F444896

General Info

Members Datasets Scaffolds Average Seq Length
442 278 884 205

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10288121|Ga0207708_102881211
Length 232
Sequence MARAPWSEARAPDVILFASLEVHSHAMKLIGSSTSPFVRKARIALTEKRIDYEFVLAKPFAPDAQIAQLNPLGKVPVLLIDDGGAIYDSSVIVEYLDTISPVGRLIPEPGRQRIQVKRWEALADGLLDAATLVVLERRRPEQQQSREWIDRHNTKVSDALRAAAHDLGERVWCAGDSYTLADIALGCALGYLDFRFPDLGWRTQHPNLVRHAEKLFKRPPFQATAPYDIAAA

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
171 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
172 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
173 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
174 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
175 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
179 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
206 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
207 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
208 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
226 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
227 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
228 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
236 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
237 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
249 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
264 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
265 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
269 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
270 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
271 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
272 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
273 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
274 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
275 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
276 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
277 2547132512 Azospira oryzae 6a3 Isolate Unclassified
278 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.11
Nodule 0
Rhizoplane 0.9
Rhizosphere 88.46
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10288121 3300026075 Bacteria 1332
2 JGI25154J39366_1002086 3300002738 Bacteria 5659
3 JGI25157J39369_1000341 3300002741 Bacteria 33014
4 Ga0055539_1000813 3300003752 Bacteria 7359
5 Ga0055540_1020591 3300003792 Bacteria 1739
6 Ga0055531_10000333 3300003794 Bacteria 46562
7 Ga0070658_10159985 3300005327 Bacteria 1889
8 Ga0070658_10210006 3300005327 Bacteria 1644
9 Ga0070658_10528907 3300005327 Bacteria 1020
10 Ga0070683_100103219 3300005329 Bacteria 2686
11 Ga0070683_100178286 3300005329 Bacteria 2017
12 Ga0070690_100126581 3300005330 Bacteria 1720
13 Ga0070690_100347415 3300005330 Bacteria 1076
14 Ga0070670_100106488 3300005331 Bacteria 2416
15 Ga0070670_100587776 3300005331 Bacteria 995
16 Ga0070670_100635965 3300005331 Unclassified 956
17 Ga0070677_10022168 3300005333 Bacteria 2336
18 Ga0068869_100157188 3300005334 Bacteria 1767
19 Ga0070682_100099504 3300005337 Bacteria 1917
20 Ga0068868_100434152 3300005338 Bacteria 1139
21 Ga0070660_100076788 3300005339 Bacteria 2616
22 Ga0070689_100279873 3300005340 Bacteria 1384
23 Ga0070689_100379212 3300005340 Bacteria 1191
24 Ga0070687_100311439 3300005343 Bacteria 1002
25 Ga0070687_100714162 3300005343 Bacteria 701
26 Ga0070661_100152080 3300005344 Bacteria 1750
27 Ga0070692_10173057 3300005345 Bacteria 1246
28 Ga0070668_100039023 3300005347 Bacteria 3632
29 Ga0070668_100461220 3300005347 Bacteria 1094
30 Ga0070675_100186954 3300005354 Bacteria 1793
31 Ga0070675_100304647 3300005354 Bacteria 1404
32 Ga0070671_100299733 3300005355 Bacteria 1368
33 Ga0070674_100017035 3300005356 Bacteria 4561
34 Ga0070674_100018234 3300005356 Bacteria 4434
35 Ga0070673_100066421 3300005364 Bacteria 2881
36 Ga0070659_100078481 3300005366 Bacteria 2634
37 Ga0070659_100563466 3300005366 Bacteria 976
38 Ga0070701_10283865 3300005438 Bacteria 1012
39 Ga0070663_100000730 3300005455 Bacteria 17702
40 Ga0070681_10744858 3300005458 Bacteria 896
41 Ga0068867_100000076 3300005459 Bacteria 59983
42 Ga0068867_100213374 3300005459 Bacteria 1551
43 Ga0070679_100083376 3300005530 Bacteria 3185
44 Ga0070679_100109390 3300005530 Bacteria 2750
45 Ga0070684_100396948 3300005535 Bacteria 1271
46 Ga0070684_100903757 3300005535 Bacteria 827
47 Ga0068853_100137498 3300005539 Bacteria 2191
