F445083

General Info

Members Datasets Scaffolds Average Seq Length
443 225 440 348

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10000383|Ga0157380_1000038313
Length 356
Sequence MELGVYTFADMMPDKVSGRAINAHTRIQQLLEEIQLADQVSLDIFAVGEHHRPDYAISAPAVVLGAAAAITKNIKLSSAVTVLSSDDPVRVFQAFATVDLISGGRAEIMVGRGSFIESFPLFGYDLNEYDELFAEKLELLLKINQNEIVSWKGKHRRSLINLGVYPRPLQPSLPIWQAVGGTPQSAVRAGTLGLPMALAIIGGYPDKFVPFINLYRESGQKAGHENLPLGINSHVYVAETSQQAGDEFYPAYSAMMNRIGRERGWAPLRRMDFDAMRSPTGSLLVGSVDEVVDKILYEHSLFKNSRFLAQMSVGIMPHDKILRSIELFGNKVAPAVKKALAAPVDKTKAKQEVNEK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2818991444 Filimonas endophytica 3197 Isolate Unclassified
4 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 2.48
Rhizosphere 92.33
Stem 0
Stem Tuber 0
Unclassified 4.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_254312 2162886007 Bacteria 3901
2 JGI24735J21928_10053640 3300002067 Unclassified 1162
3 JGI25406J46586_10006818 3300003203 Bacteria 5245
4 rootL2_10076218 3300003322 Bacteria 1728
5 rootL2_10168539 3300003322 Bacteria 6265
6 rootH1_10005049 3300003323 Bacteria 11651
7 Ga0070658_10077638 3300005327 Bacteria 2724
8 Ga0070658_10106805 3300005327 Unclassified 2316
9 Ga0070658_10214326 3300005327 Bacteria 1627
10 Ga0070683_100000236 3300005329 Bacteria 37800
11 Ga0070683_100015553 3300005329 Bacteria 6688
12 Ga0070670_100228845 3300005331 Bacteria 1618
13 Ga0070670_100286993 3300005331 Bacteria 1437
14 Ga0070677_10009308 3300005333 Bacteria 3328
15 Ga0070680_100028337 3300005336 Bacteria 4491
16 Ga0070680_100037636 3300005336 Unclassified 3909
17 Ga0070680_100045335 3300005336 Bacteria 3574
18 Ga0070682_100000315 3300005337 Bacteria 33359
19 Ga0068868_100150844 3300005338 Unclassified 1914
20 Ga0070660_100004805 3300005339 Bacteria 9345
21 Ga0070660_100021267 3300005339 Bacteria 4781
22 Ga0070660_100060283 3300005339 Bacteria 2945
23 Ga0070660_100402811 3300005339 Bacteria 1131
24 Ga0070689_100151430 3300005340 Bacteria 1871
25 Ga0070691_10000896 3300005341 Bacteria 12075
26 Ga0070671_100183094 3300005355 Bacteria 1774
27 Ga0070674_100075580 3300005356 Bacteria 2393
28 Ga0070673_100090424 3300005364 Bacteria 2501
29 Ga0070673_100370041 3300005364 Unclassified 1276
30 Ga0070659_100040509 3300005366 Bacteria 3641
31 Ga0070659_100041451 3300005366 Bacteria 3598
32 Ga0070659_100061700 3300005366 Bacteria 2963
33 Ga0070659_100211169 3300005366 Bacteria 1600
34 Ga0070667_100100663 3300005367 Bacteria 2496
35 Ga0070709_10000842 3300005434 Bacteria 17172
36 Ga0070714_100019674 3300005435 Bacteria 5504
37 Ga0070714_100027027 3300005435 Bacteria 4748
38 Ga0070711_100061528 3300005439 Bacteria 2614
39 Ga0070708_100000022 3300005445 Bacteria 113297
40 Ga0070708_100063220 3300005445 Bacteria 3313
41 Ga0070663_100029008 3300005455 Bacteria 3775
42 Ga0070663_100094816 3300005455 Bacteria 2217
43 Ga0070678_100013313 3300005456 Bacteria 5152
44 Ga0070678_100129349 3300005456 Bacteria 2004
45 Ga0070662_100205634 3300005457 Bacteria 1564
46 Ga0070681_10052182 3300005458 Bacteria 4078
47 Ga0070681_10078008 3300005458 Bacteria 3269
48 Ga0070681_10318721 3300005458 Bacteria 1464
49 Ga0070685_10020157 3300005466 Bacteria 3607
50 Ga0070685_10036049 3300005466 Bacteria 2795
51 Ga0070706_100001535 3300005467 Bacteria 24133
52 Ga0070698_100050706 3300005471 Unclassified 4229
53 Ga0070699_100035352 3300005518 Bacteria 4319
54 Ga0070699_100140001 3300005518 Bacteria 2136
55 Ga0070679_100005166 3300005530 Bacteria 12080
56 Ga0070679_100010126 3300005530 Bacteria 8938
57 Ga0070679_100032553 3300005530 Bacteria 5158
58 Ga0070679_100090965 3300005530 Unclassified 3039
59 Ga0070679_100230837 3300005530 Unclassified 1810
60 Ga0070684_100001605 3300005535 Bacteria 16331
61 Ga0068853_100042831 3300005539 Bacteria 3872
62 Ga0068853_100067655 3300005539 Bacteria 3104
63 Ga0070672_100154910 3300005543 Unclassified 1898
64 Ga0070695_100054599 3300005545 Bacteria 2572
65 Ga0070693_100014807 3300005547 Bacteria 4006
66 Ga0070693_100030967 3300005547 Bacteria 2929
67 Ga0070665_100133748 3300005548 Bacteria 2482
68 Ga0068855_100007528 3300005563 Bacteria 13178
69 Ga0068855_100016426 3300005563 Bacteria 8899
70 Ga0068855_100095266 3300005563 Bacteria 3431
71 Ga0068855_100100676 3300005563 Bacteria 3327
72 Ga0068855_100105976 3300005563 Bacteria 3232
73 Ga0070664_100005547 3300005564 Bacteria 10133
74 Ga0068857_100096266 3300005577 Bacteria 2653
75 Ga0068857_100276843 3300005577 Bacteria 1543
76 Ga0068857_100400893 3300005577 Unclassified 1276
77 Ga0068856_100025417 3300005614 Bacteria 5776
78 Ga0070702_100079183 3300005615 Bacteria 1963
79 Ga0068866_10042854 3300005718 Bacteria 2255
80 Ga0068851_10000171 3300005834 Bacteria 33294
81 Ga0081455_10005121 3300005937 Bacteria 14453
82 Ga0081538_10011368 3300005981 Bacteria 7217
83 Ga0081538_10042943 3300005981 Bacteria 2846
84 Ga0081540_1003249 3300005983 Bacteria 12929
85 Ga0081539_10002306 3300005985 Bacteria 27511
86 Ga0081539_10004967 3300005985 Bacteria 14091
87 Ga0081539_10015145 3300005985 Bacteria 5633
88 Ga0070712_100090975 3300006175 Bacteria 2235
89 Ga0075367_10109305 3300006178 Bacteria 1696
90 Ga0097621_100318129 3300006237 Bacteria 1378
91 Ga0075431_100021106 3300006847 Bacteria 6656
92 Ga0075431_100056847 3300006847 Bacteria 4035
93 Ga0075429_100009688 3300006880 Bacteria 8352
94 Ga0075429_100035192 3300006880 Bacteria 4354
95 Ga0068865_100111955 3300006881 Bacteria 2015
96 Ga0075435_100039549 3300007076 Bacteria 3764
97 Ga0105240_10016585 3300009093 Bacteria 9967
98 Ga0111539_10033471 3300009094 Bacteria 6239
99 Ga0105245_10210283 3300009098 Bacteria 1872
100 Ga0114129_10025797 3300009147 Bacteria 8324
101 Ga0114129_10137924 3300009147 Bacteria 3346
102 Ga0114129_10295619 3300009147 Bacteria 2160
103 Ga0114129_10824425 3300009147 Bacteria 1181
104 Ga0105243_10000003 3300009148 Bacteria 712931
105 Ga0105243_10427060 3300009148 Bacteria 1238
106 Ga0105241_10010626 3300009174 Bacteria 6750
107 Ga0105248_10043814 3300009177 Bacteria 5018
108 Ga0105237_10206465 3300009545 Bacteria 1965
109 Ga0105237_10261111 3300009545 Bacteria 1734
110 Ga0105238_10001579 3300009551 Bacteria 22813
111 Ga0157373_10009211 3300013100 Bacteria 7301
112 Ga0157373_10013071 3300013100 Bacteria 6091
113 Ga0157373_10048853 3300013100 Bacteria 3016
114 Ga0157371_10000584 3300013102 Bacteria 43265
