F444890

General Info

Members Datasets Scaffolds Average Seq Length
442 187 884 320

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10371419|Ga0207644_103714191
Length 311
Sequence MSTNFRDNIKASEITDYKVYLNRRNFMRGAALAASATATSFLYRKLNPPPAELPKGQKIETVTAKPADDLAKSGFTANENRTSLEDITNYNNFYEFSTDKREVAAESKGFVTRPWAVDVKFPQEERVYRFRCVEGWSMVIPWIGFPLSKLLEKVEPMSQARYVSFQTLHDPKRLPNQRTTVLSWPYVEGLRLDEAMHPLAILATGLYGQVLPPQDGAPIRLVVPWKYGFKSIKSIVKISLVAEQPPTTWNNEGPSEYGFYSNVNPHVNHPRWSQATEHRVGEFTGRPTLMFNGYAEQVAHLYEGMDLRVNF

Samples

Sample ID Description Type Environment
1 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
154 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
155 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
167 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
168 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
169 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
170 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
171 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
172 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
173 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
177 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
178 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
181 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.58
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207644_10371419 3300025931 Bacteria 1165
2 CNAas_1000718 3300000532 Bacteria 3185
3 JGI24751J29686_10000003 3300002459 Bacteria 157815
4 Ga0065704_10127375 3300005289 Bacteria 1676
5 Ga0065712_10024857 3300005290 Bacteria 1392
6 Ga0065712_10067727 3300005290 Bacteria 189643
7 Ga0065712_10074045 3300005290 Bacteria 4197
8 Ga0065715_10089973 3300005293 Bacteria 7985
9 Ga0065715_10100587 3300005293 Bacteria 3288
10 Ga0065715_10109114 3300005293 Bacteria 2683
11 Ga0065715_10147959 3300005293 Bacteria 1753
12 Ga0065707_10002620 3300005295 Bacteria 6972
13 Ga0070676_10004164 3300005328 Bacteria 7596
14 Ga0070690_100007776 3300005330 Bacteria 6144
15 Ga0070690_100015236 3300005330 Bacteria 4582
16 Ga0070670_100004801 3300005331 Bacteria 11348
17 Ga0070670_100103249 3300005331 Bacteria 2455
18 Ga0070670_100122043 3300005331 Bacteria 2247
19 Ga0068869_100010281 3300005334 Bacteria 6099
20 Ga0068869_100029570 3300005334 Bacteria 3839
21 Ga0068869_100293083 3300005334 Bacteria 1311
22 Ga0070680_100002231 3300005336 Bacteria 14296
23 Ga0070680_100005222 3300005336 Bacteria 9826
24 Ga0070682_100001561 3300005337 Bacteria 12801
25 Ga0068868_100072600 3300005338 Bacteria 2746
26 Ga0068868_100119928 3300005338 Bacteria 2145
27 Ga0068868_100368968 3300005338 Bacteria 1233
28 Ga0070689_100002015 3300005340 Bacteria 13172
29 Ga0070687_100001313 3300005343 Bacteria 8685
30 Ga0070687_100020857 3300005343 Bacteria 3071
31 Ga0070687_100107631 3300005343 Bacteria 1572
32 Ga0070692_10002257 3300005345 Bacteria 7395
33 Ga0070668_100014541 3300005347 Bacteria 5881
34 Ga0070669_100053980 3300005353 Bacteria 2942
35 Ga0070669_100184096 3300005353 Bacteria 1635
36 Ga0070675_100095881 3300005354 Bacteria 2491
37 Ga0070675_100289449 3300005354 Bacteria 1441
38 Ga0070671_100012458 3300005355 Bacteria 6847
39 Ga0070674_100081820 3300005356 Bacteria 2308
40 Ga0070673_100011074 3300005364 Bacteria 6146
41 Ga0070673_100021433 3300005364 Bacteria 4685
42 Ga0070673_100043068 3300005364 Bacteria 3485
43 Ga0070667_100178969 3300005367 Bacteria 1875
44 Ga0070703_10006465 3300005406 Bacteria 3286
45 Ga0070701_10007864 3300005438 Bacteria 4582
46 Ga0070705_100002698 3300005440 Bacteria 8869
47 Ga0070705_100369646 3300005440 Bacteria 1052
48 Ga0070700_100020574 3300005441 Bacteria 3824
49 Ga0070700_100031739 3300005441 Bacteria 3168
50 Ga0070700_100126290 3300005441 Bacteria 1720
51 Ga0070694_100008831 3300005444 Bacteria 6173
52 Ga0070694_100025592 3300005444 Bacteria 3819
53 Ga0070694_100046549 3300005444 Bacteria 2912
54 Ga0070694_100179131 3300005444 Bacteria 1566
55 Ga0070694_100243418 3300005444 Bacteria 1357
56 Ga0070708_100000042 3300005445 Bacteria 83511
57 Ga0070708_100074229 3300005445 Bacteria 3067
58 Ga0070662_100076546 3300005457 Bacteria 2481