48 Ga0068853_100412959 3300005539 Bacteria 1265
49 Ga0070672_100236545 3300005543 Bacteria 1535
50 Ga0070672_100280548 3300005543 Bacteria 1408
51 Ga0070672_100694915 3300005543 Bacteria 890
52 Ga0070686_100805230 3300005544 Bacteria 758
53 Ga0070696_100383884 3300005546 Bacteria 1095
54 Ga0070665_100296405 3300005548 Bacteria 1620
55 Ga0070704_100135181 3300005549 Bacteria 1917
56 Ga0070704_100185198 3300005549 Bacteria 1669
57 Ga0068855_100032493 3300005563 Bacteria 6231
58 Ga0068855_100099397 3300005563 Bacteria 3351
59 Ga0068855_100219994 3300005563 Bacteria 2130
60 Ga0068855_100236568 3300005563 Bacteria 2042
61 Ga0068855_100313765 3300005563 Bacteria 1734
62 Ga0070664_100337726 3300005564 Bacteria 1368
63 Ga0068857_100009087 3300005577 Bacteria 8622
64 Ga0068857_100030365 3300005577 Bacteria 4772
65 Ga0068857_100080298 3300005577 Bacteria 2912
66 Ga0068857_101328635 3300005577 Bacteria 698
67 Ga0068854_100145135 3300005578 Bacteria 1825
68 Ga0068854_100570574 3300005578 Bacteria 962
69 Ga0068856_100003535 3300005614 Bacteria 15759
70 Ga0068856_100279896 3300005614 Bacteria 1685
71 Ga0070702_100182463 3300005615 Bacteria 1374
72 Ga0068852_100050911 3300005616 Bacteria 3552
73 Ga0068852_100051638 3300005616 Bacteria 3530
74 Ga0068852_100109179 3300005616 Bacteria 2512
75 Ga0068859_100254164 3300005617 Bacteria 1848
76 Ga0068859_100471940 3300005617 Bacteria 1350
77 Ga0068864_100052156 3300005618 Bacteria 3525
78 Ga0068864_100782934 3300005618 Bacteria 936
79 Ga0068866_10446444 3300005718 Unclassified 845
80 Ga0068861_100322036 3300005719 Bacteria 1347
81 Ga0068870_10168645 3300005840 Bacteria 1304
82 Ga0068863_100124845 3300005841 Bacteria 2455
83 Ga0068863_100133824 3300005841 Bacteria 2368
84 Ga0068858_100100429 3300005842 Bacteria 2698
85 Ga0068858_100185812 3300005842 Bacteria 1963
86 Ga0068860_100294331 3300005843 Bacteria 1589
87 Ga0068862_100191911 3300005844 Bacteria 1838
88 Ga0068862_100377456 3300005844 Bacteria 1321
89 Ga0075365_10216108 3300006038 Bacteria 1344
90 Ga0075365_10226327 3300006038 Bacteria 1312
91 Ga0075365_10693435 3300006038 Bacteria 719
92 Ga0075363_100107043 3300006048 Bacteria 1551
93 Ga0075363_100358400 3300006048 Bacteria 853
94 Ga0075362_10039117 3300006177 Bacteria 2084
95 Ga0075366_10180638 3300006195 Bacteria 1282
96 Ga0075366_10517788 3300006195 Bacteria 738
97 Ga0097621_100342685 3300006237 Bacteria 1327
98 Ga0097621_100366017 3300006237 Bacteria 1285
99 Ga0068871_100041736 3300006358 Bacteria 3680
100 Ga0068871_100042413 3300006358 Bacteria 3652
101 Ga0075428_100061373 3300006844 Bacteria 4117
102 Ga0075428_100550672 3300006844 Bacteria 1233
103 Ga0075428_101268658 3300006844 Bacteria 775
104 Ga0075430_100039475 3300006846 Bacteria 3997
105 Ga0075431_101019399 3300006847 Bacteria 794
106 Ga0075429_100142563 3300006880 Bacteria 2097
107 Ga0075429_100704502 3300006880 Unclassified 884
108 Ga0068865_100337846 3300006881 Bacteria 1216
109 Ga0097620_100254167 3300006931 Bacteria 1848
110 Ga0097620_100471888 3300006931 Bacteria 1350
111 Ga0097620_100806912 3300006931 Bacteria 1026
112 Ga0105240_10012435 3300009093 Bacteria 11750
113 Ga0105240_10445964 3300009093 Bacteria 1449
114 Ga0105240_10593469 3300009093 Bacteria 1220
115 Ga0111539_10026639 3300009094 Bacteria 7067
116 Ga0111539_10361201 3300009094 Bacteria 1690
117 Ga0105245_10007063 3300009098 Bacteria 9851
118 Ga0105245_10235905 3300009098 Bacteria 1771
119 Ga0114129_10330496 3300009147 Bacteria 2024
120 Ga0105243_10001449 3300009148 Bacteria 20854
121 Ga0105243_10177497 3300009148 Bacteria 1850
122 Ga0105241_10050428 3300009174 Bacteria 3172
123 Ga0105242_10077242 3300009176 Bacteria 2778
124 Ga0105242_10200343 3300009176 Bacteria 1773
125 Ga0105248_10038120 3300009177 Bacteria 5378
126 Ga0105248_10859542 3300009177 Bacteria 1024
127 Ga0105237_10007206 3300009545 Bacteria 12208
128 Ga0105238_10031327 3300009551 Bacteria 5413
129 Ga0105238_10079743 3300009551 Bacteria 3263
130 Ga0105238_10181049 3300009551 Bacteria 2084
131 Ga0105249_10296333 3300009553 Bacteria 1621
132 Ga0105239_10038998 3300010375 Bacteria 5204
133 Ga0105239_10367280 3300010375 Bacteria 1626
134 Ga0105239_10709759 3300010375 Bacteria 1150
135 Ga0157373_10217299 3300013100 Bacteria 1348
136 Ga0157369_10081455 3300013105 Bacteria 3464
137 Ga0157374_10136348 3300013296 Bacteria 2380
138 Ga0157374_10282946 3300013296 Bacteria 1638
139 Ga0157374_10897704 3300013296 Bacteria 904