115 Ga0157371_10001101 3300013102 Bacteria 29303
116 Ga0157371_10003314 3300013102 Bacteria 14722
117 Ga0157371_10005044 3300013102 Bacteria 11291
118 Ga0157371_10006737 3300013102 Bacteria 9393
119 Ga0157371_10029488 3300013102 Bacteria 3967
120 Ga0157371_10058113 3300013102 Bacteria 2744
121 Ga0157371_10112750 3300013102 Bacteria 1930
122 Ga0157371_10137067 3300013102 Unclassified 1743
123 Ga0157370_10000821 3300013104 Bacteria 39240
124 Ga0157370_10001675 3300013104 Bacteria 27295
125 Ga0157370_10061411 3300013104 Bacteria 3567
126 Ga0157370_10065875 3300013104 Bacteria 3427
127 Ga0157370_10089620 3300013104 Bacteria 2889
128 Ga0157370_10173980 3300013104 Bacteria 2001
129 Ga0157370_10229755 3300013104 Bacteria 1717
130 Ga0157369_10062214 3300013105 Bacteria 4023
131 Ga0157369_10121014 3300013105 Bacteria 2778
132 Ga0157369_10134430 3300013105 Bacteria 2619
133 Ga0163162_10095354 3300013306 Bacteria 3062
134 Ga0157372_10021733 3300013307 Bacteria 6935
135 Ga0157372_10027898 3300013307 Bacteria 6154
136 Ga0157372_10030583 3300013307 Bacteria 5891
137 Ga0157372_10061828 3300013307 Bacteria 4194
138 Ga0157372_10078405 3300013307 Unclassified 3733
139 Ga0157372_10085048 3300013307 Bacteria 3587
140 Ga0157372_10256905 3300013307 Bacteria 2028
141 Ga0157372_10354850 3300013307 Bacteria 1709
142 Ga0157372_10384146 3300013307 Bacteria 1636
143 Ga0157372_10384556 3300013307 Bacteria 1635
144 Ga0157372_10389001 3300013307 Unclassified 1625
145 Ga0157375_10001388 3300013308 Bacteria 20910
146 Ga0157375_10167313 3300013308 Bacteria 2344
147 Ga0163163_10097337 3300014325 Bacteria 2963
148 Ga0157380_10000067 3300014326 Bacteria 58606
149 Ga0157380_10000383 3300014326 Bacteria 26712
150 Ga0157380_10014932 3300014326 Bacteria 5695
151 Ga0157380_10067083 3300014326 Bacteria 2888
152 Ga0157380_10186368 3300014326 Bacteria 1828
153 Ga0182008_10014581 3300014497 Bacteria 4111
154 Ga0157379_10043387 3300014968 Bacteria 4015
155 Ga0157379_10290298 3300014968 Bacteria 1489
156 Ga0157376_10493963 3300014969 Bacteria 1201
157 Ga0182007_10002043 3300015262 Bacteria 10364
158 Ga0182007_10003083 3300015262 Bacteria 8026
159 Ga0213876_10001274 3300021384 Bacteria 15905
160 Ga0213876_10003196 3300021384 Bacteria 9414
161 Ga0213876_10072671 3300021384 Unclassified 1816
162 Ga0213875_10000693 3300021388 Bacteria 26070
163 Ga0207656_10000250 3300025321 Bacteria 18780
164 Ga0207642_10032685 3300025899 Bacteria 2194
165 Ga0207680_10011709 3300025903 Bacteria 4442
166 Ga0207647_10065956 3300025904 Unclassified 2196
167 Ga0207699_10005231 3300025906 Bacteria 6210
168 Ga0207705_10018439 3300025909 Unclassified 4991
169 Ga0207705_10021406 3300025909 Bacteria 4614
170 Ga0207705_10050391 3300025909 Bacteria 2997
171 Ga0207705_10072741 3300025909 Bacteria 2494
172 Ga0207705_10135055 3300025909 Bacteria 1838
173 Ga0207684_10029871 3300025910 Bacteria 4640
174 Ga0207654_10012479 3300025911 Bacteria 4354
175 Ga0207707_10000456 3300025912 Bacteria 42593
176 Ga0207707_10031689 3300025912 Bacteria 4627
177 Ga0207707_10280275 3300025912 Bacteria 1444
178 Ga0207695_10242171 3300025913 Bacteria 1705
179 Ga0207671_10046745 3300025914 Bacteria 3203
180 Ga0207693_10213637 3300025915 Bacteria 1516
181 Ga0207660_10025045 3300025917 Bacteria 4047
182 Ga0207660_10029276 3300025917 Unclassified 3775
183 Ga0207657_10010191 3300025919 Bacteria 9389
184 Ga0207657_10015465 3300025919 Bacteria 7392
185 Ga0207657_10023224 3300025919 Bacteria 5780
186 Ga0207657_10087659 3300025919 Bacteria 2603
187 Ga0207657_10198653 3300025919 Bacteria 1614
188 Ga0207657_10212548 3300025919 Bacteria 1552
189 Ga0207649_10022703 3300025920 Bacteria 3625
190 Ga0207652_10000383 3300025921 Bacteria 46096
191 Ga0207652_10000831 3300025921 Bacteria 29402
192 Ga0207652_10000939 3300025921 Bacteria 27425
193 Ga0207652_10037201 3300025921 Bacteria 4119
194 Ga0207700_10051634 3300025928 Bacteria 3069
195 Ga0207700_10160746 3300025928 Bacteria 1865
196 Ga0207664_10190584 3300025929 Bacteria 1765
197 Ga0207664_10216687 3300025929 Bacteria 1658
198 Ga0207690_10121928 3300025932 Bacteria 1895
199 Ga0207690_10126222 3300025932 Bacteria 1866
200 Ga0207709_10000008 3300025935 Bacteria 713099
201 Ga0207665_10029800 3300025939 Bacteria 3606
202 Ga0207691_10073421 3300025940 Bacteria 3085
203 Ga0207711_10298780 3300025941 Bacteria 1485
204 Ga0207661_10007962 3300025944 Bacteria 7554
205 Ga0207661_10119193 3300025944 Bacteria 2244
206 Ga0207661_10228146 3300025944 Bacteria 1648
207 Ga0207667_10013719 3300025949 Bacteria 9262
208 Ga0207667_10015447 3300025949 Bacteria 8672
209 Ga0207667_10038893 3300025949 Bacteria 5073
210 Ga0207667_10098002 3300025949 Bacteria 3025
211 Ga0207667_10108731 3300025949 Bacteria 2860
212 Ga0207667_10228629 3300025949 Bacteria 1905
213 Ga0207658_10355203 3300025986 Bacteria 1277
214 Ga0207639_10035987 3300026041 Bacteria 3666
215 Ga0207678_10021475 3300026067 Bacteria 5660
216 Ga0207702_10050237 3300026078 Bacteria 3520
217 Ga0207702_10098049 3300026078 Bacteria 2581
218 Ga0207648_10065526 3300026089 Bacteria 3167
219 Ga0207674_10006140 3300026116 Bacteria 14191
220 Ga0207683_10003439 3300026121 Bacteria 13800
221 Ga0207683_10091228 3300026121 Bacteria 2714
222 Ga0268265_10133411 3300028380 Bacteria 2068
223 Ga0265322_10004498 3300028654 Bacteria 4149
224 Ga0265330_10002857 3300031235 Bacteria 9237
225 Ga0265332_10061071 3300031238 Bacteria 1612
226 Ga0265327_10000234 3300031251 Bacteria 112034
227 Ga0265327_10034543 3300031251 Bacteria 2804
228 Ga0307408_100016961 3300031548 Bacteria 4869
229 Ga0307408_100028097 3300031548 Bacteria 3884
230 Ga0307408_100123170 3300031548 Bacteria 2012
231 Ga0265342_10000391 3300031712 Bacteria 48414
232 Ga0316576_10080975 3300031727 Bacteria 2409
233 Ga0307516_10028154 3300031730 Bacteria 5689
234 Ga0307405_10008832 3300031731 Bacteria 5133
235 Ga0307405_10019981 3300031731 Bacteria 3732
236 Ga0307413_10003399 3300031824 Bacteria 6695
237 Ga0307413_10094431 3300031824 Bacteria 1958
238 Ga0307413_10150789 3300031824 Bacteria 1620
239 Ga0307413_10295294 3300031824 Bacteria 1226
240 Ga0307410_10062399 3300031852 Bacteria 2553
241 Ga0307410_10107631 3300031852 Bacteria 2011
242 Ga0307406_10003498 3300031901 Bacteria 8551
243 Ga0307412_10006717 3300031911 Bacteria 6522
244 Ga0307409_100024644 3300031995 Bacteria 4200
