3300006358 Ga0068871_100111587 Ga0068871_1001115871 334
71 3300006844 Ga0075428_100027550 Ga0075428_1000275503 334
72 3300006847 Ga0075431_100094954 Ga0075431_1000949542 334
73 3300006852 Ga0075433_10003642 Ga0075433_100036423 334
74 3300006871 Ga0075434_100003377 Ga0075434_1000033778 334
75 3300006880 Ga0075429_100022045 Ga0075429_1000220452 334
76 3300006914 Ga0075436_100053831 Ga0075436_1000538312 334
77 3300009093 Ga0105240_10008993 Ga0105240_1000899313 334
78 3300009147 Ga0114129_10127757 Ga0114129_101277572 334
79 3300009177 Ga0105248_10021922 Ga0105248_100219225 334
80 3300011119 Ga0105246_10007496 Ga0105246_100074965 334
81 3300013102 Ga0157371_10237833 Ga0157371_102378332 334
82 3300013306 Ga0163162_10011405 Ga0163162_100114054 334
83 3300013308 Ga0157375_10076220 Ga0157375_100762202 334
84 3300014969 Ga0157376_10129067 Ga0157376_101290671 334
85 3300025899 Ga0207642_10002219 Ga0207642_100022196 334
86 3300025903 Ga0207680_10022760 Ga0207680_100227601 334
87 3300025906 Ga0207699_10003775 Ga0207699_100037755 334
88 3300025907 Ga0207645_10003720 Ga0207645_100037207 334
89 3300025908 Ga0207643_10055890 Ga0207643_100558902 334
90 3300025916 Ga0207663_10000053 Ga0207663_100000532 334
91 3300025927 Ga0207687_10021454 Ga0207687_100214543 334
92 3300025933 Ga0207706_10000005 Ga0207706_10000005195 334
93 3300025935 Ga0207709_10004217 Ga0207709_100042178 334
94 3300025938 Ga0207704_10113480 Ga0207704_101134802 334
95 3300025942 Ga0207689_10003763 Ga0207689_100037636 334
96 3300025972 Ga0207668_10082592 Ga0207668_100825922 334
97 3300025981 Ga0207640_10004284 Ga0207640_100042844 334
98 3300026067 Ga0207678_10229110 Ga0207678_102291102 334
99 3300026089 Ga0207648_10000008 Ga0207648_1000000885 334
100 3300026116 Ga0207674_10000558 Ga0207674_1000055833 334
101 3300026121 Ga0207683_10003917 Ga0207683_100039177 334
102 3300026142 Ga0207698_10265281 Ga0207698_102652812 334
103 3300028381 Ga0268264_10015541 Ga0268264_100155415 334
104 3300035085 Ga0373929_0008128 Ga0373929_0008128_18_1022 334
105 3300042134 Ga0450898_002186 Ga0450898_002186_399_1406 334
106 3300042876 Ga0451577_0120949 Ga0451577_0120949_311_1318 334
107 3300044673 Ga0453683_0279066 Ga0453683_0279066_34_1038 334
108 3300045051 Ga0451576_0687916 Ga0451576_0687916_11_1018 334
109 3300046455 Ga0495603_0020520 Ga0495603_0020520_2884_3891 334
110 3300046499 Ga0495594_0036163 Ga0495594_0036163_124_1131 334
111 3300046664 Ga0495659_0007269 Ga0495659_0007269_2331_3338 334
112 3300048904 Ga0496101_0142643 Ga0496101_0142643_733_1740 334
113 3300048904 Ga0496101_0167650 Ga0496101_0167650_382_1386 334
114 3300048905 Ga0496102_0034011 Ga0496102_0034011_1346_2350 334
115 3300048905 Ga0496102_0047872 Ga0496102_0047872_1296_2300 334
116 3300048905 Ga0496102_0335734 Ga0496102_0335734_38_1042 334
117 3300048905 Ga0496102_0369047 Ga0496102_0369047_183_1187 334
118 3300048907 Ga0496104_0241957 Ga0496104_0241957_14_1018 334
119 3300048911 Ga0496108_0088049 Ga0496108_0088049_457_1461 334
120 3300048912 Ga0496109_0079579 Ga0496109_0079579_344_1348 334
121 3300048913 Ga0496110_0206227 Ga0496110_0206227_268_1272 334