59 Ga0070662_100116493 3300005457 Bacteria 2042
60 Ga0070662_100423919 3300005457 Bacteria 1101
61 Ga0070681_10000053 3300005458 Bacteria 81387
62 Ga0070681_10002770 3300005458 Bacteria 16179
63 Ga0070681_10009693 3300005458 Bacteria 9476
64 Ga0068867_100047556 3300005459 Bacteria 3154
65 Ga0068867_100055456 3300005459 Bacteria 2931
66 Ga0068867_100079263 3300005459 Bacteria 2472
67 Ga0068867_100231609 3300005459 Bacteria 1493
68 Ga0068867_100394077 3300005459 Bacteria 1166
69 Ga0070706_100000053 3300005467 Bacteria 139565
70 Ga0070706_100007447 3300005467 Bacteria 10263
71 Ga0070706_100094843 3300005467 Bacteria 2769
72 Ga0070707_100004457 3300005468 Bacteria 13110
73 Ga0070707_100077168 3300005468 Bacteria 3214
74 Ga0070698_100013777 3300005471 Bacteria 8557
75 Ga0070698_100015717 3300005471 Bacteria 7994
76 Ga0070698_100094228 3300005471 Bacteria 2973
77 Ga0070699_100002993 3300005518 Bacteria 15009
78 Ga0070699_100181954 3300005518 Bacteria 1865
79 Ga0070699_100430829 3300005518 Bacteria 1195
80 Ga0070679_100000030 3300005530 Bacteria 108148
81 Ga0070679_100115002 3300005530 Bacteria 2676
82 Ga0070697_100024600 3300005536 Bacteria 4796
83 Ga0070697_100040703 3300005536 Bacteria 3761
84 Ga0070697_100335603 3300005536 Bacteria 1304
85 Ga0068853_100056351 3300005539 Bacteria 3389
86 Ga0068853_100103146 3300005539 Bacteria 2524
87 Ga0070686_100009528 3300005544 Bacteria 5461
88 Ga0070686_100046339 3300005544 Bacteria 2743
89 Ga0070686_100086740 3300005544 Bacteria 2085
90 Ga0070695_100022647 3300005545 Bacteria 3855
91 Ga0070695_100226864 3300005545 Bacteria 1348
92 Ga0070696_100258905 3300005546 Bacteria 1319
93 Ga0070693_100006565 3300005547 Bacteria 5644
94 Ga0070693_100029574 3300005547 Bacteria 2989
95 Ga0070693_100166195 3300005547 Bacteria 1409
96 Ga0070693_100229488 3300005547 Bacteria 1220
97 Ga0070704_100073051 3300005549 Bacteria 2497
98 Ga0070704_100116639 3300005549 Bacteria 2042
99 Ga0070704_100137841 3300005549 Bacteria 1901
100 Ga0070704_100202377 3300005549 Bacteria 1603
101 Ga0070664_100058456 3300005564 Bacteria 3279
102 Ga0070664_100113767 3300005564 Bacteria 2364
103 Ga0068857_100000975 3300005577 Bacteria 21916
104 Ga0068857_100049672 3300005577 Bacteria 3722
105 Ga0068857_100225351 3300005577 Bacteria 1713
106 Ga0068854_100077995 3300005578 Bacteria 2439
107 Ga0068854_100128475 3300005578 Bacteria 1933
108 Ga0068856_100039517 3300005614 Bacteria 4632
109 Ga0070702_100134849 3300005615 Bacteria 1565
110 Ga0070702_100160364 3300005615 Bacteria 1453
111 Ga0068852_100297243 3300005616 Bacteria 1562
112 Ga0068852_100417209 3300005616 Bacteria 1323
113 Ga0068859_100024100 3300005617 Bacteria 6107
114 Ga0068859_100061620 3300005617 Bacteria 3780
115 Ga0068859_100065554 3300005617 Bacteria 3665
116 Ga0068859_100098220 3300005617 Bacteria 2982
117 Ga0068859_100137780 3300005617 Bacteria 2514
118 Ga0068859_100145291 3300005617 Bacteria 2446
119 Ga0068859_100160785 3300005617 Bacteria 2325
120 Ga0068859_100438428 3300005617 Bacteria 1402
121 Ga0068859_100635840 3300005617 Bacteria 1159
122 Ga0068864_100002204 3300005618 Bacteria 16082
123 Ga0068864_100007365 3300005618 Bacteria 9056
124 Ga0068864_100037267 3300005618 Bacteria 4149
125 Ga0068864_100075234 3300005618 Bacteria 2948
126 Ga0068864_100076997 3300005618 Bacteria 2916
127 Ga0068864_100189503 3300005618 Bacteria 1885
128 Ga0068864_100225762 3300005618 Bacteria 1730
129 Ga0068866_10128626 3300005718 Bacteria 1437
130 Ga0068861_100002914 3300005719 Bacteria 11283
131 Ga0068861_100017292 3300005719 Bacteria 5116
132 Ga0068851_10000327 3300005834 Bacteria 21602
133 Ga0068851_10049134 3300005834 Bacteria 2139
134 Ga0068870_10011736 3300005840 Bacteria 4073
135 Ga0068870_10048140 3300005840 Bacteria 2244
136 Ga0068870_10157877 3300005840 Bacteria 1342
137 Ga0068863_100043173 3300005841 Bacteria 4281
138 Ga0068863_100185355 3300005841 Bacteria 1999
139 Ga0068863_100203583 3300005841 Bacteria 1904
140 Ga0068858_100031399 3300005842 Bacteria 4934
141 Ga0068858_100033552 3300005842 Bacteria 4761
142 Ga0068858_100115480 3300005842 Bacteria 2508
143 Ga0068858_100143334 3300005842 Bacteria 2244
144 Ga0068860_100058895 3300005843 Bacteria 3652