245 Ga0307409_100271241 3300031995 Bacteria 1563
246 Ga0307416_100000645 3300032002 Bacteria 17987
247 Ga0307416_100009110 3300032002 Bacteria 6468
248 Ga0307416_100014539 3300032002 Bacteria 5401
249 Ga0307416_100099362 3300032002 Bacteria 2527
250 Ga0307414_10002657 3300032004 Bacteria 9407
251 Ga0307414_10010586 3300032004 Bacteria 5361
252 Ga0307414_10101653 3300032004 Bacteria 2165
253 Ga0307414_10102579 3300032004 Bacteria 2156
254 Ga0307411_10163906 3300032005 Bacteria 1668
255 Ga0307415_100001074 3300032126 Bacteria 12718
256 Ga0307415_100016388 3300032126 Bacteria 4416
257 Ga0307415_100060415 3300032126 Bacteria 2619
258 Ga0307415_100158415 3300032126 Bacteria 1752
259 Ga0373955_0024699 3300035172 Bacteria 3076
260 Ga0373933_0047088 3300035724 Bacteria 2563
261 Ga0373937_0011668 3300036401 Bacteria 7709
262 Ga0395899_0006917 3300037312 Bacteria 8785
263 Ga0395899_0009618 3300037312 Bacteria 7419
264 Ga0395899_0048931 3300037312 Bacteria 3143
265 Ga0395899_0091217 3300037312 Bacteria 2208
266 Ga0395900_0000203 3300037418 Bacteria 93536
267 Ga0395900_0027824 3300037418 Bacteria 5792
268 Ga0395900_0041156 3300037418 Bacteria 4764
269 Ga0395900_0061350 3300037418 Bacteria 3865
270 Ga0395900_0078098 3300037418 Bacteria 3401
271 Ga0395898_0001285 3300037466 Bacteria 36916
272 Ga0395898_0120233 3300037466 Bacteria 2516
273 Ga0395898_0247238 3300037466 Bacteria 1701
274 Ga0436364_0040101 3300037853 Bacteria 5260
275 Ga0436364_0638094 3300037853 Bacteria 6292
276 Ga0436364_1156440 3300037853 Bacteria 43375
277 Ga0395901_0002230 3300038443 Bacteria 19784
278 Ga0395901_0071453 3300038443 Bacteria 3617
279 Ga0395901_0201345 3300038443 Bacteria 2087
280 Ga0395901_0247845 3300038443 Bacteria 1856
281 Ga0436365_0004784 3300039437 Bacteria 42373
282 Ga0436365_0226253 3300039437 Bacteria 24079
283 Ga0436365_1207904 3300039437 Bacteria 13850
284 Ga0436365_1709655 3300039437 Unclassified 1816
285 Ga0436362_1129554 3300039453 Bacteria 2924
286 Ga0451577_0000723 3300042876 Bacteria 51136
287 Ga0451577_0101910 3300042876 Bacteria 2565
288 Ga0451577_0265560 3300042876 Bacteria 1554
289 Ga0453683_0000747 3300044673 Bacteria 32801
290 Ga0466966_0004073 3300044684 Bacteria 9650
291 Ga0466966_0063806 3300044684 Bacteria 2320
292 Ga0466961_0099188 3300044693 Bacteria 1836
293 Ga0466961_0134056 3300044693 Bacteria 1552
294 Ga0466963_0001189 3300044694 Bacteria 13695
295 Ga0453684_0000033 3300044712 Bacteria 734012
296 Ga0453684_0007166 3300044712 Bacteria 20738
297 Ga0453684_0016322 3300044712 Bacteria 11626
298 Ga0466971_0143981 3300044719 Bacteria 1111
299 Ga0466959_0038572 3300045049 Bacteria 3530
300 Ga0466959_0072964 3300045049 Bacteria 2483
301 Ga0451576_0004888 3300045051 Bacteria 17124
302 Ga0466967_0067161 3300045976 Bacteria 3198
303 Ga0495603_0179565 3300046455 Bacteria 1225
304 Ga0495653_0000907 3300046463 Bacteria 22917
305 Ga0495664_0111251 3300046477 Bacteria 1653
306 Ga0495608_0143089 3300046511 Bacteria 1526
307 Ga0495645_0000022 3300046543 Bacteria 137019
308 Ga0495657_0000041 3300046675 Bacteria 115251
309 Ga0495613_0143852 3300046689 Bacteria 1703
310 Ga0495636_0000333 3300047318 Bacteria 18073
311 Ga0495674_0199008 3300047319 Bacteria 1663
312 Ga0495674_0245097 3300047319 Bacteria 1476
313 Ga0495680_0090707 3300047322 Bacteria 2292
314 Ga0495684_0058470 3300047471 Bacteria 2937
315 Ga0496101_0098620 3300048904 Bacteria 2183
316 Ga0496102_0040605 3300048905 Bacteria 4209
317 Ga0496104_0114190 3300048907 Bacteria 2590
318 Ga0496106_0057241 3300048909 Bacteria 2948
319 Ga0496107_0292594 3300048910 Bacteria 1212
320 Ga0496107_0306097 3300048910 Bacteria 1183
321 Ga0496111_0064027 3300048914 Bacteria 2667
322 Ga0496111_0291865 3300048914 Bacteria 1209
323 Ga0496112_0350928 3300048915 Bacteria 1418
324 Ga0496113_0055725 3300048916 Bacteria 2965
325 Ga0496114_0105473 3300048917 Bacteria 2411
326 Ga0496122_0014325 3300048925 Bacteria 7676
327 Ga0496123_0007946 3300048926 Bacteria 9846
328 Ga0496125_0157164 3300048928 Bacteria 1551
329 Ga0501031_0011072 3300049568 Bacteria 5878
330 Ga0501031_0064622 3300049568 Bacteria 2383
331 Ga0501031_0094239 3300049568 Bacteria 1954
332 Ga0501032_0023957 3300049569 Bacteria 4216
333 Ga0501032_0041693 3300049569 Bacteria 3116
334 Ga0501033_0017096 3300049570 Bacteria 5482
335 Ga0501033_0036122 3300049570 Bacteria 3703
336 Ga0501033_0068449 3300049570 Bacteria 2610
337 Ga0501033_0141884 3300049570 Bacteria 1736
338 Ga0501034_0002811 3300049571 Bacteria 20358
339 Ga0501034_0009934 3300049571 Bacteria 9946
340 Ga0501034_0024790 3300049571 Bacteria 6103
341 Ga0501034_0049541 3300049571 Bacteria 4238
342 Ga0501034_0102285 3300049571 Bacteria 2858
343 Ga0501034_0161392 3300049571 Bacteria 2212
344 Ga0501034_0184583 3300049571 Bacteria 2050
345 Ga0501036_0028227 3300049572 Unclassified 4744
346 Ga0501036_0081803 3300049572 Bacteria 2729
347 Ga0501037_0047899 3300049573 Bacteria 3132
348 Ga0501037_0057356 3300049573 Bacteria 2843
349 Ga0501037_0093647 3300049573 Bacteria 2172
350 Ga0501038_0021286 3300049574 Bacteria 5822
351 Ga0501038_0033830 3300049574 Unclassified 4498
352 Ga0501038_0100699 3300049574 Bacteria 2406
353 Ga0501039_0001109 3300049575 Bacteria 19797
354 Ga0501039_0134797 3300049575 Bacteria 1938
355 Ga0501039_0141451 3300049575 Bacteria 1890
356 Ga0501040_0013383 3300049576 Bacteria 5391
357 Ga0501040_0058005 3300049576 Bacteria 2658
358 Ga0501040_0070009 3300049576 Bacteria 2420
359 Ga0501041_0004521 3300049577 Bacteria 8066
360 Ga0501041_0029786 3300049577 Bacteria 3293
361 Ga0501041_0074044 3300049577 Bacteria 2092
362 Ga0501042_0005712 3300049578 Bacteria 8032
363 Ga0501043_0015884 3300049579 Bacteria 5902
364 Ga0501043_0016048 3300049579 Bacteria 5873
365 Ga0501043_0239628 3300049579 Unclassified 1399
366 Ga0501046_0004485 3300049580 Bacteria 12657
367 Ga0501046_0030253 3300049580 Bacteria 4395
368 Ga0501047_0004075 3300049581 Bacteria 13749
369 Ga0501047_0039448 3300049581 Bacteria 4567
370 Ga0501047_0044308 3300049581 Bacteria 4298
371 Ga0501047_0153102 3300049581 Bacteria 2181
372 Ga0501047_0250728 3300049581 Bacteria 1619
373 Ga0501048_0213807 3300049582 Bacteria 1367
374 Ga0501067_0075306 3300049583 Bacteria 1870
375 Ga0501068_0137473 3300049584 Bacteria 1530
376 Ga0501069_0021149 3300049585 Bacteria 3529
