F444956

General Info

Members Datasets Scaffolds Average Seq Length
442 229 884 111

Family's Representative Sequence

Representative Sequence 3300047319|Ga0495674_0408247|Ga0495674_0408247_565_966
Length 133
Sequence MSTPGLSTSGAALTIAHTFDIAAAQARLHERGGYEVIHESPGLEIGVYVLVAPEPDRQQPHADDEVYVVLEGSGTLDVEGQKVELREGQATFVPAGAKHQFVGYEQLSVLVIFEKGQTQHLSRDARSRGDRVP

Samples

Sample ID Description Type Environment
1 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
108 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
109 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
110 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
111 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
112 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
113 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
114 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
115 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
119 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
122 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
123 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
124 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
127 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.11
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 11.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495674_0408247 3300047319 Bacteria 1096
2 rootH1_10153823 3300003323 Bacteria 1821
3 Ga0070658_10053788 3300005327 Bacteria 3268
4 Ga0070658_10187765 3300005327 Bacteria 1741
5 Ga0070683_100244386 3300005329 Bacteria 1707
6 Ga0070690_100111880 3300005330 Bacteria 1823
7 Ga0070680_100020905 3300005336 Bacteria 5197
8 Ga0070680_100043721 3300005336 Bacteria 3639
9 Ga0070680_100270412 3300005336 Bacteria 1439
10 Ga0070680_100405616 3300005336 Bacteria 1162
11 Ga0070680_101891413 3300005336 Unclassified 517
12 Ga0070682_100032993 3300005337 Bacteria 3143
13 Ga0070682_100155007 3300005337 Unclassified 1576
14 Ga0070682_100168957 3300005337 Bacteria 1518
15 Ga0070660_100150418 3300005339 Bacteria 1871
16 Ga0070660_100366645 3300005339 Bacteria 1188
17 Ga0070661_100016699 3300005344 Bacteria 5194
18 Ga0070661_100161056 3300005344 Bacteria 1699
19 Ga0070659_100013379 3300005366 Bacteria 6105
20 Ga0070659_100459549 3300005366 Bacteria 1081
21 Ga0070709_10335698 3300005434 Bacteria 1113
22 Ga0070714_100025915 3300005435 Bacteria 4842
23 Ga0070714_100112875 3300005435 Bacteria 2409
24 Ga0070701_10599793 3300005438 Bacteria 729
25 Ga0070711_100099384 3300005439 Bacteria 2114
26 Ga0070700_101189143 3300005441 Unclassified 636
27 Ga0070708_100548013 3300005445 Bacteria 1091
28 Ga0070663_100275080 3300005455 Bacteria 1340
29 Ga0070681_10022345 3300005458 Bacteria 6351
30 Ga0070681_10051458 3300005458 Bacteria 4108
31 Ga0070681_10236930 3300005458 Bacteria 1738
32 Ga0070681_10252509 3300005458 Bacteria 1676
33 Ga0070681_10835683 3300005458 Bacteria 838
34 Ga0070706_100570998 3300005467 Bacteria 1052
35 Ga0070706_100702244 3300005467 Bacteria 938
36 Ga0070707_100232768 3300005468 Unclassified 1793
37 Ga0070707_100980247 3300005468 Unclassified 810
38 Ga0070707_101125847 3300005468 Bacteria 751
39 Ga0070698_100167947 3300005471 Bacteria 2135
40 Ga0070698_100434577 3300005471 Bacteria 1247
41 Ga0070699_101976439 3300005518 Bacteria 533
42 Ga0070679_100074715 3300005530 Bacteria 3380
43 Ga0070679_100109342 3300005530 Bacteria 2750
44 Ga0070679_100273823 3300005530 Bacteria 1642
45 Ga0070679_100669403 3300005530 Bacteria 981
46 Ga0070684_100144974 3300005535 Bacteria 2149
47 Ga0070684_100551170 3300005535 Bacteria 1070
48 Ga0068853_100066652 3300005539 Bacteria 3127
49 Ga0070686_100237575 3300005544 Unclassified 1325
50 Ga0070693_100013052 3300005547 Bacteria 4221
51 Ga0070665_100028147 3300005548 Bacteria 5659
52 Ga0068855_100023532 3300005563 Bacteria 7376
53 Ga0068855_100646579 3300005563 Bacteria 1136
54 Ga0070664_100528768 3300005564 Bacteria 1089
55 Ga0068857_100004411 3300005577 Bacteria 11894
56 Ga0068857_100371421 3300005577 Bacteria 1327
57 Ga0068854_100235996 3300005578 Bacteria 1454
58 Ga0068856_100263034 3300005614 Bacteria 1741
59 Ga0068856_101200567 3300005614 Bacteria 775
60 Ga0068856_101806766 3300005614 Unclassified 623
61 Ga0070702_100075633 3300005615 Bacteria 2002