122 3300048915 Ga0496112_0268830 Ga0496112_0268830_74_1078 334
123 3300049571 Ga0501034_0010694 Ga0501034_0010694_4359_5366 334
124 3300049575 Ga0501039_0024950 Ga0501039_0024950_92_1096 334
125 3300049576 Ga0501040_0043658 Ga0501040_0043658_1657_2661 334
126 3300049576 Ga0501040_0069807 Ga0501040_0069807_1110_2114 334
127 3300049576 Ga0501040_0110819 Ga0501040_0110819_882_1886 334
128 3300049577 Ga0501041_0056252 Ga0501041_0056252_1001_2005 334
129 3300049578 Ga0501042_0229720 Ga0501042_0229720_209_1213 334
130 3300049581 Ga0501047_0309209 Ga0501047_0309209_102_1109 334
131 3300049582 Ga0501048_0084218 Ga0501048_0084218_120_1124 334
132 3300049583 Ga0501067_0001446 Ga0501067_0001446_7569_8576 334
133 3300049583 Ga0501067_0014762 Ga0501067_0014762_1675_2679 334
134 3300049584 Ga0501068_0004960 Ga0501068_0004960_5918_6925 334
135 3300049585 Ga0501069_0000727 Ga0501069_0000727_9416_10423 334
136 3300049585 Ga0501069_0125703 Ga0501069_0125703_284_1288 334
137 3300049586 Ga0501070_0011315 Ga0501070_0011315_4269_5276 334
138 3300049586 Ga0501070_0060973 Ga0501070_0060973_274_1281 334
139 3300049587 Ga0501071_0000675 Ga0501071_0000675_12463_13470 334
140 3300049587 Ga0501071_0091813 Ga0501071_0091813_297_1304 334
141 3300049588 Ga0501072_0000375 Ga0501072_0000375_25114_26121 334
142 3300049589 Ga0501073_0005051 Ga0501073_0005051_7569_8576 334
143 3300049590 Ga0501074_0009841 Ga0501074_0009841_4344_5351 334
144 3300049591 Ga0501075_0089220 Ga0501075_0089220_1160_2164 334
145 3300049591 Ga0501075_0102351 Ga0501075_0102351_89_1093 334
146 3300049592 Ga0501076_0010112 Ga0501076_0010112_3373_4377 334
147 3300049592 Ga0501076_0330078 Ga0501076_0330078_116_1120 334
148 3300049593 Ga0501077_0001740 Ga0501077_0001740_267_1271 334
149 3300049593 Ga0501077_0032025 Ga0501077_0032025_969_1973 334
150 3300049593 Ga0501077_0036429 Ga0501077_0036429_586_1590 334
151 3300049741 Ga0501079_0048725 Ga0501079_0048725_65_1069 334
152 3300049741 Ga0501079_0063161 Ga0501079_0063161_619_1623 334
153 3300049742 Ga0501080_0016606 Ga0501080_0016606_1466_2473 334
154 3300049742 Ga0501080_0288889 Ga0501080_0288889_373_1380 334
155 3300049743 Ga0501081_0020536 Ga0501081_0020536_1774_2781 334
156 3300049743 Ga0501081_0221709 Ga0501081_0221709_141_1145 334
157 3300049744 Ga0501083_0001311 Ga0501083_0001311_14609_15616 334
158 3300049824 Ga0501045_0123952 Ga0501045_0123952_754_1758 334
159 3300049824 Ga0501045_0150344 Ga0501045_0150344_355_1359 334
160 3300050507 nmdc:mga05p37_212897_c1 nmdc:mga05p37_212897_c1_1068_2072 334
161 3300050512 nmdc:mga0n895_33062_c1 nmdc:mga0n895_33062_c1_420_1424 334
162 3300050514 nmdc:mga08x19_8536_c1 nmdc:mga08x19_8536_c1_1189_2217 334
163 3300050515 nmdc:mga0a205_33177_c1 nmdc:mga0a205_33177_c1_220_1224 334
164 3300054114 Ga0501084_0000920 Ga0501084_0000920_17388_18395 334
165 3300054114 Ga0501084_0015255 Ga0501084_0015255_4202_5206 334
166 3300059421 Ga0590071_003412 Ga0590071_003412_1626_2630 334
167 3300059424 Ga0590075_016658 Ga0590075_016658_626_1630 334
168 3300060353 Ga0501082_0009431 Ga0501082_0009431_3050_4057 334