377 Ga0501069_0094041 3300049585 Bacteria 1696
378 Ga0501070_0000631 3300049586 Bacteria 32396
379 Ga0501070_0004818 3300049586 Bacteria 11531
380 Ga0501071_0021014 3300049587 Bacteria 4543
381 Ga0501071_0022767 3300049587 Bacteria 4370
382 Ga0501072_0011740 3300049588 Bacteria 6693
383 Ga0501072_0104293 3300049588 Bacteria 2254
384 Ga0501073_0062219 3300049589 Bacteria 2604
385 Ga0501073_0097286 3300049589 Bacteria 2044
386 Ga0501073_0207868 3300049589 Unclassified 1353
387 Ga0501074_0089764 3300049590 Bacteria 2201
388 Ga0501075_0003196 3300049591 Bacteria 10963
389 Ga0501075_0085301 3300049591 Bacteria 2392
390 Ga0501076_0006378 3300049592 Bacteria 8555
391 Ga0501076_0205645 3300049592 Bacteria 1608
392 Ga0501077_0013105 3300049593 Bacteria 5195
393 Ga0501077_0132366 3300049593 Bacteria 1581
394 Ga0501233_012733 3300049668 Bacteria 1694
395 Ga0501079_0018948 3300049741 Bacteria 5258
396 Ga0501079_0178009 3300049741 Bacteria 1659
397 Ga0501080_0000128 3300049742 Bacteria 53662
398 Ga0501080_0005261 3300049742 Bacteria 11525
399 Ga0501080_0100066 3300049742 Bacteria 2690
400 Ga0501080_0328673 3300049742 Bacteria 1383
401 Ga0501081_0016359 3300049743 Bacteria 4902
402 Ga0501083_0006737 3300049744 Bacteria 8150
403 Ga0501083_0017225 3300049744 Bacteria 5037
404 Ga0501264_000054 3300049761 Bacteria 16104
405 Ga0501035_0000245 3300049822 Bacteria 65283
406 Ga0501035_0000933 3300049822 Bacteria 30964
407 Ga0501035_0013047 3300049822 Bacteria 7667
408 Ga0501035_0016699 3300049822 Bacteria 6768
409 Ga0501035_0022130 3300049822 Bacteria 5839
410 Ga0501035_0033365 3300049822 Unclassified 4682
411 Ga0501035_0088440 3300049822 Bacteria 2730
412 Ga0501035_0170972 3300049822 Bacteria 1877
413 Ga0501035_0177674 3300049822 Bacteria 1836
414 Ga0501044_0004353 3300049823 Bacteria 15860
415 Ga0501044_0007335 3300049823 Bacteria 12117
416 Ga0501044_0019783 3300049823 Bacteria 7192
417 Ga0501044_0068381 3300049823 Bacteria 3618
418 Ga0501044_0099209 3300049823 Bacteria 2931
419 Ga0501044_0110884 3300049823 Bacteria 2752
420 Ga0501044_0150987 3300049823 Bacteria 2305
421 Ga0501044_0193547 3300049823 Bacteria 1995
422 Ga0501045_0011906 3300049824 Bacteria 6114
423 Ga0501045_0034741 3300049824 Bacteria 3660
424 Ga0501045_0043890 3300049824 Bacteria 3256
425 nmdc:mga05p37_25918_c1 3300050507 Bacteria 7128
426 nmdc:mga05p37_342004_c1 3300050507 Bacteria 1764
427 nmdc:mga05p37_40942_c1 3300050507 Bacteria 5689
428 nmdc:mga09592_143475_c1 3300050508 Bacteria 2059
429 nmdc:mga0qj67_204581_c1 3300050509 Bacteria 1604
430 nmdc:mga06r32_37809_c1 3300050510 Bacteria 4567
431 nmdc:mga0rr50_308967_c1 3300050513 Bacteria 1324
432 Ga0495601_0004765 3300053077 Bacteria 7868
433 Ga0495612_0000103 3300053078 Bacteria 36230
434 Ga0500568_0009400 3300053139 Bacteria 4650
435 Ga0500616_0092481 3300053153 Bacteria 1495
436 Ga0501084_0001744 3300054114 Bacteria 17275
437 Ga0501082_0012543 3300060353 Bacteria 7281
438 Ga0501082_0368181 3300060353 Unclassified 1254
439 Ga0530510_0019730 3300061734 Bacteria 4789
440 Ga0530510_0021970 3300061734 Bacteria 4542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100140001 Ga0070699_1001400012 313
2 3300005467 Ga0070706_100001535 Ga0070706_10000153511 316
3 3300009147 Ga0114129_10025797 Ga0114129_100257979 316
4 3300009147 Ga0114129_10137924 Ga0114129_101379246 316
5 3300037312 Ga0395899_0048931 Ga0395899_0048931_2167_3123 316
6 3300037466 Ga0395898_0247238 Ga0395898_0247238_23_985 316
7 3300050507 nmdc:mga05p37_25918_c1 nmdc:mga05p37_25918_c1_210_1184 316
8 3300050507 nmdc:mga05p37_342004_c1 nmdc:mga05p37_342004_c1_608_1582 316
9 3300049588 Ga0501072_0104293 Ga0501072_0104293_12_995 319
10 3300025915 Ga0207693_10213637 Ga0207693_102136372 320
11 3300046511 Ga0495608_0143089 Ga0495608_0143089_11_1009 320
12 3300047319 Ga0495674_0245097 Ga0495674_0245097_466_1464 320
13 3300048914 Ga0496111_0291865 Ga0496111_0291865_14_997 320
14 3300048928 Ga0496125_0157164 Ga0496125_0157164_28_990 320
15 3300009148 Ga0105243_10427060 Ga0105243_104270601 321
16 3300025929 Ga0207664_10216687 Ga0207664_102166872 323
17 3300005457 Ga0070662_100205634 Ga0070662_1002056342 325
18 3300014326 Ga0157380_10067083 Ga0157380_100670832 325
19 3300005937 Ga0081455_10005121 Ga0081455_100051216 326
20 3300005985 Ga0081539_10004967 Ga0081539_1000496714 326
21 3300006880 Ga0075429_100035192 Ga0075429_1000351922 326
22 3300007076 Ga0075435_100039549 Ga0075435_1000395493 326
23 3300009147 Ga0114129_10295619 Ga0114129_102956192 326
24 3300009147 Ga0114129_10824425 Ga0114129_108244251 326
25 3300044693 Ga0466961_0134056 Ga0466961_0134056_549_1541 326
26 3300048915 Ga0496112_0350928 Ga0496112_0350928_34_1026 326
27 3300050507 nmdc:mga05p37_40942_c1 nmdc:mga05p37_40942_c1_3265_4326 326
28 3300050508 nmdc:mga09592_143475_c1 nmdc:mga09592_143475_c1_373_1434 326
29 3300050513 nmdc:mga0rr50_308967_c1 nmdc:mga0rr50_308967_c1_225_1298 326
30 3300014497 Ga0182008_10014581 Ga0182008_100145813 329
31 3300015262 Ga0182007_10003083 Ga0182007_100030835 329
32 3300049589 Ga0501073_0207868 Ga0501073_0207868_242_1303 331
33 3300005327 Ga0070658_10077638 Ga0070658_100776382 333
34 3300031995 Ga0307409_100271241 Ga0307409_1002712412 333
35 3300005545 Ga0070695_100054599 Ga0070695_1000545992 334
36 3300005983 Ga0081540_1003249 Ga0081540_10032498 335
37 3300031731 Ga0307405_10008832 Ga0307405_100088324 335
38 3300031824 Ga0307413_10003399 Ga0307413_100033995 335
39 3300031852 Ga0307410_10062399 Ga0307410_100623992 335
40 3300031901 Ga0307406_10003498 Ga0307406_100034982 335
41 3300031911 Ga0307412_10006717 Ga0307412_100067172 335
42 3300032002 Ga0307416_100000645 Ga0307416_10000064514 335
43 3300032004 Ga0307414_10002657 Ga0307414_100026572 335
44 3300032005 Ga0307411_10163906 Ga0307411_101639062 335
45 3300032126 Ga0307415_100001074 Ga0307415_1000010741 335
46 3300002067 JGI24735J21928_10053640 JGI24735J21928_100536401 336
47 3300005327 Ga0070658_10106805 Ga0070658_101068052 336
48 3300005331 Ga0070670_100286993 Ga0070670_1002869931 336
49 3300005333 Ga0070677_10009308 Ga0070677_100093084 336
50 3300005458 Ga0070681_10052182 Ga0070681_100521823 336
51 3300005577 Ga0068857_100400893 Ga0068857_1004008931 336
52 3300013102 Ga0157371_10029488 Ga0157371_100294885 336
53 3300013104 Ga0157370_10065875 Ga0157370_100658752 336
