F444883

General Info

Members Datasets Scaffolds Average Seq Length
442 316 421 345

Family's Representative Sequence

Representative Sequence 3300023557|Ga0247521_102428|Ga0247521_1024282
Length 412
Sequence MARASYLPAGSCLARDSNSKPRISFLTGEISGTAVSVSLKVSATRSVYKGVRCAVAEGFRETLGVSNSARPPRRVVGRGSKLIGSGSAVPKLVVSNHDLSKLVDTSDEWISSRTGIHNRRILSGDETLTGLAVESSRKALEMAKVKPEDVDLVLMCTSTPDDLFGSAPQVQREVGCIKALAFDITAACSGFVLGLVTATRFIKGGGFENVLVIGADALSRYVDWTDRGSCILFGDAAGAVLLQAAKGDQDGLLGFDLQSDGHGQKHLSVPAMGEGAVKDLGSSNGAALKPPKPPSPSCIQMNGKEVFRFAVSRVPQVIEAAMEEAGMTGSHLDWLLLHQANQRIISAVADRLQIQPDRVITNLADYGNTSAASIPLALDEAVRSGRVQSGHVIATAGFGAGVTWGSAIVRWG

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2643221559 Lysobacter sp. Root559 Isolate Unclassified
3 2643221586 Lysobacter sp. Root667 Isolate Unclassified
4 2643221612 Lysobacter sp. Root76 Isolate Unclassified
5 2643221727 Lysobacter sp. Root96 Isolate Unclassified
6 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
7 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
8 2831426010 Nostoc sp. 106C Isolate Unclassified
9 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
10 2849660919 Nostoc sp. T09 Isolate Unclassified
11 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
12 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
13 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
14 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
15 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
16 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
17 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
18 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
19 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
20 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
32 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
33 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300023557 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
121 3300023558 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
122 3300023559 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
123 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
124 3300023564 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
125 3300023664 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
126 3300023666 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
127 3300023686 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
128 3300023688 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
129 3300023690 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
130 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
196 3300031636 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
197 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
198 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
199 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
200 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
201 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
202 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
203 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
204 3300031816 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
205 3300031828 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
220 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
221 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
222 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
228 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
231 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
232 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
233 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
234 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
238 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
263 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
303 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
308 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
309 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