169 3300060353 Ga0501082_0051800 Ga0501082_0051800_1313_2317 334
170 3300060353 Ga0501082_0057429 Ga0501082_0057429_2231_3235 334
171 3300060353 Ga0501082_0117085 Ga0501082_0117085_804_1808 334
172 3300060353 Ga0501082_0351939 Ga0501082_0351939_107_1120 334
173 3300061734 Ga0530510_0157383 Ga0530510_0157383_444_1451 334
174 3300005518 Ga0070699_100008262 Ga0070699_1000082624 335
175 3300005549 Ga0070704_100112237 Ga0070704_1001122372 335
176 3300025885 Ga0207653_10025784 Ga0207653_100257842 335
177 3300025910 Ga0207684_10009933 Ga0207684_100099337 335
178 3300025922 Ga0207646_10004399 Ga0207646_100043995 335
179 3300045051 Ga0451576_0004983 Ga0451576_0004983_5820_6860 335
180 3300005434 Ga0070709_10169415 Ga0070709_101694152 336
181 3300005468 Ga0070707_100028943 Ga0070707_1000289435 336
182 3300005536 Ga0070697_100042332 Ga0070697_1000423325 336
183 3300006844 Ga0075428_100014806 Ga0075428_1000148061 336
184 3300006847 Ga0075431_100010519 Ga0075431_1000105195 336
185 3300006847 Ga0075431_100034962 Ga0075431_1000349622 336
186 3300006852 Ga0075433_10000564 Ga0075433_1000056416 336
187 3300006852 Ga0075433_10008507 Ga0075433_100085077 336
188 3300006871 Ga0075434_100024727 Ga0075434_1000247274 336
189 3300006871 Ga0075434_100036780 Ga0075434_1000367803 336
190 3300006880 Ga0075429_100003889 Ga0075429_1000038895 336
191 3300006914 Ga0075436_100025451 Ga0075436_1000254513 336
192 3300007076 Ga0075435_100065238 Ga0075435_1000652383 336
193 3300044673 Ga0453683_0079938 Ga0453683_0079938_328_1368 336
194 3300050508 nmdc:mga09592_17931_c1 nmdc:mga09592_17931_c1_1063_2103 336
195 3300050510 nmdc:mga06r32_105091_c1 nmdc:mga06r32_105091_c1_1508_2548 336
196 3300050512 nmdc:mga0n895_5323_c1 nmdc:mga0n895_5323_c1_3888_4928 336
197 3300050512 nmdc:mga0n895_8552_c1 nmdc:mga0n895_8552_c1_753_1781 336
198 3300050513 nmdc:mga0rr50_69932_c1 nmdc:mga0rr50_69932_c1_236_1264 336
199 3300050514 nmdc:mga08x19_3606_c1 nmdc:mga08x19_3606_c1_7630_8658 336
200 3300050515 nmdc:mga0a205_10498_c1 nmdc:mga0a205_10498_c1_4618_5658 336
201 3300050515 nmdc:mga0a205_1721_c1 nmdc:mga0a205_1721_c1_11112_12140 336
202 3300038996 Ga0242420_020800 Ga0242420_020800_95_1135 340
203 3300005336 Ga0070680_100006317 Ga0070680_1000063176 342
204 3300005343 Ga0070687_100055149 Ga0070687_1000551492 342
205 3300005438 Ga0070701_10002346 Ga0070701_100023463 342
206 3300005439 Ga0070711_100042817 Ga0070711_1000428172 342
207 3300005444 Ga0070694_100005296 Ga0070694_1000052961 342
208 3300005444 Ga0070694_100028871 Ga0070694_1000288713 342
209 3300005445 Ga0070708_100078050 Ga0070708_1000780503 342
210 3300005445 Ga0070708_100187249 Ga0070708_1001872492 342
211 3300005445 Ga0070708_100313247 Ga0070708_1003132471 342
212 3300005467 Ga0070706_100117150 Ga0070706_1001171502 342
213 3300005468 Ga0070707_100123305 Ga0070707_1001233052 342
214 3300005468 Ga0070707_100152827 Ga0070707_1001528272 342
215 3300005471 Ga0070698_100000802 Ga0070698_10000080214 342
216 3300005471 Ga0070698_100330944 Ga0070698_1003309442 342
217 3300005518 Ga0070699_100007304 Ga0070699_1000073047 342