145 Ga0068860_100099662 3300005843 Bacteria 2771
146 Ga0068860_100107518 3300005843 Bacteria 2666
147 Ga0068860_100143329 3300005843 Bacteria 2297
148 Ga0068860_100163612 3300005843 Bacteria 2146
149 Ga0068860_100272345 3300005843 Bacteria 1653
150 Ga0068862_100009473 3300005844 Bacteria 8057
151 Ga0068862_100284732 3300005844 Bacteria 1516
152 Ga0081539_10003540 3300005985 Bacteria 18990
153 Ga0068871_100005838 3300006358 Bacteria 8653
154 Ga0068871_100220547 3300006358 Bacteria 1643
155 Ga0075428_100057923 3300006844 Bacteria 4242
156 Ga0075430_100023282 3300006846 Bacteria 5270
157 Ga0075431_100160052 3300006847 Bacteria 2315
158 Ga0075433_10014700 3300006852 Bacteria 6404
159 Ga0075433_10074716 3300006852 Bacteria 2983
160 Ga0075433_10172603 3300006852 Bacteria 1924
161 Ga0075434_100009959 3300006871 Bacteria 8895
162 Ga0075434_100023361 3300006871 Bacteria 6024
163 Ga0075434_100098441 3300006871 Bacteria 2930
164 Ga0075434_100117510 3300006871 Bacteria 2672
165 Ga0075434_100199465 3300006871 Bacteria 2021
166 Ga0075434_100360132 3300006871 Bacteria 1476
167 Ga0075429_100134547 3300006880 Bacteria 2163
168 Ga0075429_100257413 3300006880 Bacteria 1528
169 Ga0097620_100024098 3300006931 Bacteria 6107
170 Ga0097620_100061629 3300006931 Bacteria 3780
171 Ga0097620_100065553 3300006931 Bacteria 3665
172 Ga0097620_100098218 3300006931 Bacteria 2982
173 Ga0097620_100137777 3300006931 Bacteria 2514
174 Ga0097620_100145289 3300006931 Bacteria 2446
175 Ga0097620_100160786 3300006931 Bacteria 2325
176 Ga0097620_100438436 3300006931 Bacteria 1402
177 Ga0097620_100635853 3300006931 Bacteria 1159
178 Ga0075435_100088146 3300007076 Bacteria 2558
179 Ga0075435_100191112 3300007076 Bacteria 1733
180 Ga0111539_10002073 3300009094 Bacteria 26784
181 Ga0111539_10398612 3300009094 Bacteria 1603
182 Ga0111539_10536291 3300009094 Bacteria 1363
183 Ga0111539_10652114 3300009094 Bacteria 1226
184 Ga0111539_10772938 3300009094 Bacteria 1118
185 Ga0105245_10311552 3300009098 Bacteria 1548
186 Ga0105245_10426059 3300009098 Bacteria 1331
187 Ga0105247_10003670 3300009101 Bacteria 9971
188 Ga0114129_10016212 3300009147 Bacteria 10604
189 Ga0114129_10203030 3300009147 Bacteria 2683
190 Ga0114129_10397016 3300009147 Bacteria 1818
191 Ga0114129_10518442 3300009147 Bacteria 1554
192 Ga0105243_10000558 3300009148 Bacteria 37622
193 Ga0105243_10009837 3300009148 Bacteria 7277
194 Ga0105243_10023111 3300009148 Bacteria 4729
195 Ga0105243_10028277 3300009148 Bacteria 4303
196 Ga0105241_10026618 3300009174 Bacteria 4304
197 Ga0105241_10039123 3300009174 Bacteria 3577
198 Ga0105241_10039127 3300009174 Bacteria 3577
199 Ga0105241_10129154 3300009174 Bacteria 2044
200 Ga0105241_10210737 3300009174 Bacteria 1628
201 Ga0105242_10000362 3300009176 Bacteria 36296
202 Ga0105242_10000884 3300009176 Bacteria 23248
203 Ga0105242_10001631 3300009176 Bacteria 17700
204 Ga0105242_10063526 3300009176 Bacteria 3040
205 Ga0105242_10113842 3300009176 Bacteria 2310
206 Ga0105242_10134885 3300009176 Bacteria 2135
207 Ga0105248_10002530 3300009177 Bacteria 20349
208 Ga0105248_10012103 3300009177 Bacteria 9517
209 Ga0105248_10034888 3300009177 Bacteria 5629
210 Ga0105248_10159041 3300009177 Bacteria 2549
211 Ga0105248_10372157 3300009177 Bacteria 1608
212 Ga0105248_10552562 3300009177 Bacteria 1299
213 Ga0105237_10000521 3300009545 Bacteria 54240
214 Ga0105238_10509653 3300009551 Bacteria 1205
215 Ga0105249_10000201 3300009553 Bacteria 68199
216 Ga0105249_10015662 3300009553 Bacteria 6714
217 Ga0105249_10042396 3300009553 Bacteria 4138
218 Ga0105239_10059400 3300010375 Bacteria 4197
219 Ga0105239_10121421 3300010375 Bacteria 2902
220 Ga0105246_10093964 3300011119 Bacteria 2168
221 Ga0105246_10133985 3300011119 Bacteria 1854
222 Ga0157373_10034467 3300013100 Bacteria 3635
223 Ga0157373_10039800 3300013100 Bacteria 3365
224 Ga0157373_10053595 3300013100 Bacteria 2868
225 Ga0157373_10184322 3300013100 Bacteria 1470
226 Ga0157374_10067184 3300013296 Bacteria 3370
227 Ga0157378_10000077 3300013297 Bacteria 89664
228 Ga0157378_10000105 3300013297 Bacteria 79945
229 Ga0157378_10015791 3300013297 Bacteria 6613