54 3300013105 Ga0157369_10062214 Ga0157369_100622143 336
55 3300013307 Ga0157372_10384146 Ga0157372_103841462 336
56 3300025909 Ga0207705_10135055 Ga0207705_101350552 336
57 3300025919 Ga0207657_10023224 Ga0207657_100232242 336
58 3300025940 Ga0207691_10073421 Ga0207691_100734212 336
59 3300032004 Ga0307414_10010586 Ga0307414_100105863 336
60 3300046543 Ga0495645_0000022 Ga0495645_0000022_79209_80276 336
61 3300005445 Ga0070708_100063220 Ga0070708_1000632203 337
62 3300005471 Ga0070698_100050706 Ga0070698_1000507062 337
63 3300005518 Ga0070699_100035352 Ga0070699_1000353522 337
64 3300046675 Ga0495657_0000041 Ga0495657_0000041_96446_97510 337
65 3300049571 Ga0501034_0002811 Ga0501034_0002811_2206_3219 337
66 3300049572 Ga0501036_0028227 Ga0501036_0028227_3568_4581 337
67 3300049574 Ga0501038_0033830 Ga0501038_0033830_1614_2627 337
68 3300049575 Ga0501039_0141451 Ga0501039_0141451_107_1120 337
69 3300049579 Ga0501043_0015884 Ga0501043_0015884_3762_4775 337
70 3300049581 Ga0501047_0039448 Ga0501047_0039448_3529_4542 337
71 3300049822 Ga0501035_0033365 Ga0501035_0033365_3581_4594 337
72 3300049823 Ga0501044_0019783 Ga0501044_0019783_3171_4184 337
73 3300031824 Ga0307413_10094431 Ga0307413_100944312 338
74 3300025928 Ga0207700_10160746 Ga0207700_101607462 339
75 3300039437 Ga0436365_0226253 Ga0436365_0226253_10072_11160 339
76 iso_pu_bacteria 2929921140 2929922281 339
77 3300003203 JGI25406J46586_10006818 JGI25406J46586_100068183 340
78 3300005355 Ga0070671_100183094 Ga0070671_1001830941 340
79 3300005981 Ga0081538_10011368 Ga0081538_100113687 340
80 3300005981 Ga0081538_10042943 Ga0081538_100429432 340
81 3300005985 Ga0081539_10002306 Ga0081539_100023068 340
82 3300009098 Ga0105245_10210283 Ga0105245_102102832 340
83 3300021384 Ga0213876_10003196 Ga0213876_100031966 340
84 3300021388 Ga0213875_10000693 Ga0213875_1000069312 340
85 3300032002 Ga0307416_100014539 Ga0307416_1000145394 340
86 3300032004 Ga0307414_10102579 Ga0307414_101025792 340
87 3300032126 Ga0307415_100060415 Ga0307415_1000604151 340
88 3300037853 Ga0436364_0040101 Ga0436364_0040101_2187_3236 340
89 3300037853 Ga0436364_0638094 Ga0436364_0638094_3353_4393 340
90 3300037853 Ga0436364_1156440 Ga0436364_1156440_32126_33172 340
91 3300039437 Ga0436365_1207904 Ga0436365_1207904_4846_5898 340
92 3300039453 Ga0436362_1129554 Ga0436362_1129554_934_1989 340
93 3300044693 Ga0466961_0099188 Ga0466961_0099188_70_1107 340
94 3300044694 Ga0466963_0001189 Ga0466963_0001189_10492_11541 340
95 3300045976 Ga0466967_0067161 Ga0466967_0067161_717_1760 340
96 3300046455 Ga0495603_0179565 Ga0495603_0179565_45_1076 340
97 3300048907 Ga0496104_0114190 Ga0496104_0114190_929_1972 340
98 3300048910 Ga0496107_0306097 Ga0496107_0306097_22_1062 340
99 3300048917 Ga0496114_0105473 Ga0496114_0105473_733_1776 340
100 3300005834 Ga0068851_10000171 Ga0068851_1000017121 341
101 3300025321 Ga0207656_10000250 Ga0207656_100002506 341
102 3300046463 Ga0495653_0000907 Ga0495653_0000907_5771_6826 341
103 3300053077 Ga0495601_0004765 Ga0495601_0004765_2556_3611 341
104 3300053078 Ga0495612_0000103 Ga0495612_0000103_14142_15197 341
105 3300005340 Ga0070689_100151430 Ga0070689_1001514302 342
106 3300005466 Ga0070685_10036049 Ga0070685_100360492 342
107 iso_pu_bacteria 2721755487 2722731070 342
108 3300003322 rootL2_10076218 rootL2_100762182 343
109 3300005563 Ga0068855_100100676 Ga0068855_1001006764 343
110 3300006847 Ga0075431_100021106 Ga0075431_1000211064 343
111 3300006847 Ga0075431_100056847 Ga0075431_1000568472 343
112 3300006880 Ga0075429_100009688 Ga0075429_1000096882 343
113 3300009551 Ga0105238_10001579 Ga0105238_100015796 343
114 3300013104 Ga0157370_10000821 Ga0157370_1000082117 343
115 3300014326 Ga0157380_10000067 Ga0157380_100000672 343
116 3300026078 Ga0207702_10098049 Ga0207702_100980491 343
117 3300028654 Ga0265322_10004498 Ga0265322_100044983 343
118 3300031235 Ga0265330_10002857 Ga0265330_100028573 343
119 3300031238 Ga0265332_10061071 Ga0265332_100610711 343
120 3300031251 Ga0265327_10000234 Ga0265327_10000234104 343
121 3300031251 Ga0265327_10034543 Ga0265327_100345433 343
122 3300031548 Ga0307408_100016961 Ga0307408_1000169613 343
123 3300031712 Ga0265342_10000391 Ga0265342_1000039146 343
124 3300047318 Ga0495636_0000333 Ga0495636_0000333_8740_9771 343
125 3300049568 Ga0501031_0064622 Ga0501031_0064622_792_1844 343
126 3300049570 Ga0501033_0068449 Ga0501033_0068449_804_1856 343
127 3300049571 Ga0501034_0102285 Ga0501034_0102285_1441_2472 343
128 3300049576 Ga0501040_0070009 Ga0501040_0070009_540_1592 343
129 3300049577 Ga0501041_0029786 Ga0501041_0029786_1675_2727 343
130 3300049582 Ga0501048_0213807 Ga0501048_0213807_155_1207 343
131 3300049592 Ga0501076_0205645 Ga0501076_0205645_216_1268 343
132 3300049741 Ga0501079_0178009 Ga0501079_0178009_235_1287 343
133 3300049761 Ga0501264_000054 Ga0501264_000054_6285_7316 343
134 3300049824 Ga0501045_0011906 Ga0501045_0011906_1857_2909 343
135 3300050509 nmdc:mga0qj67_204581_c1 nmdc:mga0qj67_204581_c1_111_1157 343
136 3300050510 nmdc:mga06r32_37809_c1 nmdc:mga06r32_37809_c1_616_1662 343
137 3300053139 Ga0500568_0009400 Ga0500568_0009400_1965_2999 343
138 3300061734 Ga0530510_0019730 Ga0530510_0019730_2491_3543 343
139 iso_pu_bacteria 2818991444 2819589350 343
140 3300003322 rootL2_10168539 rootL2_101685393 344
141 3300003323 rootH1_10005049 rootH1_100050494 344
142 3300005336 Ga0070680_100028337 Ga0070680_1000283373 344
143 3300005336 Ga0070680_100045335 Ga0070680_1000453353 344
144 3300005337 Ga0070682_100000315 Ga0070682_1000003159 344
145 3300005339 Ga0070660_100021267 Ga0070660_1000212672 344
146 3300005341 Ga0070691_10000896 Ga0070691_100008967 344
147 3300005364 Ga0070673_100370041 Ga0070673_1003700411 344
148 3300005366 Ga0070659_100040509 Ga0070659_1000405093 344
149 3300005366 Ga0070659_100061700 Ga0070659_1000617004 344
150 3300005435 Ga0070714_100019674 Ga0070714_1000196742 344
151 3300005455 Ga0070663_100094816 Ga0070663_1000948161 344
152 3300005456 Ga0070678_100129349 Ga0070678_1001293492 344
153 3300005458 Ga0070681_10078008 Ga0070681_100780083 344
154 3300005530 Ga0070679_100005166 Ga0070679_1000051664 344
155 3300005530 Ga0070679_100010126 Ga0070679_1000101264 344
156 3300005530 Ga0070679_100090965 Ga0070679_1000909651 344
157 3300005539 Ga0068853_100067655 Ga0068853_1000676553 344
