F445116

General Info

Members Datasets Scaffolds Average Seq Length
443 228 886 289

Family's Representative Sequence

Representative Sequence 3300035117|Ga0373953_0117668|Ga0373953_0117668_26_955
Length 309
Sequence MILIVLAIGLFGAATYVLLTGLTVRQREVAVTLRKAKRYGMQSQREVETRRSVNERLVGPLTAKLAAVTQRFMPRTDPNLIANRLMAAGLARSMSPQMYLALKGGLIFTAIAFGGIVLVSGAVSPVIGLLVALGGAAIGYIAPDFFINSKIRARRDLMQMELPNVLDLLCVSVEAGLGFDAAVAKLSERMVGPLVDEFGLVLHEMRIGESRSEALKNLSERVDVPEVSQFCRAIIQADQLGIALSRILRVQSHDMRVRRQLAAEEKAMKAPVKMLFPTVLFXXXSMFVVALGPAALNLMQTFSGGAPGK

Samples

Sample ID Description Type Environment
1 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
118 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
121 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 8.8
Rhizosphere 89.84
Stem 0
Stem Tuber 0
Unclassified 11.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373953_0117668 3300035117 Bacteria 1127
2 JGI25407J50210_10000163 3300003373 Bacteria 10674
3 Ga0070683_100000526 3300005329 Bacteria 26899
4 Ga0070683_100014856 3300005329 Bacteria 6826
5 Ga0070683_100087829 3300005329 Bacteria 2916
6 Ga0070682_100392199 3300005337 Bacteria 1047
7 Ga0068868_100066673 3300005338 Bacteria 2863
8 Ga0070668_100010985 3300005347 Bacteria 6740
9 Ga0070671_100343400 3300005355 Bacteria 1274
10 Ga0070688_100008028 3300005365 Bacteria 5711
11 Ga0070709_10056205 3300005434 Bacteria 2488
12 Ga0070709_10098195 3300005434 Bacteria 1946
13 Ga0070709_10116392 3300005434 Unclassified 1804
14 Ga0070714_100010830 3300005435 Bacteria 7223
15 Ga0070714_100026217 3300005435 Bacteria 4815
16 Ga0070714_100028860 3300005435 Bacteria 4607
17 Ga0070714_100073790 3300005435 Bacteria 2956
18 Ga0070710_10076581 3300005437 Bacteria 1942
19 Ga0070710_10107817 3300005437 Bacteria 1669
20 Ga0070710_10117009 3300005437 Bacteria 1608
21 Ga0070710_10134687 3300005437 Bacteria 1509
22 Ga0070711_100060624 3300005439 Bacteria 2631
23 Ga0070711_100116541 3300005439 Bacteria 1968
24 Ga0070705_100025446 3300005440 Bacteria 3209
25 Ga0070694_100047353 3300005444 Bacteria 2889
26 Ga0070708_100060856 3300005445 Bacteria 3371
27 Ga0070708_100080895 3300005445 Unclassified 2940
28 Ga0070708_100124037 3300005445 Bacteria 2386
29 Ga0070662_100026929 3300005457 Bacteria 3986
30 Ga0070681_10189393 3300005458 Unclassified 1977
31 Ga0070685_10143051 3300005466 Bacteria 1508
32 Ga0070706_100232320 3300005467 Bacteria 1722
33 Ga0070706_100238006 3300005467 Bacteria 1700
34 Ga0070707_100028015 3300005468 Bacteria 5358
35 Ga0070707_100051393 3300005468 Bacteria 3952
36 Ga0070707_100066588 3300005468 Bacteria 3462
37 Ga0070698_100032960 3300005471 Bacteria 5366
38 Ga0070698_100048801 3300005471 Bacteria 4325
39 Ga0070699_100136193 3300005518 Bacteria 2166
40 Ga0070679_100075480 3300005530 Bacteria 3360
41 Ga0070679_100097659 3300005530 Unclassified 2925
42 Ga0070684_100002252 3300005535 Bacteria 14186
43 Ga0070684_100008720 3300005535 Bacteria 7949
44 Ga0070684_100023721 3300005535 Bacteria 5137
45 Ga0070684_100082025 3300005535 Bacteria 2854
46 Ga0070684_100482538 3300005535 Unclassified 1147
47 Ga0070695_100048569 3300005545 Unclassified 2714
48 Ga0070695_100104521 3300005545 Unclassified 1912
49 Ga0070696_100008677 3300005546 Bacteria 6801
50 Ga0070693_100108009 3300005547 Bacteria 1706
51 Ga0070704_100103406 3300005549 Bacteria 2151
52 Ga0068855_100088397 3300005563 Bacteria 3579
53 Ga0068855_100111618 3300005563 Bacteria 3139
54 Ga0068857_100000350 3300005577 Bacteria 31927
55 Ga0068857_100077731 3300005577 Bacteria 2962
56 Ga0068854_100052069 3300005578 Bacteria 2934
57 Ga0068856_100338045 3300005614 Bacteria 1524
58 Ga0068856_100380610 3300005614 Bacteria 1430
59 Ga0070702_100059725 3300005615 Bacteria 2214
60 Ga0068861_100187027 3300005719 Unclassified 1728
61 Ga0081538_10000850 3300005981 Bacteria 32938
62 Ga0081538_10001205 3300005981 Bacteria 27126
63 Ga0081538_10002806 3300005981 Bacteria 16689
64 Ga0081538_10004822 3300005981 Bacteria 12292
65 Ga0081538_10008577 3300005981 Bacteria 8651
66 Ga0081540_1001637 3300005983 Bacteria 19084
67 Ga0070717_10045853 3300006028 Bacteria 3575