230 Ga0157378_10017244 3300013297 Bacteria 6333
231 Ga0157378_10039490 3300013297 Bacteria 4186
232 Ga0163162_10000128 3300013306 Bacteria 68199
233 Ga0163162_10028030 3300013306 Bacteria 5571
234 Ga0163162_10058152 3300013306 Bacteria 3895
235 Ga0163162_10068000 3300013306 Bacteria 3613
236 Ga0163162_10068219 3300013306 Bacteria 3607
237 Ga0163162_10113500 3300013306 Bacteria 2808
238 Ga0163162_10153347 3300013306 Bacteria 2422
239 Ga0163162_10229761 3300013306 Bacteria 1985
240 Ga0157372_10006169 3300013307 Bacteria 12745
241 Ga0157372_10015828 3300013307 Bacteria 8092
242 Ga0157375_10001282 3300013308 Bacteria 21701
243 Ga0157375_10002929 3300013308 Bacteria 14806
244 Ga0157375_10004099 3300013308 Bacteria 12637
245 Ga0157375_10093649 3300013308 Bacteria 3071
246 Ga0157375_10197797 3300013308 Bacteria 2165
247 Ga0157375_10361378 3300013308 Bacteria 1618
248 Ga0157375_10462100 3300013308 Bacteria 1435
249 Ga0163163_10003319 3300014325 Bacteria 13647
250 Ga0163163_10008237 3300014325 Bacteria 9251
251 Ga0163163_10035570 3300014325 Bacteria 4832
252 Ga0163163_10039739 3300014325 Bacteria 4593
253 Ga0163163_10208296 3300014325 Bacteria 2004
254 Ga0157380_10010880 3300014326 Bacteria 6560
255 Ga0157380_10048029 3300014326 Bacteria 3360
256 Ga0157380_10122252 3300014326 Bacteria 2207
257 Ga0157380_10281931 3300014326 Bacteria 1521
258 Ga0157379_10104190 3300014968 Bacteria 2546
259 Ga0157379_10134498 3300014968 Bacteria 2227
260 Ga0157376_10101089 3300014969 Bacteria 2519
261 Ga0207666_1013211 3300025271 Bacteria 1158
262 Ga0207697_10115428 3300025315 Bacteria 1152
263 Ga0207656_10035419 3300025321 Bacteria 2090
264 Ga0207653_10011107 3300025885 Bacteria 2812
265 Ga0207642_10029062 3300025899 Bacteria 2285
266 Ga0207710_10000808 3300025900 Bacteria 16971
267 Ga0207680_10095788 3300025903 Bacteria 1897
268 Ga0207645_10016954 3300025907 Bacteria 4812
269 Ga0207645_10052375 3300025907 Bacteria 2608
270 Ga0207643_10001384 3300025908 Bacteria 13921
271 Ga0207643_10089756 3300025908 Bacteria 1790
272 Ga0207643_10162957 3300025908 Bacteria 1342
273 Ga0207643_10212229 3300025908 Bacteria 1182
274 Ga0207684_10000053 3300025910 Bacteria 225260
275 Ga0207684_10014908 3300025910 Bacteria 6688
276 Ga0207684_10185262 3300025910 Bacteria 1795
277 Ga0207684_10312357 3300025910 Bacteria 1355
278 Ga0207654_10035946 3300025911 Bacteria 2764
279 Ga0207654_10098029 3300025911 Bacteria 1800
280 Ga0207707_10000063 3300025912 Bacteria 108163
281 Ga0207707_10009335 3300025912 Bacteria 8506
282 Ga0207707_10030120 3300025912 Bacteria 4745
283 Ga0207707_10125708 3300025912 Bacteria 2242
284 Ga0207660_10002003 3300025917 Bacteria 13554
285 Ga0207660_10089674 3300025917 Bacteria 2276
286 Ga0207662_10021438 3300025918 Bacteria 3693
287 Ga0207662_10032140 3300025918 Bacteria 3053
288 Ga0207662_10047011 3300025918 Bacteria 2555
289 Ga0207662_10057468 3300025918 Bacteria 2325
290 Ga0207662_10084516 3300025918 Bacteria 1942
291 Ga0207649_10041439 3300025920 Bacteria 2803
292 Ga0207652_10000091 3300025921 Bacteria 98787
293 Ga0207646_10001854 3300025922 Bacteria 25492
294 Ga0207681_10051321 3300025923 Bacteria 2794
295 Ga0207650_10000007 3300025925 Bacteria 530810
296 Ga0207650_10026485 3300025925 Bacteria 4137
297 Ga0207690_10083879 3300025932 Bacteria 2232
298 Ga0207690_10150638 3300025932 Bacteria 1724
299 Ga0207706_10105433 3300025933 Bacteria 2481
300 Ga0207706_10146161 3300025933 Bacteria 2079
301 Ga0207706_10176571 3300025933 Bacteria 1876
302 Ga0207706_10459829 3300025933 Bacteria 1100
303 Ga0207686_10001072 3300025934 Bacteria 16056
304 Ga0207686_10002748 3300025934 Bacteria 9540
305 Ga0207686_10036582 3300025934 Bacteria 2956
306 Ga0207686_10051227 3300025934 Bacteria 2571
307 Ga0207686_10128634 3300025934 Bacteria 1734
308 Ga0207686_10377014 3300025934 Bacteria 1075
309 Ga0207709_10000325 3300025935 Bacteria 51529
310 Ga0207709_10012421 3300025935 Bacteria 4692
311 Ga0207670_10000756 3300025936 Bacteria 16999
312 Ga0207670_10131868 3300025936 Bacteria 1832
313 Ga0207704_10208106 3300025938 Bacteria 1437
314 Ga0207691_10058127 3300025940 Bacteria 3518
315 Ga0207711_10016784 3300025941 Bacteria 6080