140 Ga0157378_10421247 3300013297 Bacteria 1320
141 Ga0163162_10285152 3300013306 Bacteria 1783
142 Ga0163162_11101077 3300013306 Bacteria 900
143 Ga0157375_10138648 3300013308 Bacteria 2558
144 Ga0157375_10411203 3300013308 Bacteria 1519
145 Ga0163163_10020142 3300014325 Bacteria 6279
146 Ga0163163_11543511 3300014325 Bacteria 725
147 Ga0157380_10209302 3300014326 Bacteria 1737
148 Ga0157377_10000006 3300014745 Bacteria 419853
149 Ga0157377_10181625 3300014745 Bacteria 1323
150 Ga0157379_10361461 3300014968 Bacteria 1330
151 Ga0157376_10004513 3300014969 Bacteria 9701
152 Ga0157376_10131339 3300014969 Bacteria 2235
153 Ga0157376_10458794 3300014969 Unclassified 1245
154 Ga0163161_10010630 3300017792 Bacteria 6373
155 Ga0209646_1000012 3300025246 Bacteria 573300
156 Ga0209026_1000004 3300025250 Bacteria 949012
157 Ga0209677_100150 3300025253 Bacteria 64346
158 Ga0209759_1000003 3300025256 Bacteria 792130
159 Ga0209759_1000067 3300025256 Bacteria 183764
160 Ga0209673_1011484 3300025273 Bacteria 3647
161 Ga0209673_1024619 3300025273 Bacteria 2018
162 Ga0209130_1017550 3300025284 Bacteria 1703
163 Ga0209051_1000214 3300025303 Bacteria 98444
164 Ga0209257_1000015 3300025304 Bacteria 908141
165 Ga0207682_10001068 3300025893 Bacteria 12641
166 Ga0207642_10120935 3300025899 Bacteria 1350
167 Ga0207642_10323562 3300025899 Bacteria 901
168 Ga0207688_10033843 3300025901 Bacteria 2828
169 Ga0207645_10012872 3300025907 Bacteria 5662
170 Ga0207705_10353125 3300025909 Bacteria 1133
171 Ga0207705_10380505 3300025909 Bacteria 1090
172 Ga0207654_10087740 3300025911 Bacteria 1888
173 Ga0207654_10538426 3300025911 Bacteria 828
174 Ga0207707_10048305 3300025912 Bacteria 3707
175 Ga0207695_10074404 3300025913 Bacteria 3459
176 Ga0207671_10017207 3300025914 Bacteria 5584
177 Ga0207662_10015271 3300025918 Bacteria 4321
178 Ga0207657_10011675 3300025919 Bacteria 8706
179 Ga0207657_10058343 3300025919 Bacteria 3322
180 Ga0207657_10659520 3300025919 Bacteria 814
181 Ga0207649_10084544 3300025920 Bacteria 2063
182 Ga0207652_10028160 3300025921 Bacteria 4686
183 Ga0207652_10113141 3300025921 Bacteria 2409
184 Ga0207652_10184636 3300025921 Bacteria 1875
185 Ga0207681_10340461 3300025923 Bacteria 1198
186 Ga0207694_10024111 3300025924 Bacteria 4620
187 Ga0207694_10092064 3300025924 Bacteria 2393
188 Ga0207650_10007896 3300025925 Bacteria 7250
189 Ga0207659_10057211 3300025926 Bacteria 2795
190 Ga0207659_10134104 3300025926 Bacteria 1915
191 Ga0207687_10973206 3300025927 Bacteria 727
192 Ga0207644_10115095 3300025931 Bacteria 2039
193 Ga0207686_10159651 3300025934 Bacteria 1579
194 Ga0207709_10001013 3300025935 Bacteria 20832
195 Ga0207669_10303589 3300025937 Bacteria 1214
196 Ga0207704_10429242 3300025938 Unclassified 1050
197 Ga0207691_10072113 3300025940 Bacteria 3115
198 Ga0207691_10244361 3300025940 Bacteria 1551
199 Ga0207691_10424977 3300025940 Bacteria 1132
200 Ga0207711_10986907 3300025941 Bacteria 781
201 Ga0207689_10065764 3300025942 Bacteria 2982
202 Ga0207689_10075995 3300025942 Bacteria 2761
203 Ga0207661_10172045 3300025944 Bacteria 1886
204 Ga0207667_10017442 3300025949 Bacteria 8078
205 Ga0207667_10194554 3300025949 Bacteria 2081
206 Ga0207667_10229165 3300025949 Bacteria 1903
207 Ga0207667_10426388 3300025949 Bacteria 1349
208 Ga0207651_10034290 3300025960 Bacteria 3285
209 Ga0207668_10296762 3300025972 Bacteria 1332
210 Ga0207677_10612282 3300026023 Bacteria 957
211 Ga0207703_10160378 3300026035 Bacteria 1969
212 Ga0207639_10039642 3300026041 Bacteria 3511
213 Ga0207639_10291723 3300026041 Bacteria 1438
214 Ga0207678_10000060 3300026067 Bacteria 85708
215 Ga0207678_10417624 3300026067 Bacteria 1163
216 Ga0207708_10042148 3300026075 Bacteria 3480
217 Ga0207702_10001911 3300026078 Bacteria 20342
218 Ga0207641_10154282 3300026088 Bacteria 2082
219 Ga0207648_10008141 3300026089 Bacteria 10195
220 Ga0207648_10011312 3300026089 Bacteria 8412
221 Ga0207648_10556186 3300026089 Unclassified 1054
222 Ga0207674_10032484 3300026116 Bacteria 5474
223 Ga0207674_10049178 3300026116 Bacteria 4314
224 Ga0207674_10058558 3300026116 Bacteria 3902
225 Ga0207674_10387340 3300026116 Bacteria 1351
226 Ga0207675_100111423 3300026118 Bacteria 2582
227 Ga0207683_10015792 3300026121 Bacteria 6427
228 Ga0207698_10005394 3300026142 Bacteria 7895
229 Ga0207698_10014920 3300026142 Bacteria 5184
230 Ga0207698_10094205 3300026142 Bacteria 2461