218 3300005536 Ga0070697_100009442 Ga0070697_1000094423 342
219 3300005536 Ga0070697_100121954 Ga0070697_1001219542 342
220 3300005536 Ga0070697_100191788 Ga0070697_1001917882 342
221 3300005545 Ga0070695_100002748 Ga0070695_1000027484 342
222 3300005545 Ga0070695_100003470 Ga0070695_1000034706 342
223 3300005549 Ga0070704_100039910 Ga0070704_1000399103 342
224 3300006844 Ga0075428_100014281 Ga0075428_1000142815 342
225 3300006871 Ga0075434_100013838 Ga0075434_1000138383 342
226 3300006871 Ga0075434_100027923 Ga0075434_1000279233 342
227 3300007076 Ga0075435_100018514 Ga0075435_1000185143 342
228 3300007076 Ga0075435_100033560 Ga0075435_1000335603 342
229 3300007265 Ga0099794_10000532 Ga0099794_100005324 342
230 3300009147 Ga0114129_10052466 Ga0114129_100524662 342
231 3300025906 Ga0207699_10033717 Ga0207699_100337172 342
232 3300025910 Ga0207684_10005205 Ga0207684_1000520510 342
233 3300025916 Ga0207663_10143157 Ga0207663_101431572 342
234 3300025917 Ga0207660_10057181 Ga0207660_100571813 342
235 3300025918 Ga0207662_10072316 Ga0207662_100723162 342
236 3300025922 Ga0207646_10006287 Ga0207646_100062876 342
237 3300026075 Ga0207708_10019444 Ga0207708_100194443 342
238 3300026118 Ga0207675_100179154 Ga0207675_1001791542 342
239 3300027671 Ga0209588_1000472 Ga0209588_10004724 342
240 3300027671 Ga0209588_1003811 Ga0209588_10038113 342
241 3300038996 Ga0242420_003325 Ga0242420_003325_1318_2346 342
242 3300044673 Ga0453683_0038029 Ga0453683_0038029_970_1998 342
243 3300045051 Ga0451576_0023385 Ga0451576_0023385_4219_5247 342
244 3300045051 Ga0451576_0072366 Ga0451576_0072366_1502_2530 342
245 3300046539 Ga0495621_0016813 Ga0495621_0016813_1007_2035 342
246 3300050512 nmdc:mga0n895_12275_c1 nmdc:mga0n895_12275_c1_1143_2171 342
247 3300050512 nmdc:mga0n895_128267_c1 nmdc:mga0n895_128267_c1_582_1610 342
248 3300050513 nmdc:mga0rr50_383882_c1 nmdc:mga0rr50_383882_c1_14_1042 342
249 3300050513 nmdc:mga0rr50_50081_c1 nmdc:mga0rr50_50081_c1_19_1047 342
250 3300050513 nmdc:mga0rr50_96991_c1 nmdc:mga0rr50_96991_c1_695_1723 342
251 3300050514 nmdc:mga08x19_9853_c1 nmdc:mga08x19_9853_c1_3580_4608 342
252 3300050515 nmdc:mga0a205_30733_c1 nmdc:mga0a205_30733_c1_291_1319 342
253 3300035724 Ga0373933_0096404 Ga0373933_0096404_135_1172 344
254 3300041486 Ga0451807_1289396 Ga0451807_1289396_416_1450 344
255 3300041512 Ga0451853_3540105 Ga0451853_3540105_58_1092 344
256 3300003322 rootL2_10144645 rootL2_101446452 345
257 3300005355 Ga0070671_100000547 Ga0070671_10000054720 345
258 3300005445 Ga0070708_100000841 Ga0070708_10000084115 345
259 3300005467 Ga0070706_100107831 Ga0070706_1001078312 345
260 3300005937 Ga0081455_10078098 Ga0081455_100780982 345
261 3300006847 Ga0075431_100006584 Ga0075431_1000065844 345
262 3300031901 Ga0307406_10077029 Ga0307406_100770292 345
263 3300050510 nmdc:mga06r32_2021_c1 nmdc:mga06r32_2021_c1_8145_9182 345
264 2162886012 MBSR1b_contig_6764082 MBSR1b_0422.00006630 346
265 3300005293 Ga0065715_10010773 Ga0065715_100107733 346
266 3300005329 Ga0070683_100046257 Ga0070683_1000462573 346
267 3300005336 Ga0070680_100000563 Ga0070680_1000005632 346