68 Ga0070717_10144093 3300006028 Bacteria 2057
69 Ga0070717_10288856 3300006028 Bacteria 1456
70 Ga0075365_10069422 3300006038 Unclassified 2368
71 Ga0075364_10065550 3300006051 Bacteria 2384
72 Ga0075432_10003191 3300006058 Bacteria 5534
73 Ga0070715_10105186 3300006163 Bacteria 1323
74 Ga0070712_100050967 3300006175 Bacteria 2882
75 Ga0070712_100134676 3300006175 Unclassified 1877
76 Ga0070712_100209980 3300006175 Bacteria 1534
77 Ga0070712_100285505 3300006175 Bacteria 1331
78 Ga0068871_100123445 3300006358 Bacteria 2190
79 Ga0075428_100063580 3300006844 Bacteria 4041
80 Ga0075428_100109613 3300006844 Bacteria 3007
81 Ga0075428_100846123 3300006844 Bacteria 971
82 Ga0075430_100029919 3300006846 Bacteria 4624
83 Ga0075431_100022561 3300006847 Bacteria 6436
84 Ga0075433_10002007 3300006852 Bacteria 15334
85 Ga0075433_10082137 3300006852 Bacteria 2842
86 Ga0075433_10130919 3300006852 Unclassified 2229
87 Ga0075433_10259708 3300006852 Bacteria 1540
88 Ga0075434_100001220 3300006871 Bacteria 21365
89 Ga0075434_100007099 3300006871 Bacteria 10345
90 Ga0075434_100119158 3300006871 Unclassified 2653
91 Ga0075434_100129632 3300006871 Bacteria 2540
92 Ga0075434_100144360 3300006871 Bacteria 2400
93 Ga0075434_100411554 3300006871 Bacteria 1373
94 Ga0075434_100469380 3300006871 Bacteria 1280
95 Ga0075434_100782147 3300006871 Bacteria 971
96 Ga0075429_100060852 3300006880 Bacteria 3288
97 Ga0075429_100583529 3300006880 Bacteria 979
98 Ga0075436_100001556 3300006914 Bacteria 15652
99 Ga0075436_100007191 3300006914 Bacteria 7613
100 Ga0075435_100000771 3300007076 Bacteria 19831
101 Ga0075435_100023717 3300007076 Bacteria 4750
102 Ga0075435_100130412 3300007076 Bacteria 2103
103 Ga0075435_100221578 3300007076 Bacteria 1606
104 Ga0105240_10118232 3300009093 Bacteria 3194
105 Ga0111539_10097804 3300009094 Bacteria 3448
106 Ga0111539_10276627 3300009094 Bacteria 1953
107 Ga0111539_10412431 3300009094 Bacteria 1573
108 Ga0105245_10084362 3300009098 Bacteria 2910
109 Ga0105245_10116046 3300009098 Bacteria 2496
110 Ga0105245_10116457 3300009098 Bacteria 2492
111 Ga0105245_10512556 3300009098 Bacteria 1217
112 Ga0114129_10030662 3300009147 Bacteria 7606
113 Ga0114129_10077611 3300009147 Bacteria 4620
114 Ga0114129_10471853 3300009147 Bacteria 1643
115 Ga0114129_10962113 3300009147 Bacteria 1078
116 Ga0105243_10003978 3300009148 Bacteria 11787
117 Ga0105243_10048401 3300009148 Bacteria 3351
118 Ga0105249_10202733 3300009553 Bacteria 1942
119 Ga0105239_10061160 3300010375 Bacteria 4133
120 Ga0105239_10830405 3300010375 Bacteria 1059
121 Ga0157370_10216046 3300013104 Bacteria 1777
122 Ga0157378_10202826 3300013297 Bacteria 1876
123 Ga0157372_10443716 3300013307 Bacteria 1513
124 Ga0157375_10035873 3300013308 Bacteria 4738
125 Ga0157375_10186143 3300013308 Bacteria 2230
126 Ga0206354_11385960 3300020081 Bacteria 1221
127 Ga0207692_10020032 3300025898 Bacteria 3034
128 Ga0207642_10031929 3300025899 Bacteria 2212
129 Ga0207699_10068501 3300025906 Bacteria 2161
130 Ga0207699_10156729 3300025906 Bacteria 1512
131 Ga0207684_10056226 3300025910 Unclassified 3338
132 Ga0207684_10197428 3300025910 Bacteria 1735
133 Ga0207695_10063783 3300025913 Bacteria 3796
134 Ga0207693_10001568 3300025915 Bacteria 20186
135 Ga0207693_10022133 3300025915 Bacteria 5054
136 Ga0207663_10004100 3300025916 Bacteria 7226
137 Ga0207660_10260854 3300025917 Bacteria 1370
138 Ga0207652_10242654 3300025921 Bacteria 1624
139 Ga0207646_10020805 3300025922 Bacteria 6075
140 Ga0207646_10090002 3300025922 Bacteria 2747
141 Ga0207646_10123184 3300025922 Bacteria 2330
142 Ga0207687_10134125 3300025927 Bacteria 1870
143 Ga0207664_10100518 3300025929 Bacteria 2388
144 Ga0207644_10268619 3300025931 Bacteria 1366
145 Ga0207706_10006238 3300025933 Bacteria 11081
146 Ga0207665_10010852 3300025939 Bacteria 5982
147 Ga0207665_10021687 3300025939 Bacteria 4225
148 Ga0207711_10387981 3300025941 Bacteria 1296
149 Ga0207661_10007346 3300025944 Bacteria 7838
150 Ga0207661_10023533 3300025944 Bacteria 4656
151 Ga0207679_10229657 3300025945 Bacteria 1566