316 Ga0207711_10224625 3300025941 Bacteria 1718
317 Ga0207711_10326552 3300025941 Bacteria 1418
318 Ga0207711_10357068 3300025941 Bacteria 1353
319 Ga0207689_10004147 3300025942 Bacteria 13173
320 Ga0207689_10055663 3300025942 Bacteria 3255
321 Ga0207689_10089756 3300025942 Bacteria 2525
322 Ga0207689_10148872 3300025942 Bacteria 1929
323 Ga0207689_10210093 3300025942 Bacteria 1608
324 Ga0207679_10024999 3300025945 Bacteria 4102
325 Ga0207679_10268446 3300025945 Bacteria 1458
326 Ga0207651_10013212 3300025960 Bacteria 4713
327 Ga0207712_10000259 3300025961 Bacteria 51318
328 Ga0207712_10017953 3300025961 Bacteria 4604
329 Ga0207712_10040235 3300025961 Bacteria 3207
330 Ga0207712_10207489 3300025961 Bacteria 1558
331 Ga0207668_10002115 3300025972 Bacteria 11592
332 Ga0207640_10077243 3300025981 Bacteria 2263
333 Ga0207640_10086092 3300025981 Bacteria 2163
334 Ga0207640_10098221 3300025981 Bacteria 2047
335 Ga0207658_10298057 3300025986 Bacteria 1388
336 Ga0207703_10076826 3300026035 Bacteria 2771
337 Ga0207703_10392223 3300026035 Bacteria 1286
338 Ga0207703_10426253 3300026035 Bacteria 1235
339 Ga0207639_10373544 3300026041 Bacteria 1279
340 Ga0207708_10000471 3300026075 Bacteria 31120
341 Ga0207708_10001411 3300026075 Bacteria 18027
342 Ga0207708_10185518 3300026075 Bacteria 1653
343 Ga0207708_10288299 3300026075 Bacteria 1332
344 Ga0207641_10077343 3300026088 Bacteria 2879
345 Ga0207641_10252306 3300026088 Bacteria 1648
346 Ga0207648_10039893 3300026089 Bacteria 4127
347 Ga0207648_10061316 3300026089 Bacteria 3279
348 Ga0207648_10206962 3300026089 Bacteria 1741
349 Ga0207676_10011121 3300026095 Bacteria 6424
350 Ga0207676_10045462 3300026095 Bacteria 3393
351 Ga0207676_10085219 3300026095 Bacteria 2578
352 Ga0207676_10158950 3300026095 Bacteria 1955
353 Ga0207676_10168520 3300026095 Bacteria 1905
354 Ga0207676_10606445 3300026095 Bacteria 1052
355 Ga0207674_10000058 3300026116 Bacteria 113012
356 Ga0207674_10118752 3300026116 Bacteria 2614
357 Ga0207674_10163075 3300026116 Bacteria 2183
358 Ga0207675_100002898 3300026118 Bacteria 16870
359 Ga0207675_100006256 3300026118 Bacteria 11299
360 Ga0207675_100037151 3300026118 Bacteria 4543
361 Ga0207675_100224763 3300026118 Bacteria 1809
362 Ga0207698_10052073 3300026142 Bacteria 3134
363 Ga0207698_10356674 3300026142 Bacteria 1383
364 Ga0207428_10163690 3300027907 Bacteria 1688
365 Ga0268265_10095710 3300028380 Bacteria 2385
366 Ga0268265_10183833 3300028380 Bacteria 1798
367 Ga0268264_10040527 3300028381 Bacteria 3848
368 Ga0268264_10129642 3300028381 Bacteria 2234
369 Ga0268264_10634246 3300028381 Bacteria 1056
370 Ga0316182_1301365 3300030745 Bacteria 1391
371 Ga0307513_10112798 3300031456 Bacteria 2708
372 Ga0307408_100002360 3300031548 Bacteria 13325
373 Ga0307405_10027425 3300031731 Bacteria 3302
374 Ga0307405_10092698 3300031731 Bacteria 2005
375 Ga0307413_10119998 3300031824 Bacteria 1779
376 Ga0307406_10001697 3300031901 Bacteria 12099
377 Ga0307412_10018160 3300031911 Bacteria 4225
378 Ga0307416_100005462 3300032002 Bacteria 7808
379 Ga0307414_10003043 3300032004 Bacteria 8895
380 Ga0307414_10043681 3300032004 Bacteria 3055
381 Ga0307415_100004223 3300032126 Bacteria 7422
382 Ga0373951_0010028 3300035091 Bacteria 2125
383 Ga0373962_0050227 3300035242 Bacteria 1201
384 Ga0400484_12150 3300038725 Bacteria 13880
385 Ga0400490_15480 3300038726 Bacteria 5701
386 Ga0439448_0036300 3300042005 Bacteria 1581
387 Ga0439462_0047780 3300042015 Bacteria 1147
388 Ga0439458_0004493 3300042157 Bacteria 3200
389 Ga0451576_0417991 3300045051 Bacteria 1407
390 Ga0495582_0127237 3300046473 Bacteria 1438
391 Ga0496102_0064033 3300048905 Bacteria 3367
392 Ga0496104_0509459 3300048907 Bacteria 1115
393 Ga0496106_0000981 3300048909 Bacteria 20812
394 Ga0496106_0004027 3300048909 Bacteria 10987
395 Ga0496106_0127571 3300048909 Bacteria 1993
396 Ga0496107_0034812 3300048910 Bacteria 3609
397 Ga0496108_0086939 3300048911 Bacteria 2655
398 Ga0501321_004658 3300049537 Bacteria 1321
399 Ga0501202_015707 3300049652 Bacteria 1461
400 Ga0501202_016091 3300049652 Bacteria 1447
401 Ga0501207_000538 3300049654 Bacteria 4310