231 Ga0268266_10515395 3300028379 Bacteria 1143
232 Ga0268264_10401286 3300028381 Bacteria 1318
233 Ga0268264_10816037 3300028381 Bacteria 933
234 Ga0307515_10001320 3300028794 Bacteria 56334
235 Ga0307515_10021749 3300028794 Bacteria 11347
236 Ga0265338_10000113 3300028800 Bacteria 150993
237 Ga0265324_10026466 3300029957 Bacteria 2053
238 Ga0265332_10000004 3300031238 Bacteria 426592
239 Ga0265332_10000006 3300031238 Bacteria 327963
240 Ga0265332_10017342 3300031238 Bacteria 3178
241 Ga0265328_10035886 3300031239 Bacteria 1833
242 Ga0265328_10057245 3300031239 Bacteria 1431
243 Ga0265320_10043733 3300031240 Bacteria 2212
244 Ga0265325_10153123 3300031241 Bacteria 1089
245 Ga0265329_10022323 3300031242 Bacteria 2118
246 Ga0265331_10053698 3300031250 Bacteria 1921
247 Ga0265327_10060132 3300031251 Bacteria 1943
248 Ga0265316_10220401 3300031344 Bacteria 1400
249 Ga0265316_10613112 3300031344 Bacteria 771
250 Ga0307408_100403511 3300031548 Bacteria 1174
251 Ga0265313_10197283 3300031595 Bacteria 839
252 Ga0265314_10000960 3300031711 Bacteria 33864
253 Ga0265314_10014690 3300031711 Bacteria 6249
254 Ga0265314_10025776 3300031711 Bacteria 4429
255 Ga0265314_10125412 3300031711 Bacteria 1609
256 Ga0265342_10067859 3300031712 Bacteria 2086
257 Ga0307516_10000973 3300031730 Bacteria 39600
258 Ga0307412_10032019 3300031911 Bacteria 3327
259 Ga0307412_10259273 3300031911 Bacteria 1354
260 Ga0307416_100329196 3300032002 Bacteria 1534
261 Ga0307414_10173489 3300032004 Bacteria 1726
262 Ga0307411_11246506 3300032005 Bacteria 676
263 Ga0373938_0012359 3300034957 Bacteria 1601
264 Ga0373928_0032500 3300035084 Bacteria 1164
265 Ga0373940_0158973 3300035088 Bacteria 724
266 Ga0395899_0003555 3300037312 Bacteria 12338
267 Ga0395899_0044364 3300037312 Bacteria 3313
268 Ga0395900_0005229 3300037418 Bacteria 13619
269 Ga0395900_0040082 3300037418 Bacteria 4826
270 Ga0395900_0090018 3300037418 Bacteria 3154
271 Ga0395900_0175952 3300037418 Bacteria 2176
272 Ga0395900_0658762 3300037418 Bacteria 983
273 Ga0395898_0029810 3300037466 Bacteria 5461
274 Ga0395898_0058007 3300037466 Bacteria 3770
275 Ga0395898_0058632 3300037466 Bacteria 3747
276 Ga0395898_0072472 3300037466 Bacteria 3328
277 Ga0395905_0000047 3300037471 Bacteria 237582
278 Ga0395905_0001133 3300037471 Bacteria 33350
279 Ga0395905_0008913 3300037471 Bacteria 9850
280 Ga0395905_0015524 3300037471 Bacteria 7238
281 Ga0395905_0029583 3300037471 Bacteria 5161
282 Ga0395905_0039142 3300037471 Bacteria 4448
283 Ga0395905_0114328 3300037471 Bacteria 2536
284 Ga0395905_0145539 3300037471 Bacteria 2229
285 Ga0395905_0204600 3300037471 Bacteria 1850
286 Ga0395905_0238791 3300037471 Bacteria 1698
287 Ga0395905_0260120 3300037471 Bacteria 1620
288 Ga0395905_0288917 3300037471 Bacteria 1526
289 Ga0395905_0500067 3300037471 Bacteria 1116
290 Ga0395901_0009451 3300038443 Bacteria 9892
291 Ga0395901_0010842 3300038443 Bacteria 9242
292 Ga0395901_0011724 3300038443 Bacteria 8885
293 Ga0395901_0021623 3300038443 Bacteria 6590
294 Ga0395901_0112741 3300038443 Bacteria 2855
295 Ga0395901_0163178 3300038443 Bacteria 2340
296 Ga0395901_0219268 3300038443 Bacteria 1989
297 Ga0436360_0276311 3300039438 Bacteria 918
298 Ga0439439_0043404 3300041406 Bacteria 1169
299 Ga0439433_0034959 3300041999 Bacteria 1158
300 Ga0439433_0039105 3300041999 Bacteria 1101
301 Ga0439449_0000317 3300042007 Bacteria 17464
302 Ga0439457_023412 3300042014 Bacteria 1367
303 Ga0439462_0036882 3300042015 Bacteria 1301
304 Ga0450923_014715 3300042125 Bacteria 1455
305 Ga0439446_0007493 3300042156 Bacteria 2870
306 Ga0439458_0029747 3300042157 Bacteria 1297
307 Ga0439434_0162507 3300042435 Bacteria 742
308 Ga0439464_0009508 3300042439 Bacteria 2559
309 Ga0451577_0000126 3300042876 Bacteria 168037
310 Ga0451577_0001338 3300042876 Bacteria 33477
311 Ga0451577_0017496 3300042876 Bacteria 6621
312 Ga0451577_0048719 3300042876 Bacteria 3784
313 Ga0451577_0067682 3300042876 Bacteria 3186
314 Ga0451577_0958089 3300042876 Bacteria 769
315 Ga0466969_0008374 3300044656 Bacteria 5483
316 Ga0453683_0001138 3300044673 Bacteria 24154
317 Ga0453683_0026745 3300044673 Bacteria 3663
318 Ga0466965_0086805 3300044683 Bacteria 1587
319 Ga0466966_0003980 3300044684 Bacteria 9759
320 Ga0466966_0021246 3300044684 Bacteria 4263
321 Ga0466961_0002664 3300044693 Bacteria 11073
322 Ga0466961_0031263 3300044693 Bacteria 3422