268 3300005336 Ga0070680_100063341 Ga0070680_1000633412 346
269 3300005345 Ga0070692_10095777 Ga0070692_100957771 346
270 3300005366 Ga0070659_100134927 Ga0070659_1001349272 346
271 3300005367 Ga0070667_100045430 Ga0070667_1000454303 346
272 3300005439 Ga0070711_100072494 Ga0070711_1000724942 346
273 3300005440 Ga0070705_100034159 Ga0070705_1000341593 346
274 3300005444 Ga0070694_100036379 Ga0070694_1000363794 346
275 3300005444 Ga0070694_100054667 Ga0070694_1000546673 346
276 3300005445 Ga0070708_100027069 Ga0070708_1000270693 346
277 3300005445 Ga0070708_100047328 Ga0070708_1000473283 346
278 3300005458 Ga0070681_10201265 Ga0070681_102012652 346
279 3300005466 Ga0070685_10128833 Ga0070685_101288332 346
280 3300005467 Ga0070706_100004320 Ga0070706_10000432013 346
281 3300005467 Ga0070706_100228837 Ga0070706_1002288372 346
282 3300005468 Ga0070707_100026761 Ga0070707_1000267612 346
283 3300005468 Ga0070707_100141471 Ga0070707_1001414712 346
284 3300005518 Ga0070699_100010879 Ga0070699_1000108792 346
285 3300005518 Ga0070699_100014082 Ga0070699_1000140827 346
286 3300005518 Ga0070699_100073820 Ga0070699_1000738202 346
287 3300005536 Ga0070697_100001210 Ga0070697_1000012104 346
288 3300005536 Ga0070697_100018508 Ga0070697_1000185084 346
289 3300005543 Ga0070672_100261260 Ga0070672_1002612602 346
290 3300005544 Ga0070686_100127259 Ga0070686_1001272592 346
291 3300005546 Ga0070696_100011147 Ga0070696_1000111473 346
292 3300005546 Ga0070696_100016401 Ga0070696_1000164012 346
293 3300005546 Ga0070696_100078767 Ga0070696_1000787672 346
294 3300005549 Ga0070704_100005335 Ga0070704_1000053358 346
295 3300005564 Ga0070664_100095176 Ga0070664_1000951762 346
296 3300005577 Ga0068857_100166605 Ga0068857_1001666051 346
297 3300005578 Ga0068854_100127631 Ga0068854_1001276312 346
298 3300005841 Ga0068863_100092901 Ga0068863_1000929013 346
299 3300006871 Ga0075434_100009731 Ga0075434_1000097315 346
300 3300006871 Ga0075434_100035434 Ga0075434_1000354346 346
301 3300006871 Ga0075434_100108678 Ga0075434_1001086782 346
302 3300006914 Ga0075436_100052135 Ga0075436_1000521352 346
303 3300007076 Ga0075435_100245836 Ga0075435_1002458362 346
304 3300009147 Ga0114129_10000435 Ga0114129_1000043515 346
305 3300009148 Ga0105243_10059134 Ga0105243_100591342 346
306 3300009553 Ga0105249_10034321 Ga0105249_100343212 346
307 3300010375 Ga0105239_10015267 Ga0105239_100152678 346
308 3300010375 Ga0105239_10300487 Ga0105239_103004871 346
309 3300013308 Ga0157375_10302824 Ga0157375_103028241 346
310 3300014969 Ga0157376_10024731 Ga0157376_100247312 346
311 3300025910 Ga0207684_10080380 Ga0207684_100803802 346
312 3300025912 Ga0207707_10004162 Ga0207707_100041623 346
313 3300025912 Ga0207707_10161547 Ga0207707_101615472 346
314 3300025912 Ga0207707_10186090 Ga0207707_101860902 346
315 3300025916 Ga0207663_10114614 Ga0207663_101146142 346
316 3300025917 Ga0207660_10002194 Ga0207660_100021943 346
317 3300025917 Ga0207660_10062333 Ga0207660_100623332 346
318 3300025920 Ga0207649_10079305 Ga0207649_100793052 346
319 3300025920 Ga0207649_10117952 Ga0207649_101179522 346