310 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
314 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
315 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
316 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.97
Metatranscriptomes 9.28
Isolates 4.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.05
Nodule 0
Rhizoplane 2.71
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 10.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000044 3300000545 Bacteria 25498
2 Ga0006556J51387_1008026 3300003479 Eukaryota 2055
3 Ga0006557J51388_1009583 3300003556 Eukaryota 1907
4 Ga0006558J51389_1009412 3300003558 Eukaryota 1902
5 Ga0006559J51393_1008410 3300003560 Eukaryota 1793
6 Ga0006553J51392_1008836 3300003561 Eukaryota 2012
7 Ga0006555J51386_1007989 3300003564 Eukaryota 1989
8 Ga0006560J51390_1007647 3300003565 Eukaryota 1984
9 Ga0006554J51385_1009443 3300003567 Eukaryota 1989
10 Ga0055526_1000139 3300003771 Bacteria 63930
11 Ga0055537_1000323 3300003773 Bacteria 32553
12 Ga0055524_1000206 3300003775 Bacteria 63929
13 Ga0055536_1010500 3300003781 Bacteria 3664
14 Ga0055536_1024279 3300003781 Bacteria 1759
15 Ga0055534_1000164 3300003784 Bacteria 49529
16 Ga0055528_1000027 3300003790 Bacteria 126420
17 Ga0055530_10002126 3300003791 Bacteria 13171
18 Ga0055531_10027513 3300003794 Bacteria 1992
19 Ga0065704_10093059 3300005289 Bacteria 2619
20 Ga0065712_10002445 3300005290 Bacteria 14340
21 Ga0065712_10008386 3300005290 Bacteria 4566
22 Ga0065712_10073891 3300005290 Bacteria 4240
23 Ga0065715_10093300 3300005293 Bacteria 4722
24 Ga0065715_10095718 3300005293 Bacteria 4020
25 Ga0070676_10001086 3300005328 Bacteria 13565
26 Ga0070683_100051689 3300005329 Unclassified 3805
27 Ga0070690_100002450 3300005330 Bacteria 9970
28 Ga0070670_100003606 3300005331 Bacteria 12883
29 Ga0070677_10036264 3300005333 Bacteria 1917
30 Ga0068869_100001581 3300005334 Bacteria 13529
31 Ga0068869_100121006 3300005334 Bacteria 2002
32 Ga0070687_100003779 3300005343 Bacteria 5935
33 Ga0070668_100007403 3300005347 Bacteria 8148
34 Ga0070668_100017122 3300005347 Bacteria 5424
35 Ga0070668_100106596 3300005347 Bacteria 2227
36 Ga0070675_100012863 3300005354 Bacteria 6567
37 Ga0070675_100050966 3300005354 Bacteria 3400
38 Ga0070671_100012120 3300005355 Bacteria 6938
39 Ga0070671_100027910 3300005355 Bacteria 4647
40 Ga0070674_100118598 3300005356 Bacteria 1956
41 Ga0070688_100020612 3300005365 Bacteria 3835
42 Ga0070688_100023805 3300005365 Bacteria 3607
43 Ga0070688_100045655 3300005365 Unclassified 2708
44 Ga0070667_100079715 3300005367 Bacteria 2800
45 Ga0070667_100150292 3300005367 Bacteria 2045
46 Ga0070705_100035863 3300005440 Bacteria 2783
47 Ga0070700_100045207 3300005441 Bacteria 2716
48 Ga0070700_100062722 3300005441 Bacteria 2349
49 Ga0070708_100360859 3300005445 Bacteria 1369
50 Ga0070663_100042850 3300005455 Unclassified 3182
51 Ga0070678_100001954 3300005456 Bacteria 11123
52 Ga0070662_100003178 3300005457 Bacteria 10209
53 Ga0070662_100272463 3300005457 Bacteria 1367
54 Ga0070681_10004545 3300005458 Bacteria 13231
55 Ga0070685_10174288 3300005466 Unclassified 1380
56 Ga0070707_100000171 3300005468 Bacteria 63131
57 Ga0070698_100042279 3300005471 Bacteria 4674
58 Ga0070699_100000001 3300005518 Bacteria 910751
59 Ga0070699_100003796 3300005518 Bacteria 13351
60 Ga0070684_100041405 3300005535 Unclassified 3971
61 Ga0070684_100124091 3300005535 Bacteria 2325
62 Ga0070697_100003525 3300005536 Bacteria 12025
63 Ga0070697_100136996 3300005536 Bacteria 2056
64 Ga0068853_100001596 3300005539 Bacteria 16510
65 Ga0068853_100004286 3300005539 Bacteria 11028
66 Ga0068853_100012186 3300005539 Bacteria 6993
67 Ga0068853_100038105 3300005539 Bacteria 4093
68 Ga0070672_100004775 3300005543 Bacteria 8895
69 Ga0070686_100004267 3300005544 Bacteria 7876
70 Ga0070695_100000847 3300005545 Bacteria 16475
71 Ga0070695_100105698 3300005545 Bacteria 1903