62 Ga0070702_100226223 3300005615 Bacteria 1254
63 Ga0068852_100026712 3300005616 Bacteria 4698
64 Ga0068866_10865786 3300005718 Unclassified 633
65 Ga0081455_10033697 3300005937 Unclassified 4598
66 Ga0081455_10274986 3300005937 Bacteria 1219
67 Ga0081538_10019530 3300005981 Bacteria 5030
68 Ga0070717_11139925 3300006028 Bacteria 710
69 Ga0070712_100163806 3300006175 Bacteria 1719
70 Ga0075428_100018869 3300006844 Bacteria 7627
71 Ga0075428_100160619 3300006844 Unclassified 2439
72 Ga0075428_101403076 3300006844 Bacteria 733
73 Ga0075430_100098409 3300006846 Unclassified 2444
74 Ga0075431_100041597 3300006847 Bacteria 4738
75 Ga0075429_100026812 3300006880 Bacteria 5003
76 Ga0068865_100245060 3300006881 Bacteria 1412
77 Ga0105240_10302095 3300009093 Bacteria 1831
78 Ga0105240_12044433 3300009093 Bacteria 595
79 Ga0111539_10412100 3300009094 Bacteria 1574
80 Ga0111539_10882035 3300009094 Unclassified 1041
81 Ga0111539_11043526 3300009094 Bacteria 950
82 Ga0105245_10070535 3300009098 Bacteria 3171
83 Ga0114129_10258089 3300009147 Unclassified 2337
84 Ga0114129_10311188 3300009147 Bacteria 2096
85 Ga0105243_10189002 3300009148 Bacteria 1797
86 Ga0105243_11215898 3300009148 Bacteria 767
87 Ga0105241_10111495 3300009174 Bacteria 2190
88 Ga0105241_10620801 3300009174 Bacteria 979
89 Ga0105241_11038937 3300009174 Bacteria 768
90 Ga0105241_11233803 3300009174 Bacteria 709
91 Ga0105248_10681849 3300009177 Bacteria 1159
92 Ga0105237_10080338 3300009545 Bacteria 3251
93 Ga0105238_10021049 3300009551 Bacteria 6645
94 Ga0105238_10894170 3300009551 Unclassified 906
95 Ga0105239_10073635 3300010375 Bacteria 3755
96 Ga0105239_11303498 3300010375 Bacteria 838
97 Ga0157373_10828582 3300013100 Bacteria 683
98 Ga0157370_10012493 3300013104 Bacteria 8802
99 Ga0157370_10205211 3300013104 Bacteria 1828
100 Ga0157370_10251625 3300013104 Bacteria 1634
101 Ga0157369_10124400 3300013105 Bacteria 2735
102 Ga0157374_10031745 3300013296 Bacteria 4804
103 Ga0157372_10010726 3300013307 Bacteria 9754
104 Ga0157372_10033806 3300013307 Bacteria 5619
105 Ga0163163_12878475 3300014325 Bacteria 537
106 Ga0182008_10288220 3300014497 Bacteria 856
107 Ga0182008_10490610 3300014497 Unclassified 674
108 Ga0207705_10012493 3300025909 Bacteria 6135
109 Ga0207705_10991445 3300025909 Bacteria 649
110 Ga0207654_10054297 3300025911 Bacteria 2315
111 Ga0207654_10802825 3300025911 Bacteria 680
112 Ga0207707_10001522 3300025912 Bacteria 21382
113 Ga0207707_10521252 3300025912 Bacteria 1012
114 Ga0207707_10553898 3300025912 Bacteria 977
115 Ga0207707_10559221 3300025912 Unclassified 971
116 Ga0207707_10566480 3300025912 Bacteria 964
117 Ga0207671_10219607 3300025914 Bacteria 1489
118 Ga0207693_10003985 3300025915 Bacteria 12547
119 Ga0207693_11357125 3300025915 Bacteria 529
120 Ga0207663_10075586 3300025916 Bacteria 2186
121 Ga0207660_10032795 3300025917 Bacteria 3587
122 Ga0207660_10037809 3300025917 Bacteria 3366
123 Ga0207660_10167272 3300025917 Bacteria 1700
124 Ga0207660_10284879 3300025917 Bacteria 1312
125 Ga0207660_11520696 3300025917 Bacteria 540
126 Ga0207657_10002332 3300025919 Bacteria 20576
127 Ga0207657_10094935 3300025919 Bacteria 2482
128 Ga0207657_10442364 3300025919 Bacteria 1020
129 Ga0207649_10087102 3300025920 Bacteria 2036
130 Ga0207649_10137181 3300025920 Bacteria 1669
131 Ga0207652_10003632 3300025921 Bacteria 12710
132 Ga0207652_10141050 3300025921 Bacteria 2155
133 Ga0207652_10193283 3300025921 Bacteria 1830
134 Ga0207652_10193720 3300025921 Bacteria 1828
135 Ga0207646_10141838 3300025922 Unclassified 2164
136 Ga0207646_11384727 3300025922 Bacteria 612
137 Ga0207694_10007321 3300025924 Bacteria 8374
138 Ga0207664_10310732 3300025929 Bacteria 1389
139 Ga0207690_10035642 3300025932 Bacteria 3216
140 Ga0207690_11277501 3300025932 Bacteria 613
141 Ga0207686_10235946 3300025934 Bacteria 1329
142 Ga0207709_10654145 3300025935 Bacteria 837
143 Ga0207711_10244334 3300025941 Bacteria 1646
144 Ga0207661_10087828 3300025944 Bacteria 2583
145 Ga0207667_10031279 3300025949 Bacteria 5746
146 Ga0207667_10179739 3300025949 Bacteria 2173
147 Ga0207640_10228583 3300025981 Bacteria 1429
148 Ga0207677_10197079 3300026023 Bacteria 1598
149 Ga0207702_10075786 3300026078 Bacteria 2906