402 Ga0501207_007086 3300049654 Bacteria 1591
403 Ga0501216_000138 3300049660 Bacteria 7447
404 Ga0501216_009401 3300049660 Bacteria 1557
405 Ga0501216_010134 3300049660 Bacteria 1511
406 Ga0501224_000213 3300049664 Bacteria 6594
407 Ga0501227_000375 3300049665 Bacteria 9414
408 Ga0501230_001092 3300049667 Bacteria 3122
409 Ga0501230_001387 3300049667 Bacteria 2874
410 Ga0501233_001868 3300049668 Bacteria 3656
411 Ga0501250_006495 3300049680 Bacteria 1238
412 Ga0501257_009035 3300049686 Bacteria 2246
413 Ga0501221_013330 3300049704 Bacteria 1511
414 Ga0501225_0002973 3300049705 Bacteria 5187
415 Ga0501225_0009108 3300049705 Bacteria 2836
416 Ga0501225_0015072 3300049705 Bacteria 2156
417 Ga0501229_007988 3300049706 Bacteria 1319
418 Ga0501234_002058 3300049707 Bacteria 3175
419 Ga0501234_003224 3300049707 Bacteria 2565
420 Ga0501081_0267251 3300049743 Bacteria 1251
421 Ga0501283_010322 3300049779 Bacteria 1372
422 Ga0501226_003800 3300049853 Bacteria 1772
423 nmdc:mga05p37_165564_c1 3300050507 Bacteria 2698
424 nmdc:mga05p37_30747_c1 3300050507 Bacteria 6553
425 nmdc:mga05p37_5317_c1 3300050507 Bacteria 15117
426 nmdc:mga09592_192371_c1 3300050508 Bacteria 1766
427 nmdc:mga09592_332163_c1 3300050508 Bacteria 1316
428 nmdc:mga06r32_95225_c1 3300050510 Bacteria 2914
429 nmdc:mga08y16_191081_c1 3300050511 Bacteria 2124
430 nmdc:mga08y16_261720_c1 3300050511 Bacteria 1786
431 nmdc:mga0n895_132579_c1 3300050512 Bacteria 2517
432 nmdc:mga0n895_283000_c1 3300050512 Bacteria 1681
433 nmdc:mga0n895_346735_c1 3300050512 Bacteria 1504
434 nmdc:mga0n895_45195_c1 3300050512 Bacteria 4297
435 nmdc:mga0n895_9938_c1 3300050512 Bacteria 8370
436 nmdc:mga0a205_148193_c1 3300050515 Bacteria 2247
437 nmdc:mga0a205_32076_c1 3300050515 Bacteria 5036
438 nmdc:mga0a205_350163_c1 3300050515 Bacteria 1345
439 nmdc:mga0a205_45671_c1 3300050515 Bacteria 4224
440 nmdc:mga0a205_49482_c1 3300050515 Bacteria 4057
441 nmdc:mga0a205_58864_c1 3300050515 Bacteria 3711
442 nmdc:mga0a205_74931_c1 3300050515 Bacteria 3270
443 Ga0207644_10371419
444 CNAas_1000718
445 JGI24751J29686_10000003
446 Ga0065704_10127375
447 Ga0065712_10024857
448 Ga0065712_10067727
449 Ga0065712_10074045
450 Ga0065715_10089973
451 Ga0065715_10100587
452 Ga0065715_10109114
453 Ga0065715_10147959
454 Ga0065707_10002620
455 Ga0070676_10004164
456 Ga0070690_100007776
457 Ga0070690_100015236
458 Ga0070670_100004801
459 Ga0070670_100103249
460 Ga0070670_100122043
461 Ga0068869_100010281
462 Ga0068869_100029570
463 Ga0068869_100293083
464 Ga0070680_100002231
465 Ga0070680_100005222
466 Ga0070682_100001561
467 Ga0068868_100072600
468 Ga0068868_100119928
469 Ga0068868_100368968
470 Ga0070689_100002015
471 Ga0070687_100001313
472 Ga0070687_100020857
473 Ga0070687_100107631
474 Ga0070692_10002257
475 Ga0070668_100014541
476 Ga0070669_100053980
477 Ga0070669_100184096
478 Ga0070675_100095881
479 Ga0070675_100289449
480 Ga0070671_100012458
481 Ga0070674_100081820
482 Ga0070673_100011074
483 Ga0070673_100021433
484 Ga0070673_100043068
485 Ga0070667_100178969
486 Ga0070703_10006465
487 Ga0070701_10007864
488 Ga0070705_100002698
489 Ga0070705_100369646
490 Ga0070700_100020574
491 Ga0070700_100031739
492 Ga0070700_100126290
493 Ga0070694_100008831
494 Ga0070694_100025592
495 Ga0070694_100046549
496 Ga0070694_100179131
497 Ga0070694_100243418
498 Ga0070708_100000042
499 Ga0070708_100074229
500 Ga0070662_100076546
501 Ga0070662_100116493
502 Ga0070662_100423919
503 Ga0070681_10000053
504 Ga0070681_10002770
505 Ga0070681_10009693
506 Ga0068867_100047556
507 Ga0068867_100055456
508 Ga0068867_100079263
509 Ga0068867_100231609
510 Ga0068867_100394077
511 Ga0070706_100000053
512 Ga0070706_100007447
513 Ga0070706_100094843
514 Ga0070707_100004457
515 Ga0070707_100077168
516 Ga0070698_100013777
517 Ga0070698_100015717
518 Ga0070698_100094228
519 Ga0070699_100002993
520 Ga0070699_100181954
521 Ga0070699_100430829
522 Ga0070679_100000030
523 Ga0070679_100115002
524 Ga0070697_100024600
525 Ga0070697_100040703
526 Ga0070697_100335603
527 Ga0068853_100056351
528 Ga0068853_100103146
529 Ga0070686_100009528
530 Ga0070686_100046339
531 Ga0070686_100086740
532 Ga0070695_100022647