152 Ga0207667_10135992 3300025949 Bacteria 2531
153 Ga0207667_10151549 3300025949 Bacteria 2386
154 Ga0207712_10006034 3300025961 Bacteria 7642
155 Ga0207668_10016356 3300025972 Bacteria 4628
156 Ga0207677_10139364 3300026023 Bacteria 1855
157 Ga0207702_10123198 3300026078 Bacteria 2323
158 Ga0207674_10001137 3300026116 Bacteria 34520
159 Ga0207674_10066989 3300026116 Unclassified 3616
160 Ga0207675_100001912 3300026118 Bacteria 20780
161 Ga0207675_100587164 3300026118 Bacteria 1116
162 Ga0207683_10100437 3300026121 Bacteria 2583
163 Ga0207428_10005538 3300027907 Bacteria 11764
164 Ga0265336_10037519 3300028666 Unclassified 1489
165 Ga0265338_10074259 3300028800 Bacteria 2893
166 Ga0265338_10120647 3300028800 Bacteria 2090
167 Ga0265339_10030797 3300031249 Bacteria 3035
168 Ga0265316_10047010 3300031344 Bacteria 3416
169 Ga0265313_10035935 3300031595 Bacteria 2490
170 Ga0265314_10021094 3300031711 Bacteria 5018
171 Ga0307410_10161513 3300031852 Bacteria 1679
172 Ga0307407_10080499 3300031903 Unclassified 1968
173 Ga0307412_10095853 3300031911 Bacteria 2087
174 Ga0307409_100032599 3300031995 Bacteria 3780
175 Ga0307409_100271281 3300031995 Bacteria 1562
176 Ga0307416_100015372 3300032002 Bacteria 5285
177 Ga0307416_100105072 3300032002 Bacteria 2471
178 Ga0307414_10511585 3300032004 Unclassified 1064
179 Ga0307411_10094063 3300032005 Bacteria 2100
180 Ga0307415_100316161 3300032126 Bacteria 1300
181 Ga0373956_0083768 3300035119 Bacteria 1466
182 Ga0373956_0101476 3300035119 Bacteria 1335
183 Ga0373960_0072898 3300035121 Unclassified 1066
184 Ga0373943_0014247 3300035170 Bacteria 3597
185 Ga0373935_0054032 3300035692 Bacteria 2556
186 Ga0373927_0012463 3300035695 Bacteria 5662
187 Ga0373947_0007248 3300035725 Bacteria 6427
188 Ga0373937_0103574 3300036401 Bacteria 2643
189 Ga0395899_0003801 3300037312 Bacteria 11924
190 Ga0395899_0074852 3300037312 Bacteria 2473
191 Ga0395900_0011229 3300037418 Bacteria 9161
192 Ga0395900_0011762 3300037418 Bacteria 8948
193 Ga0395900_0011951 3300037418 Bacteria 8878
194 Ga0395900_0035193 3300037418 Bacteria 5159
195 Ga0395900_0035393 3300037418 Bacteria 5142
196 Ga0395900_0060923 3300037418 Bacteria 3882
197 Ga0395900_0105059 3300037418 Bacteria 2902
198 Ga0395900_0127902 3300037418 Unclassified 2604
199 Ga0395900_0157520 3300037418 Bacteria 2319
200 Ga0395900_0180090 3300037418 Bacteria 2148
201 Ga0395900_0203766 3300037418 Unclassified 2000
202 Ga0395900_0316584 3300037418 Unclassified 1542
203 Ga0395898_0004822 3300037466 Bacteria 14674
204 Ga0395898_0005827 3300037466 Bacteria 13258
205 Ga0395898_0005972 3300037466 Bacteria 13076
206 Ga0395898_0023322 3300037466 Bacteria 6255
207 Ga0395898_0027528 3300037466 Bacteria 5704
208 Ga0395898_0030554 3300037466 Bacteria 5390
209 Ga0395898_0084824 3300037466 Bacteria 3053
210 Ga0395898_0106828 3300037466 Bacteria 2685
211 Ga0395898_0361836 3300037466 Unclassified 1383
212 Ga0395898_0399244 3300037466 Unclassified 1311
213 Ga0395905_0002721 3300037471 Bacteria 19368
214 Ga0395905_0017315 3300037471 Bacteria 6842
215 Ga0395905_0021007 3300037471 Bacteria 6182
216 Ga0395905_0053042 3300037471 Unclassified 3796
217 Ga0395905_0097452 3300037471 Bacteria 2761
218 Ga0395905_0154494 3300037471 Bacteria 2158
219 Ga0395905_0262327 3300037471 Bacteria 1613
220 Ga0395905_0581306 3300037471 Unclassified 1022
221 Ga0395901_0005099 3300038443 Bacteria 13267
222 Ga0395901_0013957 3300038443 Bacteria 8175
223 Ga0395901_0033264 3300038443 Bacteria 5322
224 Ga0395901_0039052 3300038443 Bacteria 4911
225 Ga0395901_0049957 3300038443 Bacteria 4346
226 Ga0395901_0061563 3300038443 Bacteria 3905
227 Ga0395901_0096953 3300038443 Bacteria 3090
228 Ga0395901_0107602 3300038443 Bacteria 2927
229 Ga0395901_0139019 3300038443 Bacteria 2553
230 Ga0439453_0001711 3300041408 Bacteria 2885
231 Ga0439461_0005780 3300041410 Bacteria 2126
232 Ga0451853_0677689 3300041512 Bacteria 2339
233 Ga0439451_000165 3300042009 Bacteria 12295
234 Ga0439454_004546 3300042011 Unclassified 1607
235 Ga0439460_0015579 3300042461 Unclassified 2015