158 3300005543 Ga0070672_100154910 Ga0070672_1001549102 344
159 3300005547 Ga0070693_100014807 Ga0070693_1000148072 344
160 3300005563 Ga0068855_100095266 Ga0068855_1000952664 344
161 3300005577 Ga0068857_100096266 Ga0068857_1000962662 344
162 3300009093 Ga0105240_10016585 Ga0105240_100165853 344
163 3300009094 Ga0111539_10033471 Ga0111539_100334716 344
164 3300009174 Ga0105241_10010626 Ga0105241_100106267 344
165 3300013100 Ga0157373_10009211 Ga0157373_100092113 344
166 3300013102 Ga0157371_10001101 Ga0157371_1000110110 344
167 3300013102 Ga0157371_10003314 Ga0157371_1000331412 344
168 3300013102 Ga0157371_10005044 Ga0157371_1000504412 344
169 3300013102 Ga0157371_10058113 Ga0157371_100581132 344
170 3300013102 Ga0157371_10137067 Ga0157371_101370673 344
171 3300013104 Ga0157370_10061411 Ga0157370_100614113 344
172 3300013307 Ga0157372_10061828 Ga0157372_100618285 344
173 3300013307 Ga0157372_10078405 Ga0157372_100784052 344
174 3300013307 Ga0157372_10256905 Ga0157372_102569053 344
175 3300014326 Ga0157380_10000383 Ga0157380_1000038313 344
176 3300014326 Ga0157380_10014932 Ga0157380_100149322 344
177 3300014969 Ga0157376_10493963 Ga0157376_104939631 344
178 3300025909 Ga0207705_10072741 Ga0207705_100727411 344
179 3300025911 Ga0207654_10012479 Ga0207654_100124793 344
180 3300025912 Ga0207707_10000456 Ga0207707_1000045613 344
181 3300025913 Ga0207695_10242171 Ga0207695_102421712 344
182 3300025917 Ga0207660_10025045 Ga0207660_100250454 344
183 3300025917 Ga0207660_10029276 Ga0207660_100292762 344
184 3300025919 Ga0207657_10015465 Ga0207657_100154656 344
185 3300025921 Ga0207652_10000831 Ga0207652_1000083121 344
186 3300025921 Ga0207652_10000939 Ga0207652_1000093923 344
187 3300025921 Ga0207652_10037201 Ga0207652_100372014 344
188 3300025929 Ga0207664_10190584 Ga0207664_101905841 344
189 3300025932 Ga0207690_10121928 Ga0207690_101219282 344
190 3300025932 Ga0207690_10126222 Ga0207690_101262222 344
191 3300025949 Ga0207667_10098002 Ga0207667_100980022 344
192 3300025949 Ga0207667_10228629 Ga0207667_102286293 344
193 3300026041 Ga0207639_10035987 Ga0207639_100359873 344
194 3300026121 Ga0207683_10091228 Ga0207683_100912282 344
195 3300037312 Ga0395899_0009618 Ga0395899_0009618_2850_3884 344
196 3300037312 Ga0395899_0091217 Ga0395899_0091217_423_1457 344
197 3300037418 Ga0395900_0000203 Ga0395900_0000203_42155_43189 344
198 3300037418 Ga0395900_0027824 Ga0395900_0027824_2728_3762 344
199 3300037466 Ga0395898_0001285 Ga0395898_0001285_19290_20324 344
200 3300038443 Ga0395901_0002230 Ga0395901_0002230_16285_17319 344
201 3300042876 Ga0451577_0000723 Ga0451577_0000723_40901_41935 344
202 3300042876 Ga0451577_0265560 Ga0451577_0265560_295_1332 344
203 3300044673 Ga0453683_0000747 Ga0453683_0000747_7501_8556 344
204 3300044712 Ga0453684_0000033 Ga0453684_0000033_444475_445509 344
205 3300045051 Ga0451576_0004888 Ga0451576_0004888_1965_3020 344
206 3300048904 Ga0496101_0098620 Ga0496101_0098620_265_1323 344
207 3300048905 Ga0496102_0040605 Ga0496102_0040605_2446_3504 344
208 3300048909 Ga0496106_0057241 Ga0496106_0057241_1384_2442 344
209 3300048910 Ga0496107_0292594 Ga0496107_0292594_32_1090 344
210 3300048914 Ga0496111_0064027 Ga0496111_0064027_161_1219 344
211 3300048916 Ga0496113_0055725 Ga0496113_0055725_908_1966 344
212 3300049571 Ga0501034_0009934 Ga0501034_0009934_7096_8130 344
213 3300049571 Ga0501034_0024790 Ga0501034_0024790_1696_2730 344
214 3300049579 Ga0501043_0239628 Ga0501043_0239628_230_1264 344
215 3300049742 Ga0501080_0100066 Ga0501080_0100066_46_1080 344
216 3300049822 Ga0501035_0022130 Ga0501035_0022130_1175_2209 344
217 3300049822 Ga0501035_0177674 Ga0501035_0177674_527_1561 344
218 3300049823 Ga0501044_0150987 Ga0501044_0150987_70_1104 344
219 3300049823 Ga0501044_0193547 Ga0501044_0193547_44_1078 344
220 3300005327 Ga0070658_10214326 Ga0070658_102143261 345
221 3300005331 Ga0070670_100228845 Ga0070670_1002288451 345
222 3300005366 Ga0070659_100041451 Ga0070659_1000414512 345
223 3300005539 Ga0068853_100042831 Ga0068853_1000428313 345
224 3300005563 Ga0068855_100105976 Ga0068855_1001059764 345
225 3300013100 Ga0157373_10013071 Ga0157373_100130713 345
226 3300013307 Ga0157372_10021733 Ga0157372_100217331 345
227 3300013307 Ga0157372_10085048 Ga0157372_100850482 345
228 3300013307 Ga0157372_10354850 Ga0157372_103548502 345
229 3300013308 Ga0157375_10167313 Ga0157375_101673132 345
230 3300014968 Ga0157379_10290298 Ga0157379_102902982 345
231 3300021384 Ga0213876_10001274 Ga0213876_100012743 345
232 3300021384 Ga0213876_10072671 Ga0213876_100726712 345
233 3300025909 Ga0207705_10021406 Ga0207705_100214066 345
234 3300025909 Ga0207705_10050391 Ga0207705_100503911 345
235 3300025912 Ga0207707_10031689 Ga0207707_100316892 345
236 3300031727 Ga0316576_10080975 Ga0316576_100809752 345
237 3300031730 Ga0307516_10028154 Ga0307516_100281545 345
238 3300032002 Ga0307416_100099362 Ga0307416_1000993622 345
239 3300037418 Ga0395900_0061350 Ga0395900_0061350_2353_3390 345
240 3300039437 Ga0436365_0004784 Ga0436365_0004784_22430_23467 345
241 3300039437 Ga0436365_1709655 Ga0436365_1709655_310_1347 345
242 3300049568 Ga0501031_0011072 Ga0501031_0011072_3430_4491 345
243 3300049569 Ga0501032_0023957 Ga0501032_0023957_62_1123 345
244 3300049569 Ga0501032_0041693 Ga0501032_0041693_1847_2914 345
245 3300049570 Ga0501033_0036122 Ga0501033_0036122_2095_3156 345
246 3300049570 Ga0501033_0141884 Ga0501033_0141884_178_1245 345
247 3300049571 Ga0501034_0161392 Ga0501034_0161392_996_2057 345
248 3300049571 Ga0501034_0184583 Ga0501034_0184583_683_1750 345
249 3300049572 Ga0501036_0081803 Ga0501036_0081803_1146_2213 345
250 3300049573 Ga0501037_0047899 Ga0501037_0047899_212_1279 345
251 3300049573 Ga0501037_0057356 Ga0501037_0057356_593_1654 345
252 3300049574 Ga0501038_0021286 Ga0501038_0021286_2132_3199 345
253 3300049574 Ga0501038_0100699 Ga0501038_0100699_1190_2251 345
254 3300049575 Ga0501039_0001109 Ga0501039_0001109_8782_9849 345
255 3300049575 Ga0501039_0134797 Ga0501039_0134797_653_1714 345
256 3300049576 Ga0501040_0013383 Ga0501040_0013383_2498_3565 345
257 3300049576 Ga0501040_0058005 Ga0501040_0058005_338_1399 345
258 3300049577 Ga0501041_0004521 Ga0501041_0004521_2369_3436 345
259 3300049577 Ga0501041_0074044 Ga0501041_0074044_694_1755 345
260 3300049578 Ga0501042_0005712 Ga0501042_0005712_2153_3220 345