323 Ga0466961_0156318 3300044693 Bacteria 1422
324 Ga0466964_0012225 3300044706 Bacteria 3247
325 Ga0453684_0000365 3300044712 Bacteria 186233
326 Ga0453684_0031332 3300044712 Bacteria 7478
327 Ga0453684_0342383 3300044712 Bacteria 1688
328 Ga0453684_0926497 3300044712 Bacteria 931
329 Ga0466971_0103715 3300044719 Bacteria 1308
330 Ga0466971_0129720 3300044719 Bacteria 1170
331 Ga0466970_0459516 3300044765 Bacteria 730
332 Ga0466957_0026889 3300044842 Bacteria 3415
333 Ga0466960_0017714 3300044901 Bacteria 3111
334 Ga0466959_0000517 3300045049 Bacteria 22405
335 Ga0466959_0025103 3300045049 Bacteria 4414
336 Ga0466959_0296523 3300045049 Bacteria 1108
337 Ga0451576_0000627 3300045051 Bacteria 73597
338 Ga0451576_0006791 3300045051 Bacteria 13913
339 Ga0451576_0056022 3300045051 Bacteria 4124
340 Ga0451576_0233699 3300045051 Bacteria 1920
341 Ga0451576_0621434 3300045051 Bacteria 1135
342 Ga0466958_0094282 3300045836 Bacteria 1854
343 Ga0495627_000007 3300046453 Bacteria 575915
344 Ga0495650_0009002 3300046471 Bacteria 5737
345 Ga0495605_0001617 3300046474 Bacteria 14594
346 Ga0495605_0001777 3300046474 Bacteria 13823
347 Ga0495605_0216044 3300046474 Bacteria 830
348 Ga0495584_0001462 3300046491 Bacteria 14191
349 Ga0495584_0024722 3300046491 Bacteria 3045
350 Ga0495585_0020862 3300046492 Bacteria 3764
351 Ga0495596_0001420 3300046500 Bacteria 13740
352 Ga0495607_0007314 3300046501 Bacteria 7654
353 Ga0495583_0000060 3300046506 Bacteria 199091
354 Ga0495606_0212391 3300046507 Bacteria 1095
355 Ga0495616_0006711 3300046513 Bacteria 6943
356 Ga0495631_0003039 3300046518 Bacteria 9269
357 Ga0495632_0000750 3300046519 Bacteria 29271
358 Ga0495637_0061942 3300046520 Bacteria 1532
359 Ga0495644_0003522 3300046523 Bacteria 6192
360 Ga0495644_0017777 3300046523 Bacteria 2716
361 Ga0495642_0017515 3300046528 Bacteria 2799
362 Ga0495642_0110354 3300046528 Bacteria 1176
363 Ga0495609_0000055 3300046538 Bacteria 146808
364 Ga0495609_0013520 3300046538 Bacteria 3852
365 Ga0495633_0015841 3300046558 Bacteria 3903
366 Ga0495656_0196314 3300046615 Bacteria 999
367 Ga0495668_0009474 3300046616 Bacteria 5981
368 Ga0495611_0003537 3300046648 Bacteria 6871
369 Ga0495625_0401830 3300046660 Bacteria 856
370 Ga0495661_0027704 3300046665 Bacteria 3633
371 Ga0495588_0151227 3300046674 Bacteria 1227
372 Ga0495669_0015279 3300046684 Bacteria 3287
373 Ga0495669_0135359 3300046684 Bacteria 1161
374 Ga0495649_0029676 3300046694 Bacteria 3023
375 Ga0495589_0010929 3300046794 Bacteria 4715
376 Ga0495660_0000091 3300046810 Bacteria 98065
377 Ga0495660_0002081 3300046810 Bacteria 12968
378 Ga0495660_0014872 3300046810 Bacteria 4500
379 Ga0495636_0131165 3300047318 Bacteria 1115
380 Ga0495672_0003337 3300047320 Bacteria 13835
381 Ga0495683_0003166 3300047323 Bacteria 9611
382 Ga0495677_0000375 3300047445 Bacteria 19231
383 Ga0495679_011019 3300047446 Bacteria 3515
384 Ga0495685_005674 3300047447 Bacteria 4080
385 Ga0495673_0000113 3300047469 Bacteria 163495
386 Ga0495681_0001779 3300047470 Bacteria 15879
387 Ga0495681_0004114 3300047470 Bacteria 10002
388 Ga0495626_0000364 3300048091 Bacteria 47517
389 Ga0496102_0375683 3300048905 Bacteria 1338
390 Ga0496110_0077412 3300048913 Bacteria 2959
391 Ga0496113_0209222 3300048916 Bacteria 1552
392 Ga0496115_0259384 3300048918 Bacteria 1430
393 Ga0496116_0022976 3300048919 Bacteria 4655
394 Ga0496124_0027485 3300048927 Bacteria 5106
395 Ga0496124_0146518 3300048927 Bacteria 1857
396 Ga0495678_002149 3300049459 Bacteria 13932
397 Ga0501031_0142607 3300049568 Bacteria 1566
398 Ga0501034_0051718 3300049571 Bacteria 4142
399 Ga0501036_0145630 3300049572 Bacteria 1998
400 Ga0501038_0165245 3300049574 Bacteria 1796
401 Ga0501039_0617164 3300049575 Bacteria 850
402 Ga0501043_0268102 3300049579 Bacteria 1311
403 Ga0501046_0040347 3300049580 Bacteria 3731
404 Ga0501047_0228903 3300049581 Bacteria 1713
405 Ga0501067_0135417 3300049583 Bacteria 1372
406 Ga0501073_0177134 3300049589 Bacteria 1476
407 Ga0501198_000033 3300049649 Bacteria 56683
408 Ga0501222_000016 3300049662 Bacteria 80046
409 Ga0501035_0044988 3300049822 Bacteria 3973
410 Ga0501035_0054941 3300049822 Bacteria 3556
411 Ga0501035_0348121 3300049822 Bacteria 1240
412 Ga0501044_0146830 3300049823 Bacteria 2343
413 Ga0501044_0215010 3300049823 Bacteria 1875
414 nmdc:mga03683_36001_c1 3300050489 Bacteria 2011
415 nmdc:mga03683_65322_c1 3300050489 Bacteria 1545