236 Ga0466972_0120115 3300044658 Bacteria 1240
237 Ga0466963_0003850 3300044694 Bacteria 8656
238 Ga0466963_0012173 3300044694 Bacteria 5258
239 Ga0466963_0046548 3300044694 Bacteria 2860
240 Ga0466963_0047372 3300044694 Bacteria 2837
241 Ga0466963_0238858 3300044694 Bacteria 1274
242 Ga0466964_0036917 3300044706 Unclassified 1961
243 Ga0466971_0072596 3300044719 Bacteria 1564
244 Ga0466971_0156782 3300044719 Bacteria 1064
245 Ga0466968_0014438 3300044735 Unclassified 3122
246 Ga0466968_0030367 3300044735 Bacteria 2238
247 Ga0466968_0037436 3300044735 Bacteria 2035
248 Ga0466957_0224922 3300044842 Bacteria 1240
249 Ga0466960_0005624 3300044901 Bacteria 4973
250 Ga0466960_0009828 3300044901 Bacteria 3955
251 Ga0466960_0020798 3300044901 Bacteria 2913
252 Ga0466960_0021544 3300044901 Bacteria 2871
253 Ga0466960_0044877 3300044901 Bacteria 2109
254 Ga0466958_0167820 3300045836 Bacteria 1389
255 Ga0466967_0000763 3300045976 Bacteria 16637
256 Ga0466967_0015757 3300045976 Bacteria 5938
257 Ga0466967_0029068 3300045976 Bacteria 4622
258 Ga0466967_0056071 3300045976 Unclassified 3473
259 Ga0466967_0075821 3300045976 Bacteria 3023
260 Ga0466967_0092680 3300045976 Bacteria 2747
261 Ga0466967_0200089 3300045976 Bacteria 1891
262 Ga0466967_0262301 3300045976 Bacteria 1653
263 Ga0466967_0434614 3300045976 Bacteria 1281
264 Ga0466967_0689243 3300045976 Bacteria 1011
265 Ga0495592_0146312 3300046454 Bacteria 1638
266 Ga0495592_0169263 3300046454 Unclassified 1497
267 Ga0495653_0170552 3300046463 Bacteria 1502
268 Ga0495653_0237495 3300046463 Bacteria 1217
269 Ga0495580_0107075 3300046472 Bacteria 1941
270 Ga0495582_0010306 3300046473 Bacteria 5141
271 Ga0495584_0066062 3300046491 Bacteria 1819
272 Ga0495596_0075250 3300046500 Bacteria 1311
273 Ga0495607_0092395 3300046501 Bacteria 1637
274 Ga0495618_0010242 3300046514 Bacteria 5672
275 Ga0495618_0149526 3300046514 Unclassified 1492
276 Ga0495628_0054980 3300046516 Unclassified 3136
277 Ga0495630_0136219 3300046517 Bacteria 1866
278 Ga0495630_0202463 3300046517 Bacteria 1515
279 Ga0495637_0023806 3300046520 Bacteria 2776
280 Ga0495637_0046407 3300046520 Bacteria 1838
281 Ga0495642_0019259 3300046528 Bacteria 2675
282 Ga0495652_0141617 3300046529 Unclassified 1890
283 Ga0495652_0233259 3300046529 Bacteria 1375
284 Ga0495652_0276002 3300046529 Bacteria 1233
285 Ga0495640_0053974 3300046533 Bacteria 2755
286 Ga0495586_0011753 3300046535 Bacteria 4655
287 Ga0495633_0048720 3300046558 Bacteria 2000
288 Ga0495667_0024598 3300046559 Bacteria 4056
289 Ga0495667_0133616 3300046559 Unclassified 1600
290 Ga0495656_0087275 3300046615 Bacteria 1420
291 Ga0495634_0289075 3300046642 Bacteria 994
292 Ga0495659_0084505 3300046664 Bacteria 1210
293 Ga0495599_0208567 3300046678 Unclassified 1199
294 Ga0495647_0024959 3300046681 Bacteria 2180
295 Ga0495658_0077553 3300046683 Bacteria 1943
296 Ga0495613_0115624 3300046689 Unclassified 1930
297 Ga0495624_0116095 3300046690 Bacteria 1645
298 Ga0495624_0134736 3300046690 Bacteria 1514
299 Ga0495581_0004615 3300047315 Bacteria 7958
300 Ga0495581_0296665 3300047315 Bacteria 945
301 Ga0495674_0176735 3300047319 Bacteria 1779
302 Ga0495674_0233509 3300047319 Unclassified 1517
303 Ga0495674_0396803 3300047319 Bacteria 1114
304 Ga0495674_0441666 3300047319 Bacteria 1046
305 Ga0495676_0067453 3300047321 Bacteria 2768
306 Ga0495680_0004390 3300047322 Bacteria 13500
307 Ga0495680_0245484 3300047322 Bacteria 1270
308 Ga0495684_0084710 3300047471 Bacteria 2404
309 Ga0495684_0116507 3300047471 Bacteria 2014
310 Ga0495684_0197454 3300047471 Bacteria 1485
311 Ga0495593_0052135 3300047673 Bacteria 2163
312 Ga0495602_0286258 3300048088 Bacteria 1212
313 Ga0495626_0019676 3300048091 Bacteria 3373
314 Ga0496100_0007690 3300048903 Bacteria 5965
315 Ga0496100_0157255 3300048903 Unclassified 1626
316 Ga0496100_0349641 3300048903 Unclassified 1116
317 Ga0496101_0012499 3300048904 Bacteria 5666
318 Ga0496101_0216118 3300048904 Bacteria 1486
319 Ga0496104_0001108 3300048907 Bacteria 23034
320 Ga0496104_0136664 3300048907 Bacteria 2355
321 Ga0496104_0177234 3300048907 Unclassified 2042