533 Ga0070695_100226864
534 Ga0070696_100258905
535 Ga0070693_100006565
536 Ga0070693_100029574
537 Ga0070693_100166195
538 Ga0070693_100229488
539 Ga0070704_100073051
540 Ga0070704_100116639
541 Ga0070704_100137841
542 Ga0070704_100202377
543 Ga0070664_100058456
544 Ga0070664_100113767
545 Ga0068857_100000975
546 Ga0068857_100049672
547 Ga0068857_100225351
548 Ga0068854_100077995
549 Ga0068854_100128475
550 Ga0068856_100039517
551 Ga0070702_100134849
552 Ga0070702_100160364
553 Ga0068852_100297243
554 Ga0068852_100417209
555 Ga0068859_100024100
556 Ga0068859_100061620
557 Ga0068859_100065554
558 Ga0068859_100098220
559 Ga0068859_100137780
560 Ga0068859_100145291
561 Ga0068859_100160785
562 Ga0068859_100438428
563 Ga0068859_100635840
564 Ga0068864_100002204
565 Ga0068864_100007365
566 Ga0068864_100037267
567 Ga0068864_100075234
568 Ga0068864_100076997
569 Ga0068864_100189503
570 Ga0068864_100225762
571 Ga0068866_10128626
572 Ga0068861_100002914
573 Ga0068861_100017292
574 Ga0068851_10000327
575 Ga0068851_10049134
576 Ga0068870_10011736
577 Ga0068870_10048140
578 Ga0068870_10157877
579 Ga0068863_100043173
580 Ga0068863_100185355
581 Ga0068863_100203583
582 Ga0068858_100031399
583 Ga0068858_100033552
584 Ga0068858_100115480
585 Ga0068858_100143334
586 Ga0068860_100058895
587 Ga0068860_100099662
588 Ga0068860_100107518
589 Ga0068860_100143329
590 Ga0068860_100163612
591 Ga0068860_100272345
592 Ga0068862_100009473
593 Ga0068862_100284732
594 Ga0081539_10003540
595 Ga0068871_100005838
596 Ga0068871_100220547
597 Ga0075428_100057923
598 Ga0075430_100023282
599 Ga0075431_100160052
600 Ga0075433_10014700
601 Ga0075433_10074716
602 Ga0075433_10172603
603 Ga0075434_100009959
604 Ga0075434_100023361
605 Ga0075434_100098441
606 Ga0075434_100117510
607 Ga0075434_100199465
608 Ga0075434_100360132
609 Ga0075429_100134547
610 Ga0075429_100257413
611 Ga0097620_100024098
612 Ga0097620_100061629
613 Ga0097620_100065553
614 Ga0097620_100098218
615 Ga0097620_100137777
616 Ga0097620_100145289
617 Ga0097620_100160786
618 Ga0097620_100438436
619 Ga0097620_100635853
620 Ga0075435_100088146
621 Ga0075435_100191112
622 Ga0111539_10002073
623 Ga0111539_10398612
624 Ga0111539_10536291
625 Ga0111539_10652114
626 Ga0111539_10772938
627 Ga0105245_10311552
628 Ga0105245_10426059
629 Ga0105247_10003670
630 Ga0114129_10016212
631 Ga0114129_10203030
632 Ga0114129_10397016
633 Ga0114129_10518442
634 Ga0105243_10000558
635 Ga0105243_10009837
636 Ga0105243_10023111
637 Ga0105243_10028277
638 Ga0105241_10026618
639 Ga0105241_10039123
640 Ga0105241_10039127
641 Ga0105241_10129154
642 Ga0105241_10210737
643 Ga0105242_10000362
644 Ga0105242_10000884
645 Ga0105242_10001631
646 Ga0105242_10063526
647 Ga0105242_10113842
648 Ga0105242_10134885
649 Ga0105248_10002530
650 Ga0105248_10012103
651 Ga0105248_10034888
652 Ga0105248_10159041
653 Ga0105248_10372157
654 Ga0105248_10552562
655 Ga0105237_10000521
656 Ga0105238_10509653
657 Ga0105249_10000201
658 Ga0105249_10015662
659 Ga0105249_10042396
660 Ga0105239_10059400
661 Ga0105239_10121421
662 Ga0105246_10093964
663 Ga0105246_10133985
664 Ga0157373_10034467
665 Ga0157373_10039800
666 Ga0157373_10053595
667 Ga0157373_10184322
668 Ga0157374_10067184
669 Ga0157378_10000077
670 Ga0157378_10000105
671 Ga0157378_10015791
672 Ga0157378_10017244
673 Ga0157378_10039490
674 Ga0163162_10000128
675 Ga0163162_10028030
676 Ga0163162_10058152
677 Ga0163162_10068000
678 Ga0163162_10068219
679 Ga0163162_10113500
680 Ga0163162_10153347
681 Ga0163162_10229761
682 Ga0157372_10006169
683 Ga0157372_10015828
684 Ga0157375_10001282
685 Ga0157375_10002929
686 Ga0157375_10004099
687 Ga0157375_10093649
688 Ga0157375_10197797
689 Ga0157375_10361378
690 Ga0157375_10462100
691 Ga0163163_10003319
692 Ga0163163_10008237
693 Ga0163163_10035570
694 Ga0163163_10039739
695 Ga0163163_10208296
696 Ga0157380_10010880
697 Ga0157380_10048029
698 Ga0157380_10122252
699 Ga0157380_10281931
700 Ga0157379_10104190
701 Ga0157379_10134498
702 Ga0157376_10101089
703 Ga0207666_1013211
704 Ga0207697_10115428
705 Ga0207656_10035419
706 Ga0207653_10011107
707 Ga0207642_10029062
708 Ga0207710_10000808