150 Ga0207648_10178627 3300026089 Bacteria 1878
151 Ga0207674_10007576 3300026116 Bacteria 12650
152 Ga0207674_10043518 3300026116 Bacteria 4630
153 Ga0207683_10074020 3300026121 Bacteria 3013
154 Ga0207428_10070664 3300027907 Bacteria 2743
155 Ga0268266_10064529 3300028379 Bacteria 3164
156 Ga0265334_10201631 3300028573 Bacteria 691
157 Ga0265313_10061537 3300031595 Bacteria 1756
158 Ga0307406_10013949 3300031901 Bacteria 4613
159 Ga0307407_10000719 3300031903 Bacteria 10795
160 Ga0307409_100000689 3300031995 Bacteria 15005
161 Ga0307411_10002799 3300032005 Bacteria 7857
162 Ga0373947_0190901 3300035725 Unclassified 1337
163 Ga0373937_0006502 3300036401 Bacteria 10086
164 Ga0395899_0005043 3300037312 Bacteria 10272
165 Ga0395899_0240795 3300037312 Bacteria 1245
166 Ga0395900_0001301 3300037418 Bacteria 30379
167 Ga0395900_0002544 3300037418 Bacteria 19971
168 Ga0395900_0010103 3300037418 Bacteria 9653
169 Ga0395900_0029008 3300037418 Bacteria 5675
170 Ga0395900_0076043 3300037418 Bacteria 3451
171 Ga0395900_0104368 3300037418 Bacteria 2912
172 Ga0395900_0339810 3300037418 Bacteria 1477
173 Ga0395900_0419013 3300037418 Bacteria 1300
174 Ga0395898_0014857 3300037466 Bacteria 7992
175 Ga0395898_0023726 3300037466 Bacteria 6193
176 Ga0395898_0048290 3300037466 Bacteria 4175
177 Ga0395898_0049757 3300037466 Bacteria 4105
178 Ga0395898_0083492 3300037466 Bacteria 3079
179 Ga0395898_0085617 3300037466 Bacteria 3038
180 Ga0395898_0261435 3300037466 Unclassified 1651
181 Ga0395898_0305176 3300037466 Bacteria 1518
182 Ga0395905_0000645 3300037471 Bacteria 46528
183 Ga0395905_0002146 3300037471 Bacteria 22374
184 Ga0395905_0064228 3300037471 Bacteria 3435
185 Ga0395905_0072213 3300037471 Bacteria 3236
186 Ga0395905_0222355 3300037471 Bacteria 1767
187 Ga0395905_0263140 3300037471 Bacteria 1610
188 Ga0395905_1024812 3300037471 Unclassified 728
189 Ga0395901_0000322 3300038443 Bacteria 59423
190 Ga0395901_0005937 3300038443 Bacteria 12367
191 Ga0395901_0006940 3300038443 Bacteria 11442
192 Ga0395901_0016812 3300038443 Bacteria 7455
193 Ga0395901_0043333 3300038443 Bacteria 4668
194 Ga0395901_0931725 3300038443 Unclassified 849
195 Ga0395901_0968502 3300038443 Bacteria 828
196 Ga0436360_0998372 3300039438 Bacteria 901
197 Ga0439439_0007620 3300041406 Bacteria 2536
198 Ga0451789_0331463 3300041443 Bacteria 664
199 Ga0451793_0374093 3300041452 Unclassified 742
200 Ga0451802_1224764 3300041460 Bacteria 1866
201 Ga0451807_0713284 3300041486 Unclassified 957
202 Ga0451833_0261135 3300041491 Bacteria 700
203 Ga0451835_0638365 3300041492 Bacteria 1548
204 Ga0451839_0867497 3300041496 Bacteria 561
205 Ga0451841_0276703 3300041498 Bacteria 679
206 Ga0451847_0001807 3300041503 Bacteria 694
207 Ga0451851_0216909 3300041507 Bacteria 541
208 Ga0451855_2007153 3300041511 Bacteria 1170
209 Ga0451853_1321286 3300041512 Bacteria 1242
210 Ga0439431_0047339 3300041997 Bacteria 1108
211 Ga0439433_0064079 3300041999 Unclassified 880
212 Ga0439442_010576 3300042002 Bacteria 1873
213 Ga0439445_0159884 3300042004 Unclassified 658
214 Ga0439449_0195101 3300042007 Bacteria 758
215 Ga0439454_052677 3300042011 Bacteria 691
216 Ga0439457_079443 3300042014 Unclassified 753
217 Ga0439462_0030377 3300042015 Bacteria 1429
218 Ga0439446_0010652 3300042156 Bacteria 2482
219 Ga0450909_025855 3300042185 Bacteria 884
220 Ga0439460_0034021 3300042461 Bacteria 1467
221 Ga0466963_0025577 3300044694 Bacteria 3766
222 Ga0466963_0416326 3300044694 Unclassified 948
223 Ga0466971_0089914 3300044719 Bacteria 1405
224 Ga0466957_0005965 3300044842 Bacteria 6870
225 Ga0466960_0065282 3300044901 Bacteria 1797
226 Ga0466959_0079706 3300045049 Bacteria 2361
227 Ga0466958_0032274 3300045836 Bacteria 3115
228 Ga0466967_0000249 3300045976 Bacteria 23684
229 Ga0466967_0131563 3300045976 Bacteria 2323
230 Ga0495603_0021125 3300046455 Unclassified 3941
231 Ga0495582_0059201 3300046473 Bacteria 2113
232 Ga0495639_0032296 3300046475 Bacteria 2334
233 Ga0495662_0340822 3300046476 Unclassified 737
234 Ga0495664_0227341 3300046477 Bacteria 1129
235 Ga0495585_0223279 3300046492 Bacteria 950
236 Ga0495594_0128738 3300046499 Bacteria 1433
237 Ga0495607_0306284 3300046501 Bacteria 746
238 Ga0495618_0315403 3300046514 Bacteria 969