416 nmdc:mga0yw44_165072_c1 3300050492 Bacteria 1451
417 nmdc:mga0k408_393440_c1 3300050493 Bacteria 825
418 nmdc:mga0k408_52525_c1 3300050493 Bacteria 2362
419 nmdc:mga06z11_191113_c1 3300050494 Bacteria 1185
420 nmdc:mga05p37_474102_c1 3300050507 Bacteria 1443
421 nmdc:mga09592_46740_c1 3300050508 Bacteria 3646
422 nmdc:mga0qj67_715928_c1 3300050509 Bacteria 796
423 nmdc:mga06r32_1016990_c1 3300050510 Bacteria 781
424 nmdc:mga08y16_346151_c1 3300050511 Bacteria 1527
425 nmdc:mga0n895_599947_c1 3300050512 Bacteria 1103
426 nmdc:mga0rr50_656528_c1 3300050513 Bacteria 895
427 Ga0500562_069250 3300053108 Bacteria 951
428 Ga0500594_0142383 3300053118 Bacteria 766
429 Ga0500561_0059569 3300053137 Bacteria 1066
430 Ga0500622_0035554 3300053156 Bacteria 2607
431 Ga0466962_0305151 3300061719 Bacteria 788
432 2501070944 2501025501 Bacteria 7768574
433 2501078908 2501025502 Bacteria 9641094
434 2501413775 2501025504 Bacteria 8008976
435 2511089546 2510917013 Bacteria 9951648
436 2511094956 2510917014 Bacteria 8296963
437 2511104615 2510917015 Bacteria 7950052
438 2511383335 2511231026 Bacteria 5225445
439 2516016930 2515154189 Bacteria 9629850
440 2526213296 2526164512 Bacteria 4025691
441 2548847744 2547132512 Bacteria 3416496
442 2883094688 2883087390 Bacteria 9532701
443 Ga0207708_10288121
444 JGI25154J39366_1002086
445 JGI25157J39369_1000341
446 Ga0055539_1000813
447 Ga0055540_1020591
448 Ga0055531_10000333
449 Ga0070658_10159985
450 Ga0070658_10210006
451 Ga0070658_10528907
452 Ga0070683_100103219
453 Ga0070683_100178286
454 Ga0070690_100126581
455 Ga0070690_100347415
456 Ga0070670_100106488
457 Ga0070670_100587776
458 Ga0070670_100635965
459 Ga0070677_10022168
460 Ga0068869_100157188
461 Ga0070682_100099504
462 Ga0068868_100434152
463 Ga0070660_100076788
464 Ga0070689_100279873
465 Ga0070689_100379212
466 Ga0070687_100311439
467 Ga0070687_100714162
468 Ga0070661_100152080
469 Ga0070692_10173057
470 Ga0070668_100039023
471 Ga0070668_100461220
472 Ga0070675_100186954
473 Ga0070675_100304647
474 Ga0070671_100299733
475 Ga0070674_100017035
476 Ga0070674_100018234
477 Ga0070673_100066421
478 Ga0070659_100078481
479 Ga0070659_100563466
480 Ga0070701_10283865
481 Ga0070663_100000730
482 Ga0070681_10744858
483 Ga0068867_100000076
484 Ga0068867_100213374
485 Ga0070679_100083376
486 Ga0070679_100109390
487 Ga0070684_100396948
488 Ga0070684_100903757
489 Ga0068853_100137498
490 Ga0068853_100412959
491 Ga0070672_100236545
492 Ga0070672_100280548
493 Ga0070672_100694915
494 Ga0070686_100805230
495 Ga0070696_100383884
496 Ga0070665_100296405
497 Ga0070704_100135181
498 Ga0070704_100185198
499 Ga0068855_100032493
500 Ga0068855_100099397
501 Ga0068855_100219994
502 Ga0068855_100236568
503 Ga0068855_100313765
504 Ga0070664_100337726
505 Ga0068857_100009087
506 Ga0068857_100030365
507 Ga0068857_100080298
508 Ga0068857_101328635
509 Ga0068854_100145135
510 Ga0068854_100570574
511 Ga0068856_100003535
512 Ga0068856_100279896
513 Ga0070702_100182463
514 Ga0068852_100050911
515 Ga0068852_100051638
516 Ga0068852_100109179
517 Ga0068859_100254164
518 Ga0068859_100471940
519 Ga0068864_100052156
520 Ga0068864_100782934
521 Ga0068866_10446444
522 Ga0068861_100322036
523 Ga0068870_10168645
524 Ga0068863_100124845
525 Ga0068863_100133824
526 Ga0068858_100100429
527 Ga0068858_100185812
528 Ga0068860_100294331
529 Ga0068862_100191911
530 Ga0068862_100377456
531 Ga0075365_10216108
532 Ga0075365_10226327
533 Ga0075365_10693435
534 Ga0075363_100107043
535 Ga0075363_100358400
536 Ga0075362_10039117
537 Ga0075366_10180638
538 Ga0075366_10517788
539 Ga0097621_100342685
540 Ga0097621_100366017
541 Ga0068871_100041736
542 Ga0068871_100042413
543 Ga0075428_100061373
544 Ga0075428_100550672
545 Ga0075428_101268658
546 Ga0075430_100039475
547 Ga0075431_101019399
548 Ga0075429_100142563
549 Ga0075429_100704502
550 Ga0068865_100337846
551 Ga0097620_100254167
552 Ga0097620_100471888
553 Ga0097620_100806912
554 Ga0105240_10012435
555 Ga0105240_10445964
556 Ga0105240_10593469
557 Ga0111539_10026639
558 Ga0111539_10361201
559 Ga0105245_10007063
560 Ga0105245_10235905
561 Ga0114129_10330496
562 Ga0105243_10001449
563 Ga0105243_10177497
564 Ga0105241_10050428
565 Ga0105242_10077242
566 Ga0105242_10200343
567 Ga0105248_10038120
568 Ga0105248_10859542
569 Ga0105237_10007206
570 Ga0105238_10031327
571 Ga0105238_10079743
572 Ga0105238_10181049