322 Ga0496104_0473810 3300048907 Bacteria 1163
323 Ga0496105_0002279 3300048908 Bacteria 13921
324 Ga0496105_0048276 3300048908 Bacteria 3514
325 Ga0496105_0140708 3300048908 Bacteria 1986
326 Ga0496105_0239905 3300048908 Bacteria 1471
327 Ga0496106_0043408 3300048909 Bacteria 3373
328 Ga0496106_0266776 3300048909 Bacteria 1370
329 Ga0496107_0038757 3300048910 Bacteria 3417
330 Ga0496108_0017117 3300048911 Bacteria 5928
331 Ga0496108_0020857 3300048911 Bacteria 5389
332 Ga0496108_0169399 3300048911 Bacteria 1889
333 Ga0496109_0001161 3300048912 Bacteria 21914
334 Ga0496109_0013768 3300048912 Bacteria 7028
335 Ga0496109_0050195 3300048912 Bacteria 3800
336 Ga0496109_0058685 3300048912 Bacteria 3515
337 Ga0496109_0176756 3300048912 Unclassified 2004
338 Ga0496109_0731129 3300048912 Bacteria 927
339 Ga0496110_0011079 3300048913 Bacteria 7364
340 Ga0496110_0024699 3300048913 Bacteria 5125
341 Ga0496111_0042557 3300048914 Bacteria 3262
342 Ga0496111_0054637 3300048914 Bacteria 2887
343 Ga0496111_0125466 3300048914 Bacteria 1897
344 Ga0496111_0128346 3300048914 Unclassified 1875
345 Ga0496112_0111474 3300048915 Bacteria 2706
346 Ga0496112_0298187 3300048915 Bacteria 1557
347 Ga0496113_0065091 3300048916 Bacteria 2758
348 Ga0496113_0170456 3300048916 Bacteria 1724
349 Ga0496114_0040833 3300048917 Bacteria 3843
350 Ga0496114_0043998 3300048917 Bacteria 3703
351 Ga0496115_0007815 3300048918 Bacteria 7884
352 Ga0496115_0016771 3300048918 Bacteria 5582
353 Ga0496126_0093450 3300048929 Bacteria 2641
354 Ga0501031_0002814 3300049568 Bacteria 11111
355 Ga0501031_0151485 3300049568 Bacteria 1515
356 Ga0501032_0031170 3300049569 Unclassified 3656
357 Ga0501033_0015282 3300049570 Bacteria 5823
358 Ga0501034_0086859 3300049571 Bacteria 3128
359 Ga0501036_0027967 3300049572 Bacteria 4767
360 Ga0501038_0003878 3300049574 Bacteria 13902
361 Ga0501038_0054092 3300049574 Bacteria 3453
362 Ga0501039_0004348 3300049575 Bacteria 10682
363 Ga0501039_0036555 3300049575 Bacteria 3790
364 Ga0501040_0043239 3300049576 Bacteria 3070
365 Ga0501041_0001852 3300049577 Bacteria 11855
366 Ga0501041_0005880 3300049577 Bacteria 7170
367 Ga0501042_0002541 3300049578 Bacteria 11223
368 Ga0501042_0002798 3300049578 Bacteria 10790
369 Ga0501043_0001776 3300049579 Bacteria 18542
370 Ga0501046_0001511 3300049580 Bacteria 22177
371 Ga0501046_0194893 3300049580 Bacteria 1510
372 Ga0501048_0002119 3300049582 Bacteria 15124
373 Ga0501067_0005315 3300049583 Bacteria 7157
374 Ga0501067_0046028 3300049583 Bacteria 2421
375 Ga0501068_0000290 3300049584 Bacteria 24966
376 Ga0501069_0002080 3300049585 Bacteria 10073
377 Ga0501069_0006985 3300049585 Bacteria 5906
378 Ga0501070_0002502 3300049586 Bacteria 16104
379 Ga0501070_0294088 3300049586 Bacteria 1324
380 Ga0501070_0354381 3300049586 Bacteria 1191
381 Ga0501071_0003884 3300049587 Bacteria 9413
382 Ga0501071_0046477 3300049587 Unclassified 3117
383 Ga0501072_0029624 3300049588 Unclassified 4276
384 Ga0501072_0099978 3300049588 Bacteria 2305
385 Ga0501073_0103785 3300049589 Unclassified 1973
386 Ga0501074_0003583 3300049590 Bacteria 11018
387 Ga0501075_0066301 3300049591 Bacteria 2724
388 Ga0501076_0003965 3300049592 Bacteria 10452
389 Ga0501076_0045435 3300049592 Unclassified 3467
390 Ga0501076_0046798 3300049592 Bacteria 3419
391 Ga0501079_0050104 3300049741 Unclassified 3223
392 Ga0501079_0051495 3300049741 Bacteria 3179
393 Ga0501080_0004718 3300049742 Bacteria 12160
394 Ga0501081_0003150 3300049743 Bacteria 10488
395 Ga0501081_0008291 3300049743 Bacteria 6743
396 Ga0501081_0100817 3300049743 Bacteria 2041
397 Ga0501083_0002607 3300049744 Bacteria 12410
398 Ga0501035_0002466 3300049822 Bacteria 18065
399 Ga0501035_0208435 3300049822 Bacteria 1673
400 Ga0501044_0032377 3300049823 Bacteria 5497
401 Ga0501045_0019712 3300049824 Bacteria 4812
402 Ga0501045_0048512 3300049824 Unclassified 3095
403 nmdc:mga00v17_99506_c1 3300050491 Bacteria 1834
404 nmdc:mga0yw44_96604_c1 3300050492 Bacteria 1876
405 nmdc:mga05p37_239949_c1 3300050507 Bacteria 2180
406 nmdc:mga05p37_83445_c1 3300050507 Bacteria 3937