239 Ga0495628_0314438 3300046516 Bacteria 1157
240 Ga0495628_1245135 3300046516 Unclassified 503
241 Ga0495630_0807254 3300046517 Unclassified 716
242 Ga0495630_1145722 3300046517 Bacteria 589
243 Ga0495644_0052438 3300046523 Bacteria 1532
244 Ga0495652_0326876 3300046529 Bacteria 1106
245 Ga0495652_0391267 3300046529 Bacteria 986
246 Ga0495665_0031484 3300046531 Unclassified 2839
247 Ga0495586_0074464 3300046535 Bacteria 1858
248 Ga0495587_0262495 3300046536 Bacteria 970
249 Ga0495587_0482446 3300046536 Bacteria 686
250 Ga0495609_0152049 3300046538 Bacteria 984
251 Ga0495645_0418151 3300046543 Bacteria 851
252 Ga0495656_0075647 3300046615 Bacteria 1507
253 Ga0495657_0142681 3300046675 Bacteria 1492
254 Ga0495623_0025757 3300046679 Bacteria 3788
255 Ga0495647_0056044 3300046681 Bacteria 1544
256 Ga0495658_0017958 3300046683 Bacteria 3668
257 Ga0495613_0123607 3300046689 Unclassified 1857
258 Ga0495613_0420563 3300046689 Bacteria 909
259 Ga0495624_0186886 3300046690 Bacteria 1261
260 Ga0495624_0512656 3300046690 Unclassified 717
261 Ga0495581_0009440 3300047315 Bacteria 5645
262 Ga0495604_0006796 3300047317 Bacteria 9069
263 Ga0495674_0086653 3300047319 Bacteria 2681
264 Ga0495674_0413053 3300047319 Unclassified 1088
265 Ga0495676_0125761 3300047321 Unclassified 1858
266 Ga0495675_0080967 3300047444 Bacteria 2045
267 Ga0495677_0142171 3300047445 Bacteria 922
268 Ga0495684_0420937 3300047471 Bacteria 934
269 Ga0495614_0277752 3300048089 Unclassified 771
270 Ga0496100_0337653 3300048903 Bacteria 1135
271 Ga0496100_1320693 3300048903 Bacteria 569
272 Ga0496101_0201095 3300048904 Bacteria 1540
273 Ga0496102_0338020 3300048905 Bacteria 1418
274 Ga0496102_0753503 3300048905 Bacteria 897
275 Ga0496103_0117364 3300048906 Unclassified 1694
276 Ga0496104_0042671 3300048907 Bacteria 4257
277 Ga0496105_0130021 3300048908 Bacteria 2076
278 Ga0496106_0048544 3300048909 Bacteria 3196
279 Ga0496108_0024527 3300048911 Bacteria 4966
280 Ga0496109_0092549 3300048912 Bacteria 2796
281 Ga0496110_0011531 3300048913 Bacteria 7240
282 Ga0496111_0069472 3300048914 Bacteria 2561
283 Ga0496112_0007797 3300048915 Bacteria 9530
284 Ga0496112_0012567 3300048915 Bacteria 7780
285 Ga0496112_0095422 3300048915 Bacteria 2944
286 Ga0496112_0782587 3300048915 Bacteria 879
287 Ga0496112_0806404 3300048915 Bacteria 863
288 Ga0496113_0077636 3300048916 Bacteria 2539
289 Ga0496113_0629986 3300048916 Bacteria 858
290 Ga0496113_1247085 3300048916 Bacteria 579
291 Ga0496114_0163687 3300048917 Bacteria 1936
292 Ga0496114_0217957 3300048917 Unclassified 1675
293 Ga0501031_0000242 3300049568 Bacteria 30996
294 Ga0501031_0028290 3300049568 Bacteria 3653
295 Ga0501031_0041132 3300049568 Bacteria 3018
296 Ga0501031_0185361 3300049568 Bacteria 1359
297 Ga0501032_0016747 3300049569 Bacteria 5150
298 Ga0501032_0107098 3300049569 Bacteria 1851
299 Ga0501033_0000237 3300049570 Bacteria 53135
300 Ga0501033_0016411 3300049570 Bacteria 5609
301 Ga0501033_0274269 3300049570 Bacteria 1192
302 Ga0501033_0341813 3300049570 Unclassified 1049
303 Ga0501034_0062343 3300049571 Bacteria 3744
304 Ga0501034_0436396 3300049571 Bacteria 1229
305 Ga0501036_0000224 3300049572 Bacteria 37944
306 Ga0501036_0009957 3300049572 Bacteria 7828
307 Ga0501036_0041409 3300049572 Bacteria 3897
308 Ga0501036_0582630 3300049572 Bacteria 929
309 Ga0501037_0000351 3300049573 Bacteria 38838
310 Ga0501037_0018934 3300049573 Bacteria 5075
311 Ga0501038_0000592 3300049574 Bacteria 32132
312 Ga0501038_0027221 3300049574 Bacteria 5089
313 Ga0501038_0272817 3300049574 Bacteria 1333
314 Ga0501039_0007771 3300049575 Bacteria 8179
315 Ga0501039_0011282 3300049575 Bacteria 6806
316 Ga0501039_0023518 3300049575 Bacteria 4728
317 Ga0501039_0767775 3300049575 Unclassified 752
318 Ga0501040_0000743 3300049576 Bacteria 20208
319 Ga0501040_0001103 3300049576 Bacteria 17097
320 Ga0501040_0008314 3300049576 Bacteria 6750
321 Ga0501040_0035929 3300049576 Bacteria 3361
322 Ga0501040_0723144 3300049576 Bacteria 720
323 Ga0501040_0760995 3300049576 Bacteria 701
324 Ga0501041_0000017 3300049577 Bacteria 55768
325 Ga0501041_0007365 3300049577 Bacteria 6460
326 Ga0501041_0011995 3300049577 Bacteria 5128
327 Ga0501041_0023422 3300049577 Bacteria 3703