709 Ga0207680_10095788
710 Ga0207645_10016954
711 Ga0207645_10052375
712 Ga0207643_10001384
713 Ga0207643_10089756
714 Ga0207643_10162957
715 Ga0207643_10212229
716 Ga0207684_10000053
717 Ga0207684_10014908
718 Ga0207684_10185262
719 Ga0207684_10312357
720 Ga0207654_10035946
721 Ga0207654_10098029
722 Ga0207707_10000063
723 Ga0207707_10009335
724 Ga0207707_10030120
725 Ga0207707_10125708
726 Ga0207660_10002003
727 Ga0207660_10089674
728 Ga0207662_10021438
729 Ga0207662_10032140
730 Ga0207662_10047011
731 Ga0207662_10057468
732 Ga0207662_10084516
733 Ga0207649_10041439
734 Ga0207652_10000091
735 Ga0207646_10001854
736 Ga0207681_10051321
737 Ga0207650_10000007
738 Ga0207650_10026485
739 Ga0207690_10083879
740 Ga0207690_10150638
741 Ga0207706_10105433
742 Ga0207706_10146161
743 Ga0207706_10176571
744 Ga0207706_10459829
745 Ga0207686_10001072
746 Ga0207686_10002748
747 Ga0207686_10036582
748 Ga0207686_10051227
749 Ga0207686_10128634
750 Ga0207686_10377014
751 Ga0207709_10000325
752 Ga0207709_10012421
753 Ga0207670_10000756
754 Ga0207670_10131868
755 Ga0207704_10208106
756 Ga0207691_10058127
757 Ga0207711_10016784
758 Ga0207711_10224625
759 Ga0207711_10326552
760 Ga0207711_10357068
761 Ga0207689_10004147
762 Ga0207689_10055663
763 Ga0207689_10089756
764 Ga0207689_10148872
765 Ga0207689_10210093
766 Ga0207679_10024999
767 Ga0207679_10268446
768 Ga0207651_10013212
769 Ga0207712_10000259
770 Ga0207712_10017953
771 Ga0207712_10040235
772 Ga0207712_10207489
773 Ga0207668_10002115
774 Ga0207640_10077243
775 Ga0207640_10086092
776 Ga0207640_10098221
777 Ga0207658_10298057
778 Ga0207703_10076826
779 Ga0207703_10392223
780 Ga0207703_10426253
781 Ga0207639_10373544
782 Ga0207708_10000471
783 Ga0207708_10001411
784 Ga0207708_10185518
785 Ga0207708_10288299
786 Ga0207641_10077343
787 Ga0207641_10252306
788 Ga0207648_10039893
789 Ga0207648_10061316
790 Ga0207648_10206962
791 Ga0207676_10011121
792 Ga0207676_10045462
793 Ga0207676_10085219
794 Ga0207676_10158950
795 Ga0207676_10168520
796 Ga0207676_10606445
797 Ga0207674_10000058
798 Ga0207674_10118752
799 Ga0207674_10163075
800 Ga0207675_100002898
801 Ga0207675_100006256
802 Ga0207675_100037151
803 Ga0207675_100224763
804 Ga0207698_10052073
805 Ga0207698_10356674
806 Ga0207428_10163690
807 Ga0268265_10095710
808 Ga0268265_10183833
809 Ga0268264_10040527
810 Ga0268264_10129642
811 Ga0268264_10634246
812 Ga0316182_1301365
813 Ga0307513_10112798
814 Ga0307408_100002360
815 Ga0307405_10027425
816 Ga0307405_10092698
817 Ga0307413_10119998
818 Ga0307406_10001697
819 Ga0307412_10018160
820 Ga0307416_100005462
821 Ga0307414_10003043
822 Ga0307414_10043681
823 Ga0307415_100004223
824 Ga0373951_0010028
825 Ga0373962_0050227
826 Ga0400484_12150
827 Ga0400490_15480
828 Ga0439448_0036300
829 Ga0439462_0047780
830 Ga0439458_0004493
831 Ga0451576_0417991
832 Ga0495582_0127237
833 Ga0496102_0064033
834 Ga0496104_0509459
835 Ga0496106_0000981
836 Ga0496106_0004027
837 Ga0496106_0127571
838 Ga0496107_0034812
839 Ga0496108_0086939
840 Ga0501321_004658
841 Ga0501202_015707
842 Ga0501202_016091
843 Ga0501207_000538
844 Ga0501207_007086
845 Ga0501216_000138
846 Ga0501216_009401
847 Ga0501216_010134
848 Ga0501224_000213
849 Ga0501227_000375
850 Ga0501230_001092
851 Ga0501230_001387
852 Ga0501233_001868
853 Ga0501250_006495
854 Ga0501257_009035
855 Ga0501221_013330
856 Ga0501225_0002973
857 Ga0501225_0009108
858 Ga0501225_0015072
859 Ga0501229_007988
860 Ga0501234_002058
861 Ga0501234_003224
862 Ga0501081_0267251
863 Ga0501283_010322
864 Ga0501226_003800
865 nmdc:mga05p37_165564_c1
866 nmdc:mga05p37_30747_c1
867 nmdc:mga05p37_5317_c1
868 nmdc:mga09592_192371_c1
869 nmdc:mga09592_332163_c1
870 nmdc:mga06r32_95225_c1
871 nmdc:mga08y16_191081_c1
872 nmdc:mga08y16_261720_c1
873 nmdc:mga0n895_132579_c1
874 nmdc:mga0n895_283000_c1
875 nmdc:mga0n895_346735_c1
876 nmdc:mga0n895_45195_c1
877 nmdc:mga0n895_9938_c1
878 nmdc:mga0a205_148193_c1
879 nmdc:mga0a205_32076_c1
880 nmdc:mga0a205_350163_c1
881 nmdc:mga0a205_45671_c1
882 nmdc:mga0a205_49482_c1
883 nmdc:mga0a205_58864_c1
884 nmdc:mga0a205_74931_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

106

249

0.93

Map