573 Ga0105249_10296333
574 Ga0105239_10038998
575 Ga0105239_10367280
576 Ga0105239_10709759
577 Ga0157373_10217299
578 Ga0157369_10081455
579 Ga0157374_10136348
580 Ga0157374_10282946
581 Ga0157374_10897704
582 Ga0157378_10421247
583 Ga0163162_10285152
584 Ga0163162_11101077
585 Ga0157375_10138648
586 Ga0157375_10411203
587 Ga0163163_10020142
588 Ga0163163_11543511
589 Ga0157380_10209302
590 Ga0157377_10000006
591 Ga0157377_10181625
592 Ga0157379_10361461
593 Ga0157376_10004513
594 Ga0157376_10131339
595 Ga0157376_10458794
596 Ga0163161_10010630
597 Ga0209646_1000012
598 Ga0209026_1000004
599 Ga0209677_100150
600 Ga0209759_1000003
601 Ga0209759_1000067
602 Ga0209673_1011484
603 Ga0209673_1024619
604 Ga0209130_1017550
605 Ga0209051_1000214
606 Ga0209257_1000015
607 Ga0207682_10001068
608 Ga0207642_10120935
609 Ga0207642_10323562
610 Ga0207688_10033843
611 Ga0207645_10012872
612 Ga0207705_10353125
613 Ga0207705_10380505
614 Ga0207654_10087740
615 Ga0207654_10538426
616 Ga0207707_10048305
617 Ga0207695_10074404
618 Ga0207671_10017207
619 Ga0207662_10015271
620 Ga0207657_10011675
621 Ga0207657_10058343
622 Ga0207657_10659520
623 Ga0207649_10084544
624 Ga0207652_10028160
625 Ga0207652_10113141
626 Ga0207652_10184636
627 Ga0207681_10340461
628 Ga0207694_10024111
629 Ga0207694_10092064
630 Ga0207650_10007896
631 Ga0207659_10057211
632 Ga0207659_10134104
633 Ga0207687_10973206
634 Ga0207644_10115095
635 Ga0207686_10159651
636 Ga0207709_10001013
637 Ga0207669_10303589
638 Ga0207704_10429242
639 Ga0207691_10072113
640 Ga0207691_10244361
641 Ga0207691_10424977
642 Ga0207711_10986907
643 Ga0207689_10065764
644 Ga0207689_10075995
645 Ga0207661_10172045
646 Ga0207667_10017442
647 Ga0207667_10194554
648 Ga0207667_10229165
649 Ga0207667_10426388
650 Ga0207651_10034290
651 Ga0207668_10296762
652 Ga0207677_10612282
653 Ga0207703_10160378
654 Ga0207639_10039642
655 Ga0207639_10291723
656 Ga0207678_10000060
657 Ga0207678_10417624
658 Ga0207708_10042148
659 Ga0207702_10001911
660 Ga0207641_10154282
661 Ga0207648_10008141
662 Ga0207648_10011312
663 Ga0207648_10556186
664 Ga0207674_10032484
665 Ga0207674_10049178
666 Ga0207674_10058558
667 Ga0207674_10387340
668 Ga0207675_100111423
669 Ga0207683_10015792
670 Ga0207698_10005394
671 Ga0207698_10014920
672 Ga0207698_10094205
673 Ga0268266_10515395
674 Ga0268264_10401286
675 Ga0268264_10816037
676 Ga0307515_10001320
677 Ga0307515_10021749
678 Ga0265338_10000113
679 Ga0265324_10026466
680 Ga0265332_10000004
681 Ga0265332_10000006
682 Ga0265332_10017342
683 Ga0265328_10035886
684 Ga0265328_10057245
685 Ga0265320_10043733
686 Ga0265325_10153123
687 Ga0265329_10022323
688 Ga0265331_10053698
689 Ga0265327_10060132
690 Ga0265316_10220401
691 Ga0265316_10613112
692 Ga0307408_100403511
693 Ga0265313_10197283
694 Ga0265314_10000960
695 Ga0265314_10014690
696 Ga0265314_10025776
697 Ga0265314_10125412
698 Ga0265342_10067859
699 Ga0307516_10000973
700 Ga0307412_10032019
701 Ga0307412_10259273
702 Ga0307416_100329196
703 Ga0307414_10173489
704 Ga0307411_11246506
705 Ga0373938_0012359
706 Ga0373928_0032500
707 Ga0373940_0158973
708 Ga0395899_0003555
709 Ga0395899_0044364
710 Ga0395900_0005229
711 Ga0395900_0040082
712 Ga0395900_0090018
713 Ga0395900_0175952
714 Ga0395900_0658762
715 Ga0395898_0029810
716 Ga0395898_0058007
717 Ga0395898_0058632
718 Ga0395898_0072472
719 Ga0395905_0000047
720 Ga0395905_0001133
721 Ga0395905_0008913
722 Ga0395905_0015524
723 Ga0395905_0029583
724 Ga0395905_0039142
725 Ga0395905_0114328
726 Ga0395905_0145539
727 Ga0395905_0204600
728 Ga0395905_0238791
729 Ga0395905_0260120
730 Ga0395905_0288917
731 Ga0395905_0500067
732 Ga0395901_0009451
733 Ga0395901_0010842
734 Ga0395901_0011724
735 Ga0395901_0021623
736 Ga0395901_0112741
737 Ga0395901_0163178
738 Ga0395901_0219268
739 Ga0436360_0276311
740 Ga0439439_0043404
741 Ga0439433_0034959
742 Ga0439433_0039105
743 Ga0439449_0000317
744 Ga0439457_023412
745 Ga0439462_0036882
746 Ga0450923_014715
747 Ga0439446_0007493
748 Ga0439458_0029747
749 Ga0439434_0162507
750 Ga0439464_0009508
751 Ga0451577_0000126
752 Ga0451577_0001338
753 Ga0451577_0017496
754 Ga0451577_0048719
755 Ga0451577_0067682
756 Ga0451577_0958089
757 Ga0466969_0008374
758 Ga0453683_0001138
759 Ga0453683_0026745
760 Ga0466965_0086805
761 Ga0466966_0003980
762 Ga0466966_0021246
763 Ga0466961_0002664
764 Ga0466961_0031263
765 Ga0466961_0156318