328 Ga0501041_0606795 3300049577 Bacteria 699
329 Ga0501042_0000294 3300049578 Bacteria 24709
330 Ga0501042_0073798 3300049578 Bacteria 2440
331 Ga0501042_0127264 3300049578 Bacteria 1834
332 Ga0501042_0329368 3300049578 Bacteria 1104
333 Ga0501043_0000329 3300049579 Bacteria 42843
334 Ga0501043_0038071 3300049579 Bacteria 3782
335 Ga0501043_0476626 3300049579 Bacteria 935
336 Ga0501043_0738820 3300049579 Bacteria 716
337 Ga0501046_0001356 3300049580 Bacteria 23654
338 Ga0501046_0016127 3300049580 Bacteria 6266
339 Ga0501046_0035598 3300049580 Bacteria 4011
340 Ga0501046_0059093 3300049580 Bacteria 3005
341 Ga0501046_0449559 3300049580 Bacteria 927
342 Ga0501047_0013956 3300049581 Bacteria 7634
343 Ga0501048_0000243 3300049582 Bacteria 36346
344 Ga0501048_0021469 3300049582 Bacteria 4727
345 Ga0501048_0036263 3300049582 Bacteria 3544
346 Ga0501048_0617246 3300049582 Bacteria 778
347 Ga0501068_0000493 3300049584 Bacteria 20042
348 Ga0501068_0003564 3300049584 Bacteria 8412
349 Ga0501068_0147894 3300049584 Bacteria 1475
350 Ga0501068_0228889 3300049584 Bacteria 1182
351 Ga0501069_0071343 3300049585 Bacteria 1947
352 Ga0501070_0000237 3300049586 Bacteria 51856
353 Ga0501070_0011548 3300049586 Bacteria 7456
354 Ga0501070_0125741 3300049586 Bacteria 2119
355 Ga0501070_0981206 3300049586 Bacteria 656
356 Ga0501071_0000176 3300049587 Bacteria 28221
357 Ga0501071_0038205 3300049587 Bacteria 3430
358 Ga0501071_0051521 3300049587 Bacteria 2966
359 Ga0501071_0367159 3300049587 Bacteria 1096
360 Ga0501071_0618479 3300049587 Bacteria 833
361 Ga0501072_0001283 3300049588 Bacteria 18788
362 Ga0501072_0005390 3300049588 Bacteria 9737
363 Ga0501072_0011637 3300049588 Bacteria 6721
364 Ga0501072_0016325 3300049588 Bacteria 5696
365 Ga0501072_0385271 3300049588 Unclassified 1112
366 Ga0501072_1023943 3300049588 Bacteria 643
367 Ga0501073_0018423 3300049589 Bacteria 5046
368 Ga0501073_0073723 3300049589 Bacteria 2377
369 Ga0501073_0153122 3300049589 Unclassified 1598
370 Ga0501073_0652400 3300049589 Bacteria 726
371 Ga0501074_0000393 3300049590 Bacteria 26006
372 Ga0501074_0000617 3300049590 Bacteria 22153
373 Ga0501074_0009702 3300049590 Bacteria 6992
374 Ga0501074_0761754 3300049590 Bacteria 682
375 Ga0501075_0000033 3300049591 Bacteria 55705
376 Ga0501075_0002477 3300049591 Bacteria 12313
377 Ga0501075_0030929 3300049591 Bacteria 3969
378 Ga0501075_0096192 3300049591 Bacteria 2247
379 Ga0501076_0000081 3300049592 Bacteria 49598
380 Ga0501076_0004976 3300049592 Bacteria 9516
381 Ga0501076_0062455 3300049592 Bacteria 2966
382 Ga0501076_0623827 3300049592 Bacteria 889
383 Ga0501077_0000175 3300049593 Bacteria 36700
384 Ga0501077_0002654 3300049593 Bacteria 10722
385 Ga0501077_0030908 3300049593 Bacteria 3407
386 Ga0501077_0033504 3300049593 Bacteria 3269
387 Ga0501079_0000024 3300049741 Bacteria 62474
388 Ga0501079_0014736 3300049741 Bacteria 5958
389 Ga0501079_0058804 3300049741 Bacteria 2966
390 Ga0501080_0000717 3300049742 Bacteria 26700
391 Ga0501080_0146267 3300049742 Bacteria 2184
392 Ga0501080_0407135 3300049742 Unclassified 1223
393 Ga0501080_0714005 3300049742 Bacteria 883
394 Ga0501080_1596470 3300049742 Bacteria 552
395 Ga0501081_0000663 3300049743 Bacteria 19708
396 Ga0501081_0010049 3300049743 Bacteria 6171
397 Ga0501081_0030466 3300049743 Bacteria 3651
398 Ga0501081_0730575 3300049743 Unclassified 744
399 Ga0501083_0000309 3300049744 Bacteria 30905
400 Ga0501083_0008354 3300049744 Bacteria 7317
401 Ga0501083_0144521 3300049744 Bacteria 1557
402 Ga0501035_0000389 3300049822 Bacteria 50594
403 Ga0501035_0008866 3300049822 Bacteria 9360
404 Ga0501035_0899891 3300049822 Unclassified 701
405 Ga0501044_0001428 3300049823 Bacteria 28051
406 Ga0501044_0055173 3300049823 Bacteria 4082
407 Ga0501044_0244841 3300049823 Bacteria 1736
408 Ga0501044_0352193 3300049823 Bacteria 1392
409 Ga0501045_0000102 3300049824 Bacteria 42092
410 Ga0501045_0007447 3300049824 Bacteria 7602
411 Ga0501045_0053341 3300049824 Bacteria 2954
412 Ga0501045_0148397 3300049824 Bacteria 1744
413 nmdc:mga05p37_25867_c1 3300050507 Bacteria 7136
414 nmdc:mga09592_685_c1 3300050508 Bacteria 25881
415 nmdc:mga0qj67_192006_c1 3300050509 Unclassified 1660
416 nmdc:mga0qj67_247277_c1 3300050509 Bacteria 1447