407 nmdc:mga09592_67557_c1 3300050508 Bacteria 3032
408 nmdc:mga0qj67_27016_c1 3300050509 Bacteria 4446
409 nmdc:mga06r32_10046_c1 3300050510 Bacteria 8543
410 nmdc:mga06r32_200332_c1 3300050510 Bacteria 1984
411 nmdc:mga06r32_659681_c1 3300050510 Bacteria 1014
412 nmdc:mga08y16_109748_c1 3300050511 Bacteria 2872
413 nmdc:mga08y16_17098_c1 3300050511 Bacteria 6471
414 nmdc:mga08y16_244932_c1 3300050511 Bacteria 1853
415 nmdc:mga0n895_4302_c1 3300050512 Bacteria 11663
416 nmdc:mga0n895_49201_c1 3300050512 Bacteria 4129
417 nmdc:mga0n895_5732_c1 3300050512 Bacteria 10424
418 nmdc:mga0n895_680305_c1 3300050512 Bacteria 1026
419 nmdc:mga0n895_8930_c1 3300050512 Bacteria 8735
420 nmdc:mga0n895_90697_c1 3300050512 Bacteria 3058
421 nmdc:mga0rr50_1600_c1 3300050513 Bacteria 12474
422 nmdc:mga0rr50_19930_c1 3300050513 Bacteria 4540
423 nmdc:mga0rr50_219961_c1 3300050513 Bacteria 1568
424 nmdc:mga0rr50_22336_c1 3300050513 Bacteria 4341
425 nmdc:mga08x19_13422_c1 3300050514 Bacteria 4953
426 nmdc:mga08x19_37654_c1 3300050514 Bacteria 3071
427 nmdc:mga08x19_9765_c1 3300050514 Bacteria 5751
428 nmdc:mga0a205_309879_c1 3300050515 Bacteria 1451
429 nmdc:mga0a205_351690_c1 3300050515 Bacteria 1341
430 nmdc:mga0a205_3597_c1 3300050515 Bacteria 13872
431 nmdc:mga0a205_38898_c1 3300050515 Bacteria 4578
432 nmdc:mga0a205_82314_c1 3300050515 Bacteria 3109
433 Ga0495601_0061841 3300053077 Bacteria 2377
434 Ga0495612_0037025 3300053078 Unclassified 1981
435 Ga0495595_0018565 3300053084 Unclassified 3007
436 Ga0495619_0004799 3300053085 Bacteria 8587
437 Ga0495619_0009326 3300053085 Bacteria 6195
438 Ga0501084_0008326 3300054114 Bacteria 8558
439 Ga0590071_016370 3300059421 Bacteria 1740
440 Ga0501082_0085383 3300060353 Bacteria 2722
441 Ga0501082_0239545 3300060353 Bacteria 1579
442 Ga0530510_0050956 3300061734 Unclassified 2990
443 Ga0530510_0055687 3300061734 Bacteria 2857
444 Ga0373953_0117668
445 JGI25407J50210_10000163
446 Ga0070683_100000526
447 Ga0070683_100014856
448 Ga0070683_100087829
449 Ga0070682_100392199
450 Ga0068868_100066673
451 Ga0070668_100010985
452 Ga0070671_100343400
453 Ga0070688_100008028
454 Ga0070709_10056205
455 Ga0070709_10098195
456 Ga0070709_10116392
457 Ga0070714_100010830
458 Ga0070714_100026217
459 Ga0070714_100028860
460 Ga0070714_100073790
461 Ga0070710_10076581
462 Ga0070710_10107817
463 Ga0070710_10117009
464 Ga0070710_10134687
465 Ga0070711_100060624
466 Ga0070711_100116541
467 Ga0070705_100025446
468 Ga0070694_100047353
469 Ga0070708_100060856
470 Ga0070708_100080895
471 Ga0070708_100124037
472 Ga0070662_100026929
473 Ga0070681_10189393
474 Ga0070685_10143051
475 Ga0070706_100232320
476 Ga0070706_100238006
477 Ga0070707_100028015
478 Ga0070707_100051393
479 Ga0070707_100066588
480 Ga0070698_100032960
481 Ga0070698_100048801
482 Ga0070699_100136193
483 Ga0070679_100075480
484 Ga0070679_100097659
485 Ga0070684_100002252
486 Ga0070684_100008720
487 Ga0070684_100023721
488 Ga0070684_100082025
489 Ga0070684_100482538
490 Ga0070695_100048569
491 Ga0070695_100104521
492 Ga0070696_100008677
493 Ga0070693_100108009
494 Ga0070704_100103406
495 Ga0068855_100088397
496 Ga0068855_100111618
497 Ga0068857_100000350
498 Ga0068857_100077731
499 Ga0068854_100052069
500 Ga0068856_100338045
501 Ga0068856_100380610
502 Ga0070702_100059725
503 Ga0068861_100187027
504 Ga0081538_10000850
505 Ga0081538_10001205
506 Ga0081538_10002806
507 Ga0081538_10004822
508 Ga0081538_10008577
509 Ga0081540_1001637
510 Ga0070717_10045853
511 Ga0070717_10144093
512 Ga0070717_10288856
513 Ga0075365_10069422
514 Ga0075364_10065550
515 Ga0075432_10003191
516 Ga0070715_10105186
517 Ga0070712_100050967
518 Ga0070712_100134676
519 Ga0070712_100209980
520 Ga0070712_100285505
521 Ga0068871_100123445
522 Ga0075428_100063580
523 Ga0075428_100109613
524 Ga0075428_100846123
525 Ga0075430_100029919
526 Ga0075431_100022561
527 Ga0075433_10002007
528 Ga0075433_10082137
529 Ga0075433_10130919
530 Ga0075433_10259708
531 Ga0075434_100001220
532 Ga0075434_100007099
533 Ga0075434_100119158
534 Ga0075434_100129632