261 3300049579 Ga0501043_0016048 Ga0501043_0016048_3119_4186 345
262 3300049580 Ga0501046_0004485 Ga0501046_0004485_6544_7611 345
263 3300049580 Ga0501046_0030253 Ga0501046_0030253_2596_3657 345
264 3300049581 Ga0501047_0250728 Ga0501047_0250728_136_1203 345
265 3300049584 Ga0501068_0137473 Ga0501068_0137473_49_1110 345
266 3300049585 Ga0501069_0094041 Ga0501069_0094041_221_1288 345
267 3300049587 Ga0501071_0021014 Ga0501071_0021014_2748_3815 345
268 3300049588 Ga0501072_0011740 Ga0501072_0011740_2620_3687 345
269 3300049589 Ga0501073_0097286 Ga0501073_0097286_285_1346 345
270 3300049591 Ga0501075_0003196 Ga0501075_0003196_6723_7790 345
271 3300049591 Ga0501075_0085301 Ga0501075_0085301_679_1740 345
272 3300049592 Ga0501076_0006378 Ga0501076_0006378_4843_5910 345
273 3300049593 Ga0501077_0013105 Ga0501077_0013105_3085_4152 345
274 3300049593 Ga0501077_0132366 Ga0501077_0132366_421_1482 345
275 3300049741 Ga0501079_0018948 Ga0501079_0018948_1154_2221 345
276 3300049742 Ga0501080_0005261 Ga0501080_0005261_8378_9439 345
277 3300049742 Ga0501080_0328673 Ga0501080_0328673_325_1365 345
278 3300049743 Ga0501081_0016359 Ga0501081_0016359_1154_2221 345
279 3300049744 Ga0501083_0006737 Ga0501083_0006737_2412_3473 345
280 3300049822 Ga0501035_0016699 Ga0501035_0016699_1573_2634 345
281 3300049822 Ga0501035_0170972 Ga0501035_0170972_630_1697 345
282 3300049823 Ga0501044_0007335 Ga0501044_0007335_10970_12031 345
283 3300049824 Ga0501045_0034741 Ga0501045_0034741_338_1399 345
284 3300049824 Ga0501045_0043890 Ga0501045_0043890_2179_3246 345
285 3300054114 Ga0501084_0001744 Ga0501084_0001744_14254_15321 345
286 3300060353 Ga0501082_0012543 Ga0501082_0012543_5061_6128 345
287 3300061734 Ga0530510_0021970 Ga0530510_0021970_2322_3389 345
288 2162886007 SwRhRL2b_contig_254312 SwRhRL2b_0771.00006110 346
289 3300005329 Ga0070683_100000236 Ga0070683_10000023633 346
290 3300005329 Ga0070683_100015553 Ga0070683_1000155533 346
291 3300005336 Ga0070680_100037636 Ga0070680_1000376362 346
292 3300005338 Ga0068868_100150844 Ga0068868_1001508443 346
293 3300005339 Ga0070660_100004805 Ga0070660_1000048052 346
294 3300005339 Ga0070660_100060283 Ga0070660_1000602831 346
295 3300005339 Ga0070660_100402811 Ga0070660_1004028111 346
296 3300005356 Ga0070674_100075580 Ga0070674_1000755802 346
297 3300005364 Ga0070673_100090424 Ga0070673_1000904242 346
298 3300005366 Ga0070659_100211169 Ga0070659_1002111692 346
299 3300005367 Ga0070667_100100663 Ga0070667_1001006631 346
300 3300005434 Ga0070709_10000842 Ga0070709_1000084213 346
301 3300005435 Ga0070714_100027027 Ga0070714_1000270275 346
302 3300005439 Ga0070711_100061528 Ga0070711_1000615283 346
303 3300005445 Ga0070708_100000022 Ga0070708_10000002281 346
304 3300005455 Ga0070663_100029008 Ga0070663_1000290084 346
305 3300005456 Ga0070678_100013313 Ga0070678_10001331310 346
306 3300005458 Ga0070681_10318721 Ga0070681_103187211 346
307 3300005466 Ga0070685_10020157 Ga0070685_100201572 346
308 3300005530 Ga0070679_100032553 Ga0070679_1000325533 346
309 3300005530 Ga0070679_100230837 Ga0070679_1002308372 346
310 3300005535 Ga0070684_100001605 Ga0070684_10000160512 346
311 3300005547 Ga0070693_100030967 Ga0070693_1000309673 346
312 3300005548 Ga0070665_100133748 Ga0070665_1001337484 346
313 3300005563 Ga0068855_100007528 Ga0068855_1000075288 346
314 3300005563 Ga0068855_100016426 Ga0068855_1000164264 346
315 3300005564 Ga0070664_100005547 Ga0070664_1000055477 346
316 3300005577 Ga0068857_100276843 Ga0068857_1002768431 346
317 3300005614 Ga0068856_100025417 Ga0068856_1000254173 346
318 3300005615 Ga0070702_100079183 Ga0070702_1000791832 346
319 3300005718 Ga0068866_10042854 Ga0068866_100428543 346
320 3300005985 Ga0081539_10015145 Ga0081539_100151457 346
321 3300006175 Ga0070712_100090975 Ga0070712_1000909752 346
322 3300006178 Ga0075367_10109305 Ga0075367_101093052 346
323 3300006237 Ga0097621_100318129 Ga0097621_1003181291 346
324 3300006881 Ga0068865_100111955 Ga0068865_1001119552 346
325 3300009148 Ga0105243_10000003 Ga0105243_1000000386 346
326 3300009177 Ga0105248_10043814 Ga0105248_100438142 346
327 3300009545 Ga0105237_10206465 Ga0105237_102064653 346
328 3300009545 Ga0105237_10261111 Ga0105237_102611112 346
329 3300013100 Ga0157373_10048853 Ga0157373_100488532 346
330 3300013102 Ga0157371_10000584 Ga0157371_1000058411 346
331 3300013102 Ga0157371_10006737 Ga0157371_1000673710 346
332 3300013102 Ga0157371_10112750 Ga0157371_101127502 346
333 3300013104 Ga0157370_10001675 Ga0157370_100016756 346
334 3300013104 Ga0157370_10089620 Ga0157370_100896202 346
335 3300013104 Ga0157370_10173980 Ga0157370_101739802 346
336 3300013104 Ga0157370_10229755 Ga0157370_102297552 346
337 3300013105 Ga0157369_10121014 Ga0157369_101210142 346
338 3300013105 Ga0157369_10134430 Ga0157369_101344302 346
339 3300013306 Ga0163162_10095354 Ga0163162_100953542 346
340 3300013307 Ga0157372_10027898 Ga0157372_100278983 346
341 3300013307 Ga0157372_10030583 Ga0157372_100305835 346
342 3300013307 Ga0157372_10384556 Ga0157372_103845561 346
343 3300013307 Ga0157372_10389001 Ga0157372_103890012 346
344 3300013308 Ga0157375_10001388 Ga0157375_1000138816 346
345 3300014325 Ga0163163_10097337 Ga0163163_100973373 346
346 3300014326 Ga0157380_10186368 Ga0157380_101863683 346
347 3300014968 Ga0157379_10043387 Ga0157379_100433874 346
348 3300015262 Ga0182007_10002043 Ga0182007_100020436 346
349 3300025899 Ga0207642_10032685 Ga0207642_100326852 346
350 3300025903 Ga0207680_10011709 Ga0207680_100117095 346
351 3300025904 Ga0207647_10065956 Ga0207647_100659562 346
352 3300025906 Ga0207699_10005231 Ga0207699_100052314 346
353 3300025909 Ga0207705_10018439 Ga0207705_100184393 346
354 3300025910 Ga0207684_10029871 Ga0207684_100298715 346
355 3300025912 Ga0207707_10280275 Ga0207707_102802752 346
356 3300025914 Ga0207671_10046745 Ga0207671_100467453 346
357 3300025919 Ga0207657_10010191 Ga0207657_100101912 346
358 3300025919 Ga0207657_10087659 Ga0207657_100876592 346
359 3300025919 Ga0207657_10198653 Ga0207657_101986531 346
360 3300025919 Ga0207657_10212548 Ga0207657_102125481 346
361 3300025920 Ga0207649_10022703 Ga0207649_100227033 346
362 3300025921 Ga0207652_10000383 Ga0207652_1000038313 346
363 3300025928 Ga0207700_10051634 Ga0207700_100516342 346
364 3300025935 Ga0207709_10000008 Ga0207709_10000008488 346