766 Ga0466964_0012225
767 Ga0453684_0000365
768 Ga0453684_0031332
769 Ga0453684_0342383
770 Ga0453684_0926497
771 Ga0466971_0103715
772 Ga0466971_0129720
773 Ga0466970_0459516
774 Ga0466957_0026889
775 Ga0466960_0017714
776 Ga0466959_0000517
777 Ga0466959_0025103
778 Ga0466959_0296523
779 Ga0451576_0000627
780 Ga0451576_0006791
781 Ga0451576_0056022
782 Ga0451576_0233699
783 Ga0451576_0621434
784 Ga0466958_0094282
785 Ga0495627_000007
786 Ga0495650_0009002
787 Ga0495605_0001617
788 Ga0495605_0001777
789 Ga0495605_0216044
790 Ga0495584_0001462
791 Ga0495584_0024722
792 Ga0495585_0020862
793 Ga0495596_0001420
794 Ga0495607_0007314
795 Ga0495583_0000060
796 Ga0495606_0212391
797 Ga0495616_0006711
798 Ga0495631_0003039
799 Ga0495632_0000750
800 Ga0495637_0061942
801 Ga0495644_0003522
802 Ga0495644_0017777
803 Ga0495642_0017515
804 Ga0495642_0110354
805 Ga0495609_0000055
806 Ga0495609_0013520
807 Ga0495633_0015841
808 Ga0495656_0196314
809 Ga0495668_0009474
810 Ga0495611_0003537
811 Ga0495625_0401830
812 Ga0495661_0027704
813 Ga0495588_0151227
814 Ga0495669_0015279
815 Ga0495669_0135359
816 Ga0495649_0029676
817 Ga0495589_0010929
818 Ga0495660_0000091
819 Ga0495660_0002081
820 Ga0495660_0014872
821 Ga0495636_0131165
822 Ga0495672_0003337
823 Ga0495683_0003166
824 Ga0495677_0000375
825 Ga0495679_011019
826 Ga0495685_005674
827 Ga0495673_0000113
828 Ga0495681_0001779
829 Ga0495681_0004114
830 Ga0495626_0000364
831 Ga0496102_0375683
832 Ga0496110_0077412
833 Ga0496113_0209222
834 Ga0496115_0259384
835 Ga0496116_0022976
836 Ga0496124_0027485
837 Ga0496124_0146518
838 Ga0495678_002149
839 Ga0501031_0142607
840 Ga0501034_0051718
841 Ga0501036_0145630
842 Ga0501038_0165245
843 Ga0501039_0617164
844 Ga0501043_0268102
845 Ga0501046_0040347
846 Ga0501047_0228903
847 Ga0501067_0135417
848 Ga0501073_0177134
849 Ga0501198_000033
850 Ga0501222_000016
851 Ga0501035_0044988
852 Ga0501035_0054941
853 Ga0501035_0348121
854 Ga0501044_0146830
855 Ga0501044_0215010
856 nmdc:mga03683_36001_c1
857 nmdc:mga03683_65322_c1
858 nmdc:mga0yw44_165072_c1
859 nmdc:mga0k408_393440_c1
860 nmdc:mga0k408_52525_c1
861 nmdc:mga06z11_191113_c1
862 nmdc:mga05p37_474102_c1
863 nmdc:mga09592_46740_c1
864 nmdc:mga0qj67_715928_c1
865 nmdc:mga06r32_1016990_c1
866 nmdc:mga08y16_346151_c1
867 nmdc:mga0n895_599947_c1
868 nmdc:mga0rr50_656528_c1
869 Ga0500562_069250
870 Ga0500594_0142383
871 Ga0500561_0059569
872 Ga0500622_0035554
873 Ga0466962_0305151
874 2501070944
875 2501078908
876 2501413775
877 2511089546
878 2511094956
879 2511104615
880 2511383335
881 2516016930
882 2526213296
883 2548847744
884 2883094688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

146

214

0.96

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

29

107

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

34

99

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

25

98

0.9

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

122

219

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.9808 2 202
4mk3-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h) 0.9792 1 203
4mk3-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h) 0.9697 1 203
3tou-assembly1.cif.gz_B crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound 0.9664 2 202
4glt-assembly2.cif.gz_C crystal structure of glutathione s-transferase mfla_2116 (target efi-507160) from methylobacillus flagellatus kt with gsh bound 0.9592 2 203
ID Description Score Start End Superfamily
3touB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9823 2 76 3.40.30.10
3totA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9797 79 194 1.20.1050.10
3touA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9779 2 76 3.40.30.10
4gltD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9671 79 194 1.20.1050.10
af_P0ACA1_1_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9652 1 72 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7S9CBS3-F1-model_v4 Glutathione S-transferase 0.9922 1 205 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A4Q3J6T0-F1-model_v4 Glutathione S-transferase 0.9887 1 80 GO:0005737
GO:0016740
AF-A0A7S9CBS3-F1-model_v4 Glutathione S-transferase 0.9874 1 205 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A6N3S2I5-F1-model_v4 deleted 0.9854 2 205
AF-S6B1S8-F1-model_v4 Glutathione S-transferase-like protein 0.9837 1 205 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Map