417 nmdc:mga06r32_97145_c1 3300050510 Bacteria 2886
418 nmdc:mga08y16_571361_c1 3300050511 Unclassified 1142
419 nmdc:mga0n895_389_c1 3300050512 Bacteria 29439
420 nmdc:mga08x19_307931_c1 3300050514 Bacteria 1101
421 nmdc:mga0a205_2223_c1 3300050515 Bacteria 17077
422 Ga0495601_0037166 3300053077 Bacteria 3044
423 Ga0495601_0642651 3300053077 Unclassified 679
424 Ga0495612_0403302 3300053078 Bacteria 621
425 Ga0495619_0353244 3300053085 Bacteria 1017
426 Ga0495619_0665095 3300053085 Bacteria 710
427 Ga0501084_0000210 3300054114 Bacteria 45327
428 Ga0501084_0086975 3300054114 Bacteria 2624
429 Ga0501084_0150336 3300054114 Bacteria 1962
430 Ga0501084_1332614 3300054114 Bacteria 601
431 Ga0590074_015141 3300059423 Bacteria 1308
432 Ga0590077_037992 3300059426 Bacteria 1064
433 Ga0501082_0000122 3300060353 Bacteria 62357
434 Ga0501082_0012884 3300060353 Bacteria 7187
435 Ga0501082_0060226 3300060353 Bacteria 3269
436 Ga0501082_0596533 3300060353 Bacteria 966
437 Ga0501082_0631685 3300060353 Unclassified 937
438 Ga0466962_0024870 3300061719 Bacteria 2875
439 Ga0530510_0000137 3300061734 Bacteria 42732
440 Ga0530510_0000807 3300061734 Bacteria 20405
441 Ga0530510_0109918 3300061734 Bacteria 2018
442 Ga0530510_0146886 3300061734 Bacteria 1739
443 Ga0495674_0408247
444 rootH1_10153823
445 Ga0070658_10053788
446 Ga0070658_10187765
447 Ga0070683_100244386
448 Ga0070690_100111880
449 Ga0070680_100020905
450 Ga0070680_100043721
451 Ga0070680_100270412
452 Ga0070680_100405616
453 Ga0070680_101891413
454 Ga0070682_100032993
455 Ga0070682_100155007
456 Ga0070682_100168957
457 Ga0070660_100150418
458 Ga0070660_100366645
459 Ga0070661_100016699
460 Ga0070661_100161056
461 Ga0070659_100013379
462 Ga0070659_100459549
463 Ga0070709_10335698
464 Ga0070714_100025915
465 Ga0070714_100112875
466 Ga0070701_10599793
467 Ga0070711_100099384
468 Ga0070700_101189143
469 Ga0070708_100548013
470 Ga0070663_100275080
471 Ga0070681_10022345
472 Ga0070681_10051458
473 Ga0070681_10236930
474 Ga0070681_10252509
475 Ga0070681_10835683
476 Ga0070706_100570998
477 Ga0070706_100702244
478 Ga0070707_100232768
479 Ga0070707_100980247
480 Ga0070707_101125847
481 Ga0070698_100167947
482 Ga0070698_100434577
483 Ga0070699_101976439
484 Ga0070679_100074715
485 Ga0070679_100109342
486 Ga0070679_100273823
487 Ga0070679_100669403
488 Ga0070684_100144974
489 Ga0070684_100551170
490 Ga0068853_100066652
491 Ga0070686_100237575
492 Ga0070693_100013052
493 Ga0070665_100028147
494 Ga0068855_100023532
495 Ga0068855_100646579
496 Ga0070664_100528768
497 Ga0068857_100004411
498 Ga0068857_100371421
499 Ga0068854_100235996
500 Ga0068856_100263034
501 Ga0068856_101200567
502 Ga0068856_101806766
503 Ga0070702_100075633
504 Ga0070702_100226223
505 Ga0068852_100026712
506 Ga0068866_10865786
507 Ga0081455_10033697
508 Ga0081455_10274986
509 Ga0081538_10019530
510 Ga0070717_11139925
511 Ga0070712_100163806
512 Ga0075428_100018869
513 Ga0075428_100160619
514 Ga0075428_101403076
515 Ga0075430_100098409
516 Ga0075431_100041597
517 Ga0075429_100026812
518 Ga0068865_100245060
519 Ga0105240_10302095
520 Ga0105240_12044433
521 Ga0111539_10412100
522 Ga0111539_10882035
523 Ga0111539_11043526
524 Ga0105245_10070535
525 Ga0114129_10258089
526 Ga0114129_10311188
527 Ga0105243_10189002
528 Ga0105243_11215898
529 Ga0105241_10111495
530 Ga0105241_10620801
531 Ga0105241_11038937
532 Ga0105241_11233803
533 Ga0105248_10681849
534 Ga0105237_10080338
535 Ga0105238_10021049
536 Ga0105238_10894170
537 Ga0105239_10073635
538 Ga0105239_11303498
539 Ga0157373_10828582
540 Ga0157370_10012493
541 Ga0157370_10205211
542 Ga0157370_10251625
543 Ga0157369_10124400
544 Ga0157374_10031745
545 Ga0157372_10010726
546 Ga0157372_10033806
547 Ga0163163_12878475
548 Ga0182008_10288220
549 Ga0182008_10490610
550 Ga0207705_10012493
551 Ga0207705_10991445
552 Ga0207654_10054297
553 Ga0207654_10802825
554 Ga0207707_10001522
555 Ga0207707_10521252
556 Ga0207707_10553898
557 Ga0207707_10559221
558 Ga0207707_10566480
559 Ga0207671_10219607
560 Ga0207693_10003985
561 Ga0207693_11357125
562 Ga0207663_10075586
563 Ga0207660_10032795
564 Ga0207660_10037809
565 Ga0207660_10167272
566 Ga0207660_10284879
567 Ga0207660_11520696
568 Ga0207657_10002332
569 Ga0207657_10094935