320 3300025921 Ga0207652_10001085 Ga0207652_1000108520 346
321 3300025922 Ga0207646_10015713 Ga0207646_100157135 346
322 3300025932 Ga0207690_10115444 Ga0207690_101154442 346
323 3300025933 Ga0207706_10034245 Ga0207706_100342452 346
324 3300025940 Ga0207691_10071230 Ga0207691_100712302 346
325 3300025945 Ga0207679_10043142 Ga0207679_100431422 346
326 3300025960 Ga0207651_10082603 Ga0207651_100826032 346
327 3300025981 Ga0207640_10169554 Ga0207640_101695542 346
328 3300026067 Ga0207678_10095040 Ga0207678_100950402 346
329 3300026088 Ga0207641_10108556 Ga0207641_101085562 346
330 3300031548 Ga0307408_100024616 Ga0307408_1000246162 346
331 3300031548 Ga0307408_100088773 Ga0307408_1000887732 346
332 3300031548 Ga0307408_100094230 Ga0307408_1000942302 346
333 3300031548 Ga0307408_100145784 Ga0307408_1001457842 346
334 3300031731 Ga0307405_10003049 Ga0307405_100030492 346
335 3300031731 Ga0307405_10056139 Ga0307405_100561392 346
336 3300031824 Ga0307413_10015203 Ga0307413_100152032 346
337 3300031824 Ga0307413_10034080 Ga0307413_100340803 346
338 3300031824 Ga0307413_10108732 Ga0307413_101087322 346
339 3300031824 Ga0307413_10178107 Ga0307413_101781072 346
340 3300031824 Ga0307413_10182373 Ga0307413_101823732 346
341 3300031852 Ga0307410_10004890 Ga0307410_100048903 346
342 3300031852 Ga0307410_10006210 Ga0307410_100062102 346
343 3300031852 Ga0307410_10025801 Ga0307410_100258013 346
344 3300031852 Ga0307410_10026310 Ga0307410_100263102 346
345 3300031852 Ga0307410_10070186 Ga0307410_100701862 346
346 3300031852 Ga0307410_10087067 Ga0307410_100870671 346
347 3300031852 Ga0307410_10136583 Ga0307410_101365832 346
348 3300031852 Ga0307410_10283957 Ga0307410_102839572 346
349 3300031901 Ga0307406_10012753 Ga0307406_100127532 346
350 3300031901 Ga0307406_10019787 Ga0307406_100197874 346
351 3300031901 Ga0307406_10053159 Ga0307406_100531591 346
352 3300031903 Ga0307407_10111127 Ga0307407_101111272 346
353 3300031903 Ga0307407_10212646 Ga0307407_102126461 346
354 3300031911 Ga0307412_10013570 Ga0307412_100135705 346
355 3300031911 Ga0307412_10145142 Ga0307412_101451421 346
356 3300031995 Ga0307409_100000536 Ga0307409_1000005362 346
357 3300031995 Ga0307409_100017616 Ga0307409_1000176162 346
358 3300031995 Ga0307409_100024072 Ga0307409_1000240722 346
359 3300031995 Ga0307409_100033102 Ga0307409_1000331024 346
360 3300031995 Ga0307409_100104718 Ga0307409_1001047182 346
361 3300032002 Ga0307416_100001321 Ga0307416_1000013218 346
362 3300032002 Ga0307416_100006664 Ga0307416_1000066645 346
363 3300032002 Ga0307416_100007989 Ga0307416_1000079892 346
364 3300032002 Ga0307416_100021784 Ga0307416_1000217842 346
365 3300032002 Ga0307416_100038204 Ga0307416_1000382041 346
366 3300032002 Ga0307416_100065470 Ga0307416_1000654702 346
367 3300032004 Ga0307414_10066895 Ga0307414_100668951 346
368 3300032004 Ga0307414_10076238 Ga0307414_100762382 346
369 3300032004 Ga0307414_10227803 Ga0307414_102278032 346
370 3300032004 Ga0307414_10258363 Ga0307414_102583632 346
371 3300032005 Ga0307411_10000590 Ga0307411_1000059011 346
372 3300032005 Ga0307411_10015500 Ga0307411_100155003 346