72 Ga0070665_100006223 3300005548 Bacteria 12210
73 Ga0070665_100013925 3300005548 Bacteria 8089
74 Ga0070665_100019004 3300005548 Bacteria 6893
75 Ga0068855_100007250 3300005563 Bacteria 13444
76 Ga0068855_100008679 3300005563 Bacteria 12283
77 Ga0068855_100019508 3300005563 Bacteria 8148
78 Ga0070664_100002579 3300005564 Bacteria 14610
79 Ga0070664_100230895 3300005564 Bacteria 1658
80 Ga0068857_100011412 3300005577 Bacteria 7729
81 Ga0068857_100021794 3300005577 Bacteria 5639
82 Ga0068857_100127513 3300005577 Bacteria 2293
83 Ga0068854_100001843 3300005578 Bacteria 12908
84 Ga0068856_100405079 3300005614 Bacteria 1384
85 Ga0070702_100007441 3300005615 Bacteria 5243
86 Ga0068852_100193989 3300005616 Bacteria 1918
87 Ga0068859_100001385 3300005617 Bacteria 24659
88 Ga0068859_100130355 3300005617 Bacteria 2586
89 Ga0068864_100002706 3300005618 Bacteria 14596
90 Ga0068861_100003967 3300005719 Bacteria 9910
91 Ga0068861_100007395 3300005719 Bacteria 7525
92 Ga0068851_10028635 3300005834 Bacteria 2753
93 Ga0068870_10016276 3300005840 Bacteria 3549
94 Ga0068863_100002900 3300005841 Bacteria 16987
95 Ga0068858_100013341 3300005842 Bacteria 7751
96 Ga0068862_100001203 3300005844 Bacteria 24415
97 Ga0068862_100005947 3300005844 Bacteria 10162
98 Ga0081455_10061976 3300005937 Unclassified 3145
99 Ga0070717_10324949 3300006028 Bacteria 1371
100 Ga0070712_100097433 3300006175 Bacteria 2168
101 Ga0097621_100028941 3300006237 Bacteria 4372
102 Ga0068871_100004526 3300006358 Bacteria 9687
103 Ga0075428_100001185 3300006844 Bacteria 27884
104 Ga0075428_100008978 3300006844 Bacteria 11090
105 Ga0075428_100009895 3300006844 Bacteria 10592
106 Ga0075428_100072914 3300006844 Bacteria 3749
107 Ga0075430_100006120 3300006846 Bacteria 10139
108 Ga0075430_100034376 3300006846 Bacteria 4302
109 Ga0075431_100000750 3300006847 Bacteria 28064
110 Ga0075431_100008704 3300006847 Bacteria 10168
111 Ga0075431_100031906 3300006847 Bacteria 5427
112 Ga0075431_100467538 3300006847 Bacteria 1255
113 Ga0075433_10044596 3300006852 Bacteria 3853
114 Ga0075433_10095199 3300006852 Bacteria 2635
115 Ga0075429_100000349 3300006880 Bacteria 33711
116 Ga0075429_100042990 3300006880 Bacteria 3931
117 Ga0068865_100033165 3300006881 Bacteria 3455
118 Ga0075436_100085478 3300006914 Bacteria 2190
119 Ga0097620_100001385 3300006931 Bacteria 24659
120 Ga0075435_100015751 3300007076 Bacteria 5688
121 Ga0075435_100079764 3300007076 Bacteria 2687
122 Ga0105240_10001096 3300009093 Bacteria 47799
123 Ga0105240_10010195 3300009093 Bacteria 13225
124 Ga0111539_10002071 3300009094 Bacteria 26801
125 Ga0111539_10018524 3300009094 Bacteria 8625
126 Ga0111539_10440752 3300009094 Bacteria 1517
127 Ga0114129_10000858 3300009147 Bacteria 39460
128 Ga0114129_10291199 3300009147 Bacteria 2179
129 Ga0114129_10638738 3300009147 Bacteria 1375
130 Ga0105241_10004002 3300009174 Bacteria 10894
131 Ga0105237_10010561 3300009545 Bacteria 9813
132 Ga0105237_10055478 3300009545 Bacteria 3968
133 Ga0105238_10037163 3300009551 Bacteria 4951
134 Ga0105249_10005307 3300009553 Bacteria 11128
135 Ga0105249_10372794 3300009553 Bacteria 1451
136 Ga0105239_10006916 3300010375 Bacteria 13082
137 Ga0105239_10009711 3300010375 Bacteria 10819
138 Ga0105239_10031067 3300010375 Bacteria 5875
139 Ga0157327_1000709 3300012512 Bacteria 1878
140 Ga0157374_10023292 3300013296 Bacteria 5537
141 Ga0157374_10102742 3300013296 Bacteria 2742
142 Ga0157378_10502655 3300013297 Unclassified 1211
143 Ga0163162_10035500 3300013306 Bacteria 4967
144 Ga0157372_10006976 3300013307 Bacteria 12029
145 Ga0157375_10011938 3300013308 Bacteria 7687
146 Ga0157375_10154518 3300013308 Bacteria 2432
147 Ga0157375_10302179 3300013308 Bacteria 1764
148 Ga0163163_10006694 3300014325 Bacteria 10097
149 Ga0163163_10211881 3300014325 Bacteria 1987
150 Ga0157380_10060516 3300014326 Bacteria 3026
151 Ga0157377_10015685 3300014745 Bacteria 3882
152 Ga0157376_10025657 3300014969 Bacteria 4644