570 Ga0207657_10442364
571 Ga0207649_10087102
572 Ga0207649_10137181
573 Ga0207652_10003632
574 Ga0207652_10141050
575 Ga0207652_10193283
576 Ga0207652_10193720
577 Ga0207646_10141838
578 Ga0207646_11384727
579 Ga0207694_10007321
580 Ga0207664_10310732
581 Ga0207690_10035642
582 Ga0207690_11277501
583 Ga0207686_10235946
584 Ga0207709_10654145
585 Ga0207711_10244334
586 Ga0207661_10087828
587 Ga0207667_10031279
588 Ga0207667_10179739
589 Ga0207640_10228583
590 Ga0207677_10197079
591 Ga0207702_10075786
592 Ga0207648_10178627
593 Ga0207674_10007576
594 Ga0207674_10043518
595 Ga0207683_10074020
596 Ga0207428_10070664
597 Ga0268266_10064529
598 Ga0265334_10201631
599 Ga0265313_10061537
600 Ga0307406_10013949
601 Ga0307407_10000719
602 Ga0307409_100000689
603 Ga0307411_10002799
604 Ga0373947_0190901
605 Ga0373937_0006502
606 Ga0395899_0005043
607 Ga0395899_0240795
608 Ga0395900_0001301
609 Ga0395900_0002544
610 Ga0395900_0010103
611 Ga0395900_0029008
612 Ga0395900_0076043
613 Ga0395900_0104368
614 Ga0395900_0339810
615 Ga0395900_0419013
616 Ga0395898_0014857
617 Ga0395898_0023726
618 Ga0395898_0048290
619 Ga0395898_0049757
620 Ga0395898_0083492
621 Ga0395898_0085617
622 Ga0395898_0261435
623 Ga0395898_0305176
624 Ga0395905_0000645
625 Ga0395905_0002146
626 Ga0395905_0064228
627 Ga0395905_0072213
628 Ga0395905_0222355
629 Ga0395905_0263140
630 Ga0395905_1024812
631 Ga0395901_0000322
632 Ga0395901_0005937
633 Ga0395901_0006940
634 Ga0395901_0016812
635 Ga0395901_0043333
636 Ga0395901_0931725
637 Ga0395901_0968502
638 Ga0436360_0998372
639 Ga0439439_0007620
640 Ga0451789_0331463
641 Ga0451793_0374093
642 Ga0451802_1224764
643 Ga0451807_0713284
644 Ga0451833_0261135
645 Ga0451835_0638365
646 Ga0451839_0867497
647 Ga0451841_0276703
648 Ga0451847_0001807
649 Ga0451851_0216909
650 Ga0451855_2007153
651 Ga0451853_1321286
652 Ga0439431_0047339
653 Ga0439433_0064079
654 Ga0439442_010576
655 Ga0439445_0159884
656 Ga0439449_0195101
657 Ga0439454_052677
658 Ga0439457_079443
659 Ga0439462_0030377
660 Ga0439446_0010652
661 Ga0450909_025855
662 Ga0439460_0034021
663 Ga0466963_0025577
664 Ga0466963_0416326
665 Ga0466971_0089914
666 Ga0466957_0005965
667 Ga0466960_0065282
668 Ga0466959_0079706
669 Ga0466958_0032274
670 Ga0466967_0000249
671 Ga0466967_0131563
672 Ga0495603_0021125
673 Ga0495582_0059201
674 Ga0495639_0032296
675 Ga0495662_0340822
676 Ga0495664_0227341
677 Ga0495585_0223279
678 Ga0495594_0128738
679 Ga0495607_0306284
680 Ga0495618_0315403
681 Ga0495628_0314438
682 Ga0495628_1245135
683 Ga0495630_0807254
684 Ga0495630_1145722
685 Ga0495644_0052438
686 Ga0495652_0326876
687 Ga0495652_0391267
688 Ga0495665_0031484
689 Ga0495586_0074464
690 Ga0495587_0262495
691 Ga0495587_0482446
692 Ga0495609_0152049
693 Ga0495645_0418151
694 Ga0495656_0075647
695 Ga0495657_0142681
696 Ga0495623_0025757
697 Ga0495647_0056044
698 Ga0495658_0017958
699 Ga0495613_0123607
700 Ga0495613_0420563
701 Ga0495624_0186886
702 Ga0495624_0512656
703 Ga0495581_0009440
704 Ga0495604_0006796
705 Ga0495674_0086653
706 Ga0495674_0413053
707 Ga0495676_0125761
708 Ga0495675_0080967
709 Ga0495677_0142171
710 Ga0495684_0420937
711 Ga0495614_0277752
712 Ga0496100_0337653
713 Ga0496100_1320693
714 Ga0496101_0201095
715 Ga0496102_0338020
716 Ga0496102_0753503
717 Ga0496103_0117364
718 Ga0496104_0042671
719 Ga0496105_0130021
720 Ga0496106_0048544
721 Ga0496108_0024527
722 Ga0496109_0092549
723 Ga0496110_0011531
724 Ga0496111_0069472
725 Ga0496112_0007797
726 Ga0496112_0012567
727 Ga0496112_0095422
728 Ga0496112_0782587
729 Ga0496112_0806404
730 Ga0496113_0077636
731 Ga0496113_0629986
732 Ga0496113_1247085
733 Ga0496114_0163687
734 Ga0496114_0217957
735 Ga0501031_0000242
736 Ga0501031_0028290
737 Ga0501031_0041132
738 Ga0501031_0185361
739 Ga0501032_0016747
740 Ga0501032_0107098
741 Ga0501033_0000237
742 Ga0501033_0016411
743 Ga0501033_0274269
744 Ga0501033_0341813
745 Ga0501034_0062343
746 Ga0501034_0436396
747 Ga0501036_0000224
748 Ga0501036_0009957
749 Ga0501036_0041409
750 Ga0501036_0582630
751 Ga0501037_0000351
752 Ga0501037_0018934
753 Ga0501038_0000592
754 Ga0501038_0027221
755 Ga0501038_0272817
756 Ga0501039_0007771
757 Ga0501039_0011282
758 Ga0501039_0023518
759 Ga0501039_0767775
760 Ga0501040_0000743