535 Ga0075434_100144360
536 Ga0075434_100411554
537 Ga0075434_100469380
538 Ga0075434_100782147
539 Ga0075429_100060852
540 Ga0075429_100583529
541 Ga0075436_100001556
542 Ga0075436_100007191
543 Ga0075435_100000771
544 Ga0075435_100023717
545 Ga0075435_100130412
546 Ga0075435_100221578
547 Ga0105240_10118232
548 Ga0111539_10097804
549 Ga0111539_10276627
550 Ga0111539_10412431
551 Ga0105245_10084362
552 Ga0105245_10116046
553 Ga0105245_10116457
554 Ga0105245_10512556
555 Ga0114129_10030662
556 Ga0114129_10077611
557 Ga0114129_10471853
558 Ga0114129_10962113
559 Ga0105243_10003978
560 Ga0105243_10048401
561 Ga0105249_10202733
562 Ga0105239_10061160
563 Ga0105239_10830405
564 Ga0157370_10216046
565 Ga0157378_10202826
566 Ga0157372_10443716
567 Ga0157375_10035873
568 Ga0157375_10186143
569 Ga0206354_11385960
570 Ga0207692_10020032
571 Ga0207642_10031929
572 Ga0207699_10068501
573 Ga0207699_10156729
574 Ga0207684_10056226
575 Ga0207684_10197428
576 Ga0207695_10063783
577 Ga0207693_10001568
578 Ga0207693_10022133
579 Ga0207663_10004100
580 Ga0207660_10260854
581 Ga0207652_10242654
582 Ga0207646_10020805
583 Ga0207646_10090002
584 Ga0207646_10123184
585 Ga0207687_10134125
586 Ga0207664_10100518
587 Ga0207644_10268619
588 Ga0207706_10006238
589 Ga0207665_10010852
590 Ga0207665_10021687
591 Ga0207711_10387981
592 Ga0207661_10007346
593 Ga0207661_10023533
594 Ga0207679_10229657
595 Ga0207667_10135992
596 Ga0207667_10151549
597 Ga0207712_10006034
598 Ga0207668_10016356
599 Ga0207677_10139364
600 Ga0207702_10123198
601 Ga0207674_10001137
602 Ga0207674_10066989
603 Ga0207675_100001912
604 Ga0207675_100587164
605 Ga0207683_10100437
606 Ga0207428_10005538
607 Ga0265336_10037519
608 Ga0265338_10074259
609 Ga0265338_10120647
610 Ga0265339_10030797
611 Ga0265316_10047010
612 Ga0265313_10035935
613 Ga0265314_10021094
614 Ga0307410_10161513
615 Ga0307407_10080499
616 Ga0307412_10095853
617 Ga0307409_100032599
618 Ga0307409_100271281
619 Ga0307416_100015372
620 Ga0307416_100105072
621 Ga0307414_10511585
622 Ga0307411_10094063
623 Ga0307415_100316161
624 Ga0373956_0083768
625 Ga0373956_0101476
626 Ga0373960_0072898
627 Ga0373943_0014247
628 Ga0373935_0054032
629 Ga0373927_0012463
630 Ga0373947_0007248
631 Ga0373937_0103574
632 Ga0395899_0003801
633 Ga0395899_0074852
634 Ga0395900_0011229
635 Ga0395900_0011762
636 Ga0395900_0011951
637 Ga0395900_0035193
638 Ga0395900_0035393
639 Ga0395900_0060923
640 Ga0395900_0105059
641 Ga0395900_0127902
642 Ga0395900_0157520
643 Ga0395900_0180090
644 Ga0395900_0203766
645 Ga0395900_0316584
646 Ga0395898_0004822
647 Ga0395898_0005827
648 Ga0395898_0005972
649 Ga0395898_0023322
650 Ga0395898_0027528
651 Ga0395898_0030554
652 Ga0395898_0084824
653 Ga0395898_0106828
654 Ga0395898_0361836
655 Ga0395898_0399244
656 Ga0395905_0002721
657 Ga0395905_0017315
658 Ga0395905_0021007
659 Ga0395905_0053042
660 Ga0395905_0097452
661 Ga0395905_0154494
662 Ga0395905_0262327
663 Ga0395905_0581306
664 Ga0395901_0005099
665 Ga0395901_0013957
666 Ga0395901_0033264
667 Ga0395901_0039052
668 Ga0395901_0049957
669 Ga0395901_0061563
670 Ga0395901_0096953
671 Ga0395901_0107602
672 Ga0395901_0139019
673 Ga0439453_0001711
674 Ga0439461_0005780
675 Ga0451853_0677689
676 Ga0439451_000165
677 Ga0439454_004546
678 Ga0439460_0015579
679 Ga0466972_0120115
680 Ga0466963_0003850
681 Ga0466963_0012173
682 Ga0466963_0046548
683 Ga0466963_0047372
684 Ga0466963_0238858
685 Ga0466964_0036917
686 Ga0466971_0072596
687 Ga0466971_0156782
688 Ga0466968_0014438
689 Ga0466968_0030367
690 Ga0466968_0037436
691 Ga0466957_0224922
692 Ga0466960_0005624
693 Ga0466960_0009828
694 Ga0466960_0020798
695 Ga0466960_0021544
696 Ga0466960_0044877
697 Ga0466958_0167820
698 Ga0466967_0000763
699 Ga0466967_0015757
700 Ga0466967_0029068
701 Ga0466967_0056071
702 Ga0466967_0075821
703 Ga0466967_0092680
704 Ga0466967_0200089
705 Ga0466967_0262301
706 Ga0466967_0434614
707 Ga0466967_0689243
708 Ga0495592_0146312
709 Ga0495592_0169263
710 Ga0495653_0170552
711 Ga0495653_0237495
712 Ga0495580_0107075
713 Ga0495582_0010306
714 Ga0495584_0066062