153 Ga0183360_10001 3300015689 Bacteria 3943671
154 Ga0213874_10033112 3300021377 Unclassified 1505
155 Ga0224712_10095147 3300022467 Bacteria 1254
156 Ga0247521_102428 3300023557 Eukaryota 1807
157 Ga0247526_102359 3300023558 Eukaryota 1791
158 Ga0247529_102472 3300023559 Eukaryota 1767
159 Ga0247514_102247 3300023560 Eukaryota 2186
160 Ga0247515_102286 3300023564 Eukaryota 2068
161 Ga0247527_101528 3300023664 Eukaryota 1868
162 Ga0247531_102474 3300023666 Eukaryota 1714
163 Ga0247520_102498 3300023686 Eukaryota 1784
164 Ga0247522_102013 3300023688 Eukaryota 1984
165 Ga0247512_102344 3300023690 Eukaryota 2104
166 Ga0207425_1012732 3300025245 Bacteria 1962
167 Ga0209565_1000005 3300025263 Bacteria 947317
168 Ga0209565_1006619 3300025263 Bacteria 3227
169 Ga0209673_1000011 3300025273 Bacteria 586604
170 Ga0209673_1020749 3300025273 Bacteria 2318
171 Ga0209130_1003427 3300025284 Bacteria 6746
172 Ga0209675_1000004 3300025291 Bacteria 947166
173 Ga0209675_1005689 3300025291 Bacteria 5151
174 Ga0209676_1003555 3300025292 Bacteria 9429
175 Ga0209676_1009125 3300025292 Bacteria 4320
176 Ga0209676_1010841 3300025292 Bacteria 3743
177 Ga0209676_1011964 3300025292 Bacteria 3452
178 Ga0209676_1013072 3300025292 Bacteria 3213
179 Ga0209025_1003425 3300025294 Bacteria 15046
180 Ga0209564_1000018 3300025295 Bacteria 586913
181 Ga0209564_1016184 3300025295 Bacteria 2985
182 Ga0209758_1034652 3300025297 Bacteria 2004
183 Ga0209050_1001755 3300025298 Bacteria 21513
184 Ga0209256_1000031 3300025299 Bacteria 410189
185 Ga0209051_1007495 3300025303 Bacteria 5955
186 Ga0209257_1000133 3300025304 Bacteria 208808
187 Ga0209257_1012447 3300025304 Bacteria 3930
188 Ga0209257_1015927 3300025304 Bacteria 3081
189 Ga0207656_10130607 3300025321 Bacteria 1176
190 Ga0207682_10063820 3300025893 Bacteria 1547
191 Ga0207688_10139206 3300025901 Bacteria 1427
192 Ga0207647_10004927 3300025904 Bacteria 9842
193 Ga0207645_10016397 3300025907 Bacteria 4904
194 Ga0207643_10028245 3300025908 Bacteria 3115
195 Ga0207643_10054908 3300025908 Bacteria 2265
196 Ga0207654_10017024 3300025911 Bacteria 3794
197 Ga0207707_10005634 3300025912 Bacteria 10958
198 Ga0207695_10002812 3300025913 Bacteria 25307
199 Ga0207695_10006159 3300025913 Bacteria 15639
200 Ga0207671_10000306 3300025914 Bacteria 72328
201 Ga0207693_10046943 3300025915 Bacteria 3394
202 Ga0207662_10004639 3300025918 Bacteria 7250
203 Ga0207649_10084810 3300025920 Bacteria 2060
204 Ga0207652_10246758 3300025921 Bacteria 1610
205 Ga0207681_10128315 3300025923 Bacteria 1871
206 Ga0207694_10001441 3300025924 Bacteria 20398
207 Ga0207650_10020979 3300025925 Bacteria 4615
208 Ga0207659_10003806 3300025926 Bacteria 9101
209 Ga0207659_10062209 3300025926 Bacteria 2693
210 Ga0207644_10114778 3300025931 Bacteria 2041
211 Ga0207706_10001632 3300025933 Bacteria 22248
212 Ga0207706_10026020 3300025933 Bacteria 5239
213 Ga0207670_10004668 3300025936 Bacteria 7428
214 Ga0207669_10081265 3300025937 Bacteria 2076
215 Ga0207704_10032140 3300025938 Bacteria 2966
216 Ga0207691_10001228 3300025940 Bacteria 25540
217 Ga0207689_10046128 3300025942 Bacteria 3603
218 Ga0207679_10004208 3300025945 Bacteria 8942
219 Ga0207679_10150314 3300025945 Bacteria 1894
220 Ga0207667_10033438 3300025949 Bacteria 5528
221 Ga0207667_10062542 3300025949 Bacteria 3892
222 Ga0207667_10066638 3300025949 Bacteria 3753
223 Ga0207712_10038576 3300025961 Bacteria 3267
224 Ga0207712_10078644 3300025961 Bacteria 2394
225 Ga0207668_10003583 3300025972 Bacteria 9124
226 Ga0207640_10001163 3300025981 Bacteria 14437
227 Ga0207658_10221067 3300025986 Bacteria 1593
228 Ga0207677_10116668 3300026023 Bacteria 1999
229 Ga0207703_10057624 3300026035 Bacteria 3169
230 Ga0207639_10003961 3300026041 Bacteria 9993
231 Ga0207639_10007307 3300026041 Bacteria 7525
232 Ga0207678_10021399 3300026067 Bacteria 5671
233 Ga0207678_10153596 3300026067 Bacteria 1965
234 Ga0207708_10067231 3300026075 Bacteria 2741