761 Ga0501040_0001103
762 Ga0501040_0008314
763 Ga0501040_0035929
764 Ga0501040_0723144
765 Ga0501040_0760995
766 Ga0501041_0000017
767 Ga0501041_0007365
768 Ga0501041_0011995
769 Ga0501041_0023422
770 Ga0501041_0606795
771 Ga0501042_0000294
772 Ga0501042_0073798
773 Ga0501042_0127264
774 Ga0501042_0329368
775 Ga0501043_0000329
776 Ga0501043_0038071
777 Ga0501043_0476626
778 Ga0501043_0738820
779 Ga0501046_0001356
780 Ga0501046_0016127
781 Ga0501046_0035598
782 Ga0501046_0059093
783 Ga0501046_0449559
784 Ga0501047_0013956
785 Ga0501048_0000243
786 Ga0501048_0021469
787 Ga0501048_0036263
788 Ga0501048_0617246
789 Ga0501068_0000493
790 Ga0501068_0003564
791 Ga0501068_0147894
792 Ga0501068_0228889
793 Ga0501069_0071343
794 Ga0501070_0000237
795 Ga0501070_0011548
796 Ga0501070_0125741
797 Ga0501070_0981206
798 Ga0501071_0000176
799 Ga0501071_0038205
800 Ga0501071_0051521
801 Ga0501071_0367159
802 Ga0501071_0618479
803 Ga0501072_0001283
804 Ga0501072_0005390
805 Ga0501072_0011637
806 Ga0501072_0016325
807 Ga0501072_0385271
808 Ga0501072_1023943
809 Ga0501073_0018423
810 Ga0501073_0073723
811 Ga0501073_0153122
812 Ga0501073_0652400
813 Ga0501074_0000393
814 Ga0501074_0000617
815 Ga0501074_0009702
816 Ga0501074_0761754
817 Ga0501075_0000033
818 Ga0501075_0002477
819 Ga0501075_0030929
820 Ga0501075_0096192
821 Ga0501076_0000081
822 Ga0501076_0004976
823 Ga0501076_0062455
824 Ga0501076_0623827
825 Ga0501077_0000175
826 Ga0501077_0002654
827 Ga0501077_0030908
828 Ga0501077_0033504
829 Ga0501079_0000024
830 Ga0501079_0014736
831 Ga0501079_0058804
832 Ga0501080_0000717
833 Ga0501080_0146267
834 Ga0501080_0407135
835 Ga0501080_0714005
836 Ga0501080_1596470
837 Ga0501081_0000663
838 Ga0501081_0010049
839 Ga0501081_0030466
840 Ga0501081_0730575
841 Ga0501083_0000309
842 Ga0501083_0008354
843 Ga0501083_0144521
844 Ga0501035_0000389
845 Ga0501035_0008866
846 Ga0501035_0899891
847 Ga0501044_0001428
848 Ga0501044_0055173
849 Ga0501044_0244841
850 Ga0501044_0352193
851 Ga0501045_0000102
852 Ga0501045_0007447
853 Ga0501045_0053341
854 Ga0501045_0148397
855 nmdc:mga05p37_25867_c1
856 nmdc:mga09592_685_c1
857 nmdc:mga0qj67_192006_c1
858 nmdc:mga0qj67_247277_c1
859 nmdc:mga06r32_97145_c1
860 nmdc:mga08y16_571361_c1
861 nmdc:mga0n895_389_c1
862 nmdc:mga08x19_307931_c1
863 nmdc:mga0a205_2223_c1
864 Ga0495601_0037166
865 Ga0495601_0642651
866 Ga0495612_0403302
867 Ga0495619_0353244
868 Ga0495619_0665095
869 Ga0501084_0000210
870 Ga0501084_0086975
871 Ga0501084_0150336
872 Ga0501084_1332614
873 Ga0590074_015141
874 Ga0590077_037992
875 Ga0501082_0000122
876 Ga0501082_0012884
877 Ga0501082_0060226
878 Ga0501082_0596533
879 Ga0501082_0631685
880 Ga0466962_0024870
881 Ga0530510_0000137
882 Ga0530510_0000807
883 Ga0530510_0109918
884 Ga0530510_0146886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

47

113

0.84

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

21

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j4f-assembly1.cif.gz_A crystal structure of the n-terminally his6-tagged hp0902, an uncharacterized protein from helicobacter pylori 26695 0.9095 21 106
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.8963 21 105
7zyb-assembly1.cif.gz_A bekdgf with ca 0.8863 25 106
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.8806 25 106
4ccl-assembly1.cif.gz_B x-ray structure of e. coli ycfd 0.8707 33 107
ID Description Score Start End Superfamily
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8779 23 107 2.60.120.10
2d40B00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8695 35 106 2.60.120.10
af_I1JF86_104_298_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8629 21 109 2.60.120.10
af_P15590_92_287_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8628 21 106 2.60.120.10
5yjsA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.861 21 109 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A538L0C6-F1-model_v4 Cupin domain-containing protein 0.9868 22 106
AF-A0A7V9P344-F1-model_v4 Cupin domain-containing protein 0.9829 7 105
AF-A0A1Q6XG55-F1-model_v4 Cupin type-2 domain-containing protein 0.9782 16 109
AF-A0A537TV13-F1-model_v4 Cupin domain-containing protein 0.9735 4 106
AF-A0A538LKQ0-F1-model_v4 Cupin domain-containing protein 0.9726 4 105

Map