365 3300025939 Ga0207665_10029800 Ga0207665_100298003 346
366 3300025941 Ga0207711_10298780 Ga0207711_102987802 346
367 3300025944 Ga0207661_10007962 Ga0207661_100079622 346
368 3300025944 Ga0207661_10119193 Ga0207661_101191932 346
369 3300025944 Ga0207661_10228146 Ga0207661_102281461 346
370 3300025949 Ga0207667_10013719 Ga0207667_100137194 346
371 3300025949 Ga0207667_10015447 Ga0207667_100154476 346
372 3300025949 Ga0207667_10038893 Ga0207667_100388932 346
373 3300025949 Ga0207667_10108731 Ga0207667_101087314 346
374 3300025986 Ga0207658_10355203 Ga0207658_103552031 346
375 3300026067 Ga0207678_10021475 Ga0207678_100214754 346
376 3300026078 Ga0207702_10050237 Ga0207702_100502372 346
377 3300026089 Ga0207648_10065526 Ga0207648_100655263 346
378 3300026116 Ga0207674_10006140 Ga0207674_1000614012 346
379 3300026121 Ga0207683_10003439 Ga0207683_1000343915 346
380 3300028380 Ga0268265_10133411 Ga0268265_101334112 346
381 3300031548 Ga0307408_100028097 Ga0307408_1000280972 346
382 3300031548 Ga0307408_100123170 Ga0307408_1001231702 346
383 3300031731 Ga0307405_10019981 Ga0307405_100199812 346
384 3300031824 Ga0307413_10150789 Ga0307413_101507892 346
385 3300031824 Ga0307413_10295294 Ga0307413_102952941 346
386 3300031852 Ga0307410_10107631 Ga0307410_101076312 346
387 3300031995 Ga0307409_100024644 Ga0307409_1000246442 346
388 3300032002 Ga0307416_100009110 Ga0307416_1000091104 346
389 3300032004 Ga0307414_10101653 Ga0307414_101016532 346
390 3300032126 Ga0307415_100016388 Ga0307415_1000163882 346
391 3300032126 Ga0307415_100158415 Ga0307415_1001584151 346
392 3300035172 Ga0373955_0024699 Ga0373955_0024699_1200_2261 346
393 3300035724 Ga0373933_0047088 Ga0373933_0047088_920_1981 346
394 3300036401 Ga0373937_0011668 Ga0373937_0011668_6583_7644 346
395 3300037312 Ga0395899_0006917 Ga0395899_0006917_2054_3094 346
396 3300037418 Ga0395900_0041156 Ga0395900_0041156_375_1415 346
397 3300037418 Ga0395900_0078098 Ga0395900_0078098_1986_3032 346
398 3300037466 Ga0395898_0120233 Ga0395898_0120233_30_1070 346
399 3300038443 Ga0395901_0071453 Ga0395901_0071453_498_1538 346
400 3300038443 Ga0395901_0201345 Ga0395901_0201345_710_1762 346
401 3300038443 Ga0395901_0247845 Ga0395901_0247845_452_1492 346
402 3300042876 Ga0451577_0101910 Ga0451577_0101910_1150_2226 346
403 3300044684 Ga0466966_0004073 Ga0466966_0004073_828_1886 346
404 3300044684 Ga0466966_0063806 Ga0466966_0063806_1229_2281 346
405 3300044712 Ga0453684_0007166 Ga0453684_0007166_9674_10750 346
406 3300044712 Ga0453684_0016322 Ga0453684_0016322_6986_8053 346
407 3300044719 Ga0466971_0143981 Ga0466971_0143981_28_1080 346
408 3300045049 Ga0466959_0038572 Ga0466959_0038572_393_1445 346
409 3300045049 Ga0466959_0072964 Ga0466959_0072964_36_1094 346
410 3300046477 Ga0495664_0111251 Ga0495664_0111251_188_1231 346
411 3300046689 Ga0495613_0143852 Ga0495613_0143852_237_1298 346
412 3300047319 Ga0495674_0199008 Ga0495674_0199008_307_1368 346
413 3300047322 Ga0495680_0090707 Ga0495680_0090707_509_1570 346
414 3300047471 Ga0495684_0058470 Ga0495684_0058470_928_1989 346
415 3300048925 Ga0496122_0014325 Ga0496122_0014325_3361_4401 346
416 3300048926 Ga0496123_0007946 Ga0496123_0007946_2449_3489 346
417 3300049568 Ga0501031_0094239 Ga0501031_0094239_127_1191 346
418 3300049570 Ga0501033_0017096 Ga0501033_0017096_383_1447 346
419 3300049571 Ga0501034_0049541 Ga0501034_0049541_2777_3817 346
420 3300049573 Ga0501037_0093647 Ga0501037_0093647_769_1833 346
421 3300049581 Ga0501047_0004075 Ga0501047_0004075_9808_10872 346
422 3300049581 Ga0501047_0044308 Ga0501047_0044308_1807_2871 346
423 3300049581 Ga0501047_0153102 Ga0501047_0153102_764_1864 346
424 3300049583 Ga0501067_0075306 Ga0501067_0075306_115_1170 346
425 3300049585 Ga0501069_0021149 Ga0501069_0021149_21_1085 346
426 3300049586 Ga0501070_0000631 Ga0501070_0000631_9155_10219 346
427 3300049586 Ga0501070_0004818 Ga0501070_0004818_6489_7553 346
428 3300049587 Ga0501071_0022767 Ga0501071_0022767_1196_2260 346
429 3300049589 Ga0501073_0062219 Ga0501073_0062219_1123_2187 346
430 3300049590 Ga0501074_0089764 Ga0501074_0089764_226_1290 346
431 3300049668 Ga0501233_012733 Ga0501233_012733_573_1619 346
432 3300049742 Ga0501080_0000128 Ga0501080_0000128_11059_12123 346
433 3300049744 Ga0501083_0017225 Ga0501083_0017225_677_1732 346
434 3300049822 Ga0501035_0000245 Ga0501035_0000245_30836_31900 346
435 3300049822 Ga0501035_0000933 Ga0501035_0000933_24032_25096 346
436 3300049822 Ga0501035_0013047 Ga0501035_0013047_6396_7460 346
437 3300049822 Ga0501035_0088440 Ga0501035_0088440_457_1521 346
438 3300049823 Ga0501044_0004353 Ga0501044_0004353_1637_2701 346
439 3300049823 Ga0501044_0068381 Ga0501044_0068381_2536_3600 346
440 3300049823 Ga0501044_0099209 Ga0501044_0099209_1008_2072 346
441 3300049823 Ga0501044_0110884 Ga0501044_0110884_186_1226 346
442 3300053153 Ga0500616_0092481 Ga0500616_0092481_68_1111 346
443 3300060353 Ga0501082_0368181 Ga0501082_0368181_58_1113 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

1

304

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9717 1 342
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9634 1 342
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8881 1 337
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8805 1 337
1luc-assembly1.cif.gz_A bacterial luciferase 0.8764 1 338
ID Description Score Start End Superfamily
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9678 1 342 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9646 1 343 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9621 1 342 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9482 1 343 3.20.20.30
1bslA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8664 1 343 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A2W6S7C1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9922 1 140 GO:0004497
GO:0005829
GO:0016705
AF-A0A2W6S7C1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9852 1 140 GO:0004497
GO:0005829
GO:0016705
AF-A0A0F2E5X6-F1-model_v4 deleted 0.9816 32 234
AF-A0A2W4U291-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9798 1 297 GO:0004497
GO:0005829
GO:0016705
AF-A0A6J4T203-F1-model_v4 Oxidoreductase 0.9796 136 346 GO:0004497
GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
94.64 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map