235 Ga0207702_10041180 3300026078 Bacteria 3873
236 Ga0207641_10035486 3300026088 Bacteria 4155
237 Ga0207641_10044935 3300026088 Bacteria 3716
238 Ga0207641_10143043 3300026088 Bacteria 2160
239 Ga0207648_10007563 3300026089 Bacteria 10661
240 Ga0207676_10087515 3300026095 Bacteria 2548
241 Ga0207674_10012741 3300026116 Bacteria 9394
242 Ga0207674_10013727 3300026116 Bacteria 8967
243 Ga0207674_10125524 3300026116 Bacteria 2532
244 Ga0207675_100000471 3300026118 Bacteria 39106
245 Ga0207675_100084015 3300026118 Bacteria 2987
246 Ga0207675_100088130 3300026118 Bacteria 2915
247 Ga0207683_10011311 3300026121 Bacteria 7611
248 Ga0207428_10157116 3300027907 Bacteria 1729
249 Ga0268266_10004242 3300028379 Bacteria 13784
250 Ga0268266_10251401 3300028379 Bacteria 1635
251 Ga0268265_10002199 3300028380 Bacteria 15038
252 Ga0268264_10021416 3300028381 Bacteria 5279
253 Ga0265338_10084080 3300028800 Bacteria 2658
254 Ga0265320_10028170 3300031240 Unclassified 2920
255 Ga0265316_10051614 3300031344 Bacteria 3230
256 Ga0307513_10089975 3300031456 Bacteria 3132
257 Ga0307408_100205147 3300031548 Bacteria 1598
258 Ga0310103_103038 3300031614 Eukaryota 2083
259 Ga0310113_103444 3300031636 Eukaryota 1740
260 Ga0316575_10040413 3300031665 Bacteria 1843
261 Ga0316575_10066482 3300031665 Bacteria 1444
262 Ga0310105_103332 3300031666 Eukaryota 1799
263 Ga0310119_103916 3300031686 Eukaryota 1815
264 Ga0310101_102362 3300031690 Eukaryota 2153
265 Ga0316577_10006299 3300031733 Bacteria 6261
266 Ga0316044_103248 3300031810 Eukaryota 1991
267 Ga0316045_103334 3300031815 Eukaryota 1956
268 Ga0316042_104212 3300031816 Eukaryota 2043
269 Ga0316043_103757 3300031828 Eukaryota 2121
270 Ga0307410_10241972 3300031852 Bacteria 1399
271 Ga0307416_100498554 3300032002 Bacteria 1281
272 Ga0307414_10002326 3300032004 Bacteria 9926
273 Ga0316592_1003361 3300033524 Bacteria 2877
274 Ga0373945_0074952 3300035116 Bacteria 1287
275 Ga0373956_0000138 3300035119 Bacteria 26073
276 Ga0373946_0002231 3300035171 Bacteria 6836
277 Ga0373931_0055249 3300035691 Bacteria 2124
278 Ga0373935_0106405 3300035692 Bacteria 1856
279 Ga0373935_0265248 3300035692 Bacteria 1205
280 Ga0373927_0014528 3300035695 Bacteria 5210
281 Ga0373927_0238548 3300035695 Bacteria 1195
282 Ga0373947_0001579 3300035725 Bacteria 13968
283 Ga0310104_01872 3300036242 Eukaryota 1753
284 Ga0373937_0117468 3300036401 Bacteria 2477
285 Ga0310112_003458 3300036458 Eukaryota 2078
286 Ga0372808_006032 3300036459 Eukaryota 1621
287 Ga0310109_002246 3300036534 Eukaryota 2131
288 Ga0310110_004732 3300036535 Eukaryota 1925
289 Ga0310110_005276 3300036535 Eukaryota 1852
290 Ga0316582_0002556 3300036647 Bacteria 8610
291 Ga0316584_0016493 3300036712 Bacteria 5295
292 Ga0373925_0000183 3300037068 Bacteria 68921
293 Ga0373925_0016275 3300037068 Bacteria 5383
294 Ga0373925_0155200 3300037068 Bacteria 1800
295 Ga0395900_0104483 3300037418 Bacteria 2910
296 Ga0316581_0006233 3300037588 Bacteria 3147
297 Ga0439447_001592 3300041407 Bacteria 8309
298 Ga0451807_0517856 3300041486 Bacteria 4827
299 Ga0451807_1244457 3300041486 Bacteria 1955
300 Ga0451837_0602140 3300041494 Bacteria 3506
301 Ga0451846_52639 3300041502 Eukaryota 1623
302 Ga0451848_09797 3300041504 Eukaryota 1705
303 Ga0451850_58294 3300041506 Eukaryota 1683
304 Ga0439432_046728 3300042006 Bacteria 1359
305 Ga0451577_0000229 3300042876 Bacteria 114275
306 Ga0451577_0015360 3300042876 Bacteria 7124
307 Ga0451577_0262316 3300042876 Bacteria 1564
308 Ga0466972_0007169 3300044658 Bacteria 5598
309 Ga0453683_0000007 3300044673 Bacteria 581341
310 Ga0453683_0000165 3300044673 Bacteria 94483
311 Ga0453683_0020992 3300044673 Bacteria 4170
312 Ga0453684_0000740 3300044712 Bacteria 114275
313 Ga0453684_0000883 3300044712 Bacteria 100160
314 Ga0453684_0004226 3300044712 Bacteria 30795
315 Ga0453684_0007705 3300044712 Bacteria 19672
316 Ga0453684_0015820 3300044712 Bacteria 11862
317 Ga0453684_0016330 3300044712 Bacteria 11622