373 3300032005 Ga0307411_10038149 Ga0307411_100381492 346
374 3300032005 Ga0307411_10116872 Ga0307411_101168721 346
375 3300032005 Ga0307411_10401259 Ga0307411_104012591 346
376 3300032126 Ga0307415_100007411 Ga0307415_1000074114 346
377 3300032126 Ga0307415_100034713 Ga0307415_1000347132 346
378 3300032126 Ga0307415_100042051 Ga0307415_1000420513 346
379 3300032126 Ga0307415_100068538 Ga0307415_1000685382 346
380 3300035241 Ga0373961_0031639 Ga0373961_0031639_133_1173 346
381 3300035691 Ga0373931_0011188 Ga0373931_0011188_2793_3833 346
382 3300035691 Ga0373931_0174294 Ga0373931_0174294_175_1215 346
383 3300041404 Ga0439436_0040508 Ga0439436_0040508_70_1113 346
384 3300041406 Ga0439439_0002597 Ga0439439_0002597_791_1834 346
385 3300042876 Ga0451577_0009265 Ga0451577_0009265_815_1873 346
386 3300046499 Ga0495594_0167566 Ga0495594_0167566_145_1185 346
387 3300046526 Ga0495666_0003052 Ga0495666_0003052_5437_6495 346
388 3300046533 Ga0495640_0059091 Ga0495640_0059091_787_1845 346
389 3300046535 Ga0495586_0004818 Ga0495586_0004818_4102_5142 346
390 3300046642 Ga0495634_0006516 Ga0495634_0006516_5161_6219 346
391 3300046681 Ga0495647_0013216 Ga0495647_0013216_1225_2283 346
392 3300046683 Ga0495658_0037955 Ga0495658_0037955_1586_2644 346
393 3300047319 Ga0495674_0111237 Ga0495674_0111237_134_1174 346
394 3300048904 Ga0496101_0072196 Ga0496101_0072196_1399_2439 346
395 3300048905 Ga0496102_0055680 Ga0496102_0055680_1647_2687 346
396 3300048906 Ga0496103_0003742 Ga0496103_0003742_3044_4084 346
397 3300048907 Ga0496104_0017078 Ga0496104_0017078_1779_2819 346
398 3300048907 Ga0496104_0025928 Ga0496104_0025928_489_1529 346
399 3300048908 Ga0496105_0186386 Ga0496105_0186386_372_1412 346
400 3300048909 Ga0496106_0013722 Ga0496106_0013722_1505_2545 346
401 3300048909 Ga0496106_0165888 Ga0496106_0165888_447_1487 346
402 3300048910 Ga0496107_0064243 Ga0496107_0064243_1500_2540 346
403 3300048910 Ga0496107_0094153 Ga0496107_0094153_418_1458 346
404 3300048911 Ga0496108_0010442 Ga0496108_0010442_6322_7362 346
405 3300048911 Ga0496108_0040916 Ga0496108_0040916_1726_2766 346
406 3300048912 Ga0496109_0017756 Ga0496109_0017756_3061_4101 346
407 3300048912 Ga0496109_0023345 Ga0496109_0023345_1960_3000 346
408 3300048913 Ga0496110_0047034 Ga0496110_0047034_1043_2083 346
409 3300048914 Ga0496111_0003464 Ga0496111_0003464_3313_4353 346
410 3300048914 Ga0496111_0128097 Ga0496111_0128097_12_1052 346
411 3300048915 Ga0496112_0039079 Ga0496112_0039079_367_1407 346
412 3300048915 Ga0496112_0057685 Ga0496112_0057685_547_1587 346
413 3300048916 Ga0496113_0009408 Ga0496113_0009408_2841_3881 346
414 3300048916 Ga0496113_0068683 Ga0496113_0068683_1447_2487 346
415 3300048918 Ga0496115_0026526 Ga0496115_0026526_2162_3202 346
416 3300049571 Ga0501034_0016611 Ga0501034_0016611_512_1555 346
417 3300049581 Ga0501047_0080094 Ga0501047_0080094_1729_2772 346
418 3300049583 Ga0501067_0018790 Ga0501067_0018790_518_1561 346
419 3300049584 Ga0501068_0000058 Ga0501068_0000058_17685_18728 346
420 3300049585 Ga0501069_0046580 Ga0501069_0046580_994_2037 346