715 Ga0495596_0075250
716 Ga0495607_0092395
717 Ga0495618_0010242
718 Ga0495618_0149526
719 Ga0495628_0054980
720 Ga0495630_0136219
721 Ga0495630_0202463
722 Ga0495637_0023806
723 Ga0495637_0046407
724 Ga0495642_0019259
725 Ga0495652_0141617
726 Ga0495652_0233259
727 Ga0495652_0276002
728 Ga0495640_0053974
729 Ga0495586_0011753
730 Ga0495633_0048720
731 Ga0495667_0024598
732 Ga0495667_0133616
733 Ga0495656_0087275
734 Ga0495634_0289075
735 Ga0495659_0084505
736 Ga0495599_0208567
737 Ga0495647_0024959
738 Ga0495658_0077553
739 Ga0495613_0115624
740 Ga0495624_0116095
741 Ga0495624_0134736
742 Ga0495581_0004615
743 Ga0495581_0296665
744 Ga0495674_0176735
745 Ga0495674_0233509
746 Ga0495674_0396803
747 Ga0495674_0441666
748 Ga0495676_0067453
749 Ga0495680_0004390
750 Ga0495680_0245484
751 Ga0495684_0084710
752 Ga0495684_0116507
753 Ga0495684_0197454
754 Ga0495593_0052135
755 Ga0495602_0286258
756 Ga0495626_0019676
757 Ga0496100_0007690
758 Ga0496100_0157255
759 Ga0496100_0349641
760 Ga0496101_0012499
761 Ga0496101_0216118
762 Ga0496104_0001108
763 Ga0496104_0136664
764 Ga0496104_0177234
765 Ga0496104_0473810
766 Ga0496105_0002279
767 Ga0496105_0048276
768 Ga0496105_0140708
769 Ga0496105_0239905
770 Ga0496106_0043408
771 Ga0496106_0266776
772 Ga0496107_0038757
773 Ga0496108_0017117
774 Ga0496108_0020857
775 Ga0496108_0169399
776 Ga0496109_0001161
777 Ga0496109_0013768
778 Ga0496109_0050195
779 Ga0496109_0058685
780 Ga0496109_0176756
781 Ga0496109_0731129
782 Ga0496110_0011079
783 Ga0496110_0024699
784 Ga0496111_0042557
785 Ga0496111_0054637
786 Ga0496111_0125466
787 Ga0496111_0128346
788 Ga0496112_0111474
789 Ga0496112_0298187
790 Ga0496113_0065091
791 Ga0496113_0170456
792 Ga0496114_0040833
793 Ga0496114_0043998
794 Ga0496115_0007815
795 Ga0496115_0016771
796 Ga0496126_0093450
797 Ga0501031_0002814
798 Ga0501031_0151485
799 Ga0501032_0031170
800 Ga0501033_0015282
801 Ga0501034_0086859
802 Ga0501036_0027967
803 Ga0501038_0003878
804 Ga0501038_0054092
805 Ga0501039_0004348
806 Ga0501039_0036555
807 Ga0501040_0043239
808 Ga0501041_0001852
809 Ga0501041_0005880
810 Ga0501042_0002541
811 Ga0501042_0002798
812 Ga0501043_0001776
813 Ga0501046_0001511
814 Ga0501046_0194893
815 Ga0501048_0002119
816 Ga0501067_0005315
817 Ga0501067_0046028
818 Ga0501068_0000290
819 Ga0501069_0002080
820 Ga0501069_0006985
821 Ga0501070_0002502
822 Ga0501070_0294088
823 Ga0501070_0354381
824 Ga0501071_0003884
825 Ga0501071_0046477
826 Ga0501072_0029624
827 Ga0501072_0099978
828 Ga0501073_0103785
829 Ga0501074_0003583
830 Ga0501075_0066301
831 Ga0501076_0003965
832 Ga0501076_0045435
833 Ga0501076_0046798
834 Ga0501079_0050104
835 Ga0501079_0051495
836 Ga0501080_0004718
837 Ga0501081_0003150
838 Ga0501081_0008291
839 Ga0501081_0100817
840 Ga0501083_0002607
841 Ga0501035_0002466
842 Ga0501035_0208435
843 Ga0501044_0032377
844 Ga0501045_0019712
845 Ga0501045_0048512
846 nmdc:mga00v17_99506_c1
847 nmdc:mga0yw44_96604_c1
848 nmdc:mga05p37_239949_c1
849 nmdc:mga05p37_83445_c1
850 nmdc:mga09592_67557_c1
851 nmdc:mga0qj67_27016_c1
852 nmdc:mga06r32_10046_c1
853 nmdc:mga06r32_200332_c1
854 nmdc:mga06r32_659681_c1
855 nmdc:mga08y16_109748_c1
856 nmdc:mga08y16_17098_c1
857 nmdc:mga08y16_244932_c1
858 nmdc:mga0n895_4302_c1
859 nmdc:mga0n895_49201_c1
860 nmdc:mga0n895_5732_c1
861 nmdc:mga0n895_680305_c1
862 nmdc:mga0n895_8930_c1
863 nmdc:mga0n895_90697_c1
864 nmdc:mga0rr50_1600_c1
865 nmdc:mga0rr50_19930_c1
866 nmdc:mga0rr50_219961_c1
867 nmdc:mga0rr50_22336_c1
868 nmdc:mga08x19_13422_c1
869 nmdc:mga08x19_37654_c1
870 nmdc:mga08x19_9765_c1
871 nmdc:mga0a205_309879_c1
872 nmdc:mga0a205_351690_c1
873 nmdc:mga0a205_3597_c1
874 nmdc:mga0a205_38898_c1
875 nmdc:mga0a205_82314_c1
876 Ga0495601_0061841
877 Ga0495612_0037025
878 Ga0495595_0018565
879 Ga0495619_0004799
880 Ga0495619_0009326
881 Ga0501084_0008326
882 Ga0590071_016370
883 Ga0501082_0085383
884 Ga0501082_0239545
885 Ga0530510_0050956
886 Ga0530510_0055687

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00482

T2SSF

Type II secretion system (T2SS), protein F

165

292

0.95

Map