318 Ga0453684_0051326 3300044712 Bacteria 5409
319 Ga0453684_0088437 3300044712 Bacteria 3836
320 Ga0453684_0307908 3300044712 Bacteria 1799
321 Ga0451576_0016474 3300045051 Bacteria 8158
322 Ga0451576_0018371 3300045051 Bacteria 7667
323 Ga0451576_0087831 3300045051 Bacteria 3234
324 Ga0451576_0211282 3300045051 Bacteria 2026
325 Ga0451576_0385839 3300045051 Bacteria 1468
326 Ga0495629_0025311 3300046459 Bacteria 4220
327 Ga0495639_0000842 3300046475 Bacteria 13990
328 Ga0495628_0006373 3300046516 Bacteria 10314
329 Ga0495630_0007958 3300046517 Bacteria 7609
330 Ga0495666_0000024 3300046526 Bacteria 57339
331 Ga0495586_0001169 3300046535 Bacteria 14718
332 Ga0495586_0145809 3300046535 Bacteria 1330
333 Ga0495621_0017978 3300046539 Bacteria 2292
334 Ga0495622_0040730 3300046557 Bacteria 2161
335 Ga0495668_0015855 3300046616 Bacteria 4390
336 Ga0495658_0014155 3300046683 Bacteria 4069
337 Ga0495636_0005386 3300047318 Bacteria 5027
338 Ga0495636_0010202 3300047318 Bacteria 3706
339 Ga0495676_0001542 3300047321 Bacteria 19955
340 Ga0495686_0082419 3300047472 Bacteria 1963
341 Ga0496102_0079813 3300048905 Bacteria 3014
342 Ga0496106_0006799 3300048909 Bacteria 8466
343 Ga0496106_0041646 3300048909 Bacteria 3442
344 Ga0496107_0234227 3300048910 Bacteria 1366
345 Ga0496108_0032361 3300048911 Bacteria 4344
346 Ga0496109_0147625 3300048912 Bacteria 2200
347 Ga0496110_0079115 3300048913 Bacteria 2926
348 Ga0496111_0027319 3300048914 Bacteria 4035
349 Ga0496111_0100751 3300048914 Bacteria 2122
350 Ga0496113_0016016 3300048916 Bacteria 5172
351 Ga0496121_0006877 3300048924 Bacteria 13903
352 Ga0496125_0000148 3300048928 Bacteria 154612
353 Ga0501299_002041 3300049522 Bacteria 2747
354 Ga0501031_0001795 3300049568 Bacteria 13467
355 Ga0501031_0041255 3300049568 Bacteria 3014
356 Ga0501032_0010175 3300049569 Bacteria 6789
357 Ga0501032_0162106 3300049569 Bacteria 1468
358 Ga0501033_0005319 3300049570 Bacteria 10199
359 Ga0501034_0003437 3300049571 Bacteria 18085
360 Ga0501036_0014061 3300049572 Bacteria 6651
361 Ga0501037_0013333 3300049573 Bacteria 6057
362 Ga0501038_0001131 3300049574 Bacteria 24190
363 Ga0501039_0015074 3300049575 Bacteria 5912
364 Ga0501039_0026902 3300049575 Bacteria 4422
365 Ga0501039_0374585 3300049575 Bacteria 1118
366 Ga0501041_0066037 3300049577 Bacteria 2216
367 Ga0501043_0069812 3300049579 Bacteria 2760
368 Ga0501046_0008828 3300049580 Bacteria 8754
369 Ga0501046_0028174 3300049580 Bacteria 4578
370 Ga0501047_0003649 3300049581 Bacteria 14507
371 Ga0501048_0023137 3300049582 Bacteria 4543
372 Ga0501048_0039668 3300049582 Bacteria 3377
373 Ga0501067_0109441 3300049583 Bacteria 1536
374 Ga0501068_0160518 3300049584 Bacteria 1417
375 Ga0501071_0013447 3300049587 Bacteria 5578
376 Ga0501072_0005884 3300049588 Bacteria 9341
377 Ga0501073_0003923 3300049589 Bacteria 11163
378 Ga0501074_0033912 3300049590 Bacteria 3701
379 Ga0501075_0002964 3300049591 Bacteria 11361
380 Ga0501076_0046881 3300049592 Bacteria 3415
381 Ga0501077_0003882 3300049593 Bacteria 9003
382 Ga0501079_0016111 3300049741 Bacteria 5712
383 Ga0501080_0028217 3300049742 Bacteria 5220
384 Ga0501080_0393059 3300049742 Bacteria 1248
385 Ga0501081_0158981 3300049743 Bacteria 1627
386 Ga0501083_0002867 3300049744 Bacteria 11931
387 Ga0501083_0118398 3300049744 Bacteria 1738
388 Ga0501035_0002271 3300049822 Bacteria 18986
389 Ga0501035_0051513 3300049822 Bacteria 3686
390 Ga0501044_0002762 3300049823 Bacteria 19988
391 Ga0501045_0000657 3300049824 Bacteria 21947
392 nmdc:mga05p37_41251_c1 3300050507 Bacteria 5667
393 nmdc:mga05p37_52965_c1 3300050507 Bacteria 4991
394 nmdc:mga09592_13658_c1 3300050508 Bacteria 6637
395 nmdc:mga09592_13853_c1 3300050508 Bacteria 6589
396 nmdc:mga0qj67_119996_c1 3300050509 Bacteria 2126
397 nmdc:mga0qj67_4242_c1 3300050509 Bacteria 10385
398 nmdc:mga06r32_2630_c1 3300050510 Bacteria 16035
399 nmdc:mga06r32_598_c1 3300050510 Bacteria 31407