421 3300049586 Ga0501070_0016680 Ga0501070_0016680_4641_5684 346
422 3300049587 Ga0501071_0003403 Ga0501071_0003403_941_1984 346
423 3300049588 Ga0501072_0026948 Ga0501072_0026948_369_1412 346
424 3300049589 Ga0501073_0048821 Ga0501073_0048821_1466_2509 346
425 3300049590 Ga0501074_0002224 Ga0501074_0002224_7900_8943 346
426 3300049660 Ga0501216_000398 Ga0501216_000398_3461_4501 346
427 3300049677 Ga0501247_007188 Ga0501247_007188_69_1109 346
428 3300049708 Ga0501245_014363 Ga0501245_014363_42_1082 346
429 3300049742 Ga0501080_0082077 Ga0501080_0082077_486_1529 346
430 3300049742 Ga0501080_0149773 Ga0501080_0149773_660_1700 346
431 3300049744 Ga0501083_0002456 Ga0501083_0002456_1380_2423 346
432 3300049764 Ga0501267_003101 Ga0501267_003101_402_1442 346
433 3300050507 nmdc:mga05p37_3026_c1 nmdc:mga05p37_3026_c1_3250_4290 346
434 3300050508 nmdc:mga09592_36241_c1 nmdc:mga09592_36241_c1_1812_2852 346
435 3300050512 nmdc:mga0n895_10607_c1 nmdc:mga0n895_10607_c1_4468_5508 346
436 3300050513 nmdc:mga0rr50_202688_c1 nmdc:mga0rr50_202688_c1_202_1242 346
437 3300050514 nmdc:mga08x19_56866_c1 nmdc:mga08x19_56866_c1_1427_2467 346
438 3300054114 Ga0501084_0001573 Ga0501084_0001573_16830_17873 346
439 3300059421 Ga0590071_000618 Ga0590071_000618_3124_4164 346
440 3300059421 Ga0590071_013429 Ga0590071_013429_49_1089 346
441 3300059421 Ga0590071_018369 Ga0590071_018369_133_1173 346
442 3300059423 Ga0590074_000946 Ga0590074_000946_1640_2680 346
443 3300059426 Ga0590077_002684 Ga0590077_002684_1130_2170 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

182

313

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

29

145

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

215

348

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9256 1 343
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9154 1 343
2dfv-assembly3.cif.gz_C hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii 0.9092 2 345
2d8a-assembly1.cif.gz_A crystal structure of ph0655 from pyrococcus horikoshii ot3 0.9039 1 343
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9014 1 343
ID Description Score Start End Superfamily
2dfvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9753 156 289 3.40.50.720
2dfvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9611 156 289 3.40.50.720
2ejvB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9511 156 289 3.40.50.720
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9434 3 151 3.90.180.10
af_P07913_155_286_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.939 157 289 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A520E7Q9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9561 164 267
AF-A0A328IQU6-F1-model_v4 deleted 0.9379 1 343
AF-A0A3D1R0P5-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9354 1 162 GO:0008270
GO:0008743
AF-A0A7D8YZT4-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9351 1 343 GO:0008270
GO:0008743
AF-A0A7C4K9A8-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9341 1 343 GO:0008270
GO:0008743

Feature Viewer

pLDDT pTM Quality
89.87 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map