400 nmdc:mga08y16_18298_c1 3300050511 Bacteria 7382
401 nmdc:mga08y16_232070_c1 3300050511 Bacteria 1909
402 nmdc:mga08y16_43000_c1 3300050511 Bacteria 4732
403 nmdc:mga08y16_5133_c1 3300050511 Bacteria 13688
404 nmdc:mga0n895_20553_c1 3300050512 Bacteria 6159
405 nmdc:mga0rr50_11633_c1 3300050513 Bacteria 5643
406 nmdc:mga0rr50_74803_c1 3300050513 Bacteria 2594
407 nmdc:mga08x19_58808_c1 3300050514 Bacteria 2487
408 nmdc:mga0a205_111482_c1 3300050515 Bacteria 2635
409 nmdc:mga0a205_14656_c1 3300050515 Bacteria 7314
410 Ga0500610_0000500 3300053079 Bacteria 12074
411 Ga0500583_0003712 3300053092 Bacteria 4864
412 Ga0500641_0024258 3300053096 Unclassified 2337
413 Ga0500553_066267 3300053101 Bacteria 1674
414 Ga0500556_0071016 3300053104 Bacteria 1300
415 Ga0500617_064669 3300053124 Bacteria 1613
416 Ga0500577_0024112 3300053142 Bacteria 2042
417 Ga0500637_0061225 3300053178 Bacteria 2156
418 Ga0587073_0007282 3300059492 Eukaryota 1742
419 Ga0587080_004854 3300059503 Eukaryota 1774
420 Ga0587109_010097 3300059624 Eukaryota 1499
421 Ga0530510_0010435 3300061734 Bacteria 6513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10291199 Ga0114129_102911993 254
2 3300050507 nmdc:mga05p37_52965_c1 nmdc:mga05p37_52965_c1_11_919 254
3 3300042006 Ga0439432_046728 Ga0439432_046728_350_1324 268
4 3300049584 Ga0501068_0160518 Ga0501068_0160518_412_1371 271
5 3300049742 Ga0501080_0393059 Ga0501080_0393059_251_1210 271
6 3300049575 Ga0501039_0374585 Ga0501039_0374585_43_939 275
7 3300035695 Ga0373927_0238548 Ga0373927_0238548_323_1183 282
8 3300005330 Ga0070690_100002450 Ga0070690_1000024504 299
9 3300005333 Ga0070677_10036264 Ga0070677_100362642 299
10 3300005343 Ga0070687_100003779 Ga0070687_1000037791 299
11 3300005354 Ga0070675_100012863 Ga0070675_1000128636 299
12 3300005356 Ga0070674_100118598 Ga0070674_1001185982 299
13 3300005365 Ga0070688_100023805 Ga0070688_1000238052 299
14 3300005441 Ga0070700_100045207 Ga0070700_1000452072 299
15 3300005457 Ga0070662_100272463 Ga0070662_1002724631 299
16 3300005543 Ga0070672_100004775 Ga0070672_1000047751 299
17 3300005544 Ga0070686_100004267 Ga0070686_1000042672 299
18 3300005577 Ga0068857_100011412 Ga0068857_1000114128 299
19 3300005841 Ga0068863_100002900 Ga0068863_10000290016 299
20 3300006237 Ga0097621_100028941 Ga0097621_1000289415 299
21 3300006358 Ga0068871_100004526 Ga0068871_1000045266 299
22 3300006881 Ga0068865_100033165 Ga0068865_1000331654 299
23 3300013308 Ga0157375_10011938 Ga0157375_100119383 299
24 3300014325 Ga0163163_10006694 Ga0163163_1000669412 299
25 3300025893 Ga0207682_10063820 Ga0207682_100638201 299
26 3300025918 Ga0207662_10004639 Ga0207662_100046395 299
27 3300025920 Ga0207649_10084810 Ga0207649_100848102 299
28 3300025926 Ga0207659_10003806 Ga0207659_1000380611 299
29 3300025933 Ga0207706_10026020 Ga0207706_100260206 299
30 3300025936 Ga0207670_10004668 Ga0207670_100046688 299
31 3300025937 Ga0207669_10081265 Ga0207669_100812652 299
32 3300025940 Ga0207691_10001228 Ga0207691_100012289 299
33 3300025945 Ga0207679_10004208 Ga0207679_1000420812 299
34 3300026035 Ga0207703_10057624 Ga0207703_100576242 299
35 3300026067 Ga0207678_10153596 Ga0207678_101535961 299
36 3300026075 Ga0207708_10067231 Ga0207708_100672313 299
37 3300026088 Ga0207641_10143043 Ga0207641_101430432 299
38 3300026089 Ga0207648_10007563 Ga0207648_100075635 299
39 3300026116 Ga0207674_10013727 Ga0207674_100137272 299
40 3300028381 Ga0268264_10021416 Ga0268264_100214163 299
41 3300035691 Ga0373931_0055249 Ga0373931_0055249_552_1661 299
42 3300048916 Ga0496113_0016016 Ga0496113_0016016_3040_4149 299
43 3300050511 nmdc:mga08y16_18298_c1 nmdc:mga08y16_18298_c1_441_1433 299
44 3300005618 Ga0068864_100002706 Ga0068864_1000027069 300
45 3300005719 Ga0068861_100007395 Ga0068861_1000073956 300
46 3300014745 Ga0157377_10015685 Ga0157377_100156855 300
47 3300046535 Ga0495586_0145809 Ga0495586_0145809_236_1141 301
48 3300009094 Ga0111539_10440752 Ga0111539_104407521 302
49 3300035116 Ga0373945_0074952 Ga0373945_0074952_204_1196 302
50 3300035171 Ga0373946_0002231 Ga0373946_0002231_4592_5584 302
51 3300037068 Ga0373925_0000183 Ga0373925_0000183_56786_57778 302
52 3300046475 Ga0495639_0000842 Ga0495639_0000842_4622_5614 302
53 3300046526 Ga0495666_0000024 Ga0495666_0000024_31108_32100 302
54 3300046535 Ga0495586_0001169 Ga0495586_0001169_9195_10187 302
55 3300046557 Ga0495622_0040730 Ga0495622_0040730_463_1455 302
56 3300046683 Ga0495658_0014155 Ga0495658_0014155_1679_2671 302
57 3300047321 Ga0495676_0001542 Ga0495676_0001542_11242_12234 302
58 3300035725 Ga0373947_0001579 Ga0373947_0001579_1418_2365 307
59 3300046459 Ga0495629_0025311 Ga0495629_0025311_3244_4191 307
60 3300009093 Ga0105240_10010195 Ga0105240_100101952 308
61 3300009147 Ga0114129_10000858 Ga0114129_1000085823 308
62 3300009174 Ga0105241_10004002 Ga0105241_100040029 308
63 3300009545 Ga0105237_10010561 Ga0105237_100105617 308
64 3300009551 Ga0105238_10037163 Ga0105238_100371633 308
65 3300010375 Ga0105239_10006916 Ga0105239_100069167 308
66 3300013296 Ga0157374_10102742 Ga0157374_101027422 308
67 3300050507 nmdc:mga05p37_41251_c1 nmdc:mga05p37_41251_c1_3035_4108 308
68 3300050508 nmdc:mga09592_13658_c1 nmdc:mga09592_13658_c1_1560_2633 308
69 3300050510 nmdc:mga06r32_2630_c1 nmdc:mga06r32_2630_c1_5473_6546 308
70 3300050511 nmdc:mga08y16_43000_c1 nmdc:mga08y16_43000_c1_3514_4587 308
71 3300041486 Ga0451807_0517856 Ga0451807_0517856_1040_2008 310
72 iso_pu_bacteria 2941489479 2941493422 310
73 iso_pu_bacteria 2995948881 2995952483 310
74 iso_pu_bacteria 8003014200 8003016328 310
75 3300005539 Ga0068853_100004286 Ga0068853_1000042863 313
76 3300005548 Ga0070665_100019004 Ga0070665_1000190043 313
77 3300005563 Ga0068855_100008679 Ga0068855_10000867912 313
78 3300005577 Ga0068857_100127513 Ga0068857_1001275133 313
79 3300010375 Ga0105239_10009711 Ga0105239_1000971112 313
80 3300025949 Ga0207667_10033438 Ga0207667_100334388 313
81 3300025961 Ga0207712_10038576 Ga0207712_100385763 313
82 3300026041 Ga0207639_10007307 Ga0207639_100073077 313
83 3300026088 Ga0207641_10044935 Ga0207641_100449355 313
84 3300028379 Ga0268266_10004242 Ga0268266_100042425 313
85 iso_pu_bacteria 2913912277 2913912672 313
86 3300003771 Ga0055526_1000139 Ga0055526_100013916 314
87 3300003773 Ga0055537_1000323 Ga0055537_100032319 314
88 3300003775 Ga0055524_1000206 Ga0055524_100020616 314
89 3300003781 Ga0055536_1010500 Ga0055536_10105002 314
90 3300003781 Ga0055536_1024279 Ga0055536_10242792 314
91 3300003784 Ga0055534_1000164 Ga0055534_100016438 314
92 3300003790 Ga0055528_1000027 Ga0055528_100002751 314
93 3300003791 Ga0055530_10002126 Ga0055530_1000212615 314
94 3300003794 Ga0055531_10027513 Ga0055531_100275131 314
95 3300005355 Ga0070671_100012120 Ga0070671_1000121206 314
96 3300005539 Ga0068853_100001596 Ga0068853_1000015962 314
97 3300005563 Ga0068855_100019508 Ga0068855_1000195085 314
98 3300005577 Ga0068857_100021794 Ga0068857_1000217949 314
99 3300012512 Ga0157327_1000709 Ga0157327_10007092 314
100 3300013296 Ga0157374_10023292 Ga0157374_100232925 314
101 3300013297 Ga0157378_10502655 Ga0157378_105026551 314
102 3300015689 Ga0183360_10001 Ga0183360_10001740 314
103 3300025245 Ga0207425_1012732 Ga0207425_10127323 314
104 3300025263 Ga0209565_1000005 Ga0209565_1000005382 314
105 3300025263 Ga0209565_1006619 Ga0209565_10066193 314
106 3300025273 Ga0209673_1000011 Ga0209673_100001137 314
107 3300025273 Ga0209673_1020749 Ga0209673_10207491 314
108 3300025284 Ga0209130_1003427 Ga0209130_10034276 314
109 3300025291 Ga0209675_1000004 Ga0209675_1000004382 314
110 3300025291 Ga0209675_1005689 Ga0209675_10056893 314
111 3300025292 Ga0209676_1003555 Ga0209676_10035554 314
112 3300025292 Ga0209676_1009125 Ga0209676_10091253 314
113 3300025292 Ga0209676_1010841 Ga0209676_10108412 314
114 3300025292 Ga0209676_1011964 Ga0209676_10119642 314
115 3300025292 Ga0209676_1013072 Ga0209676_10130721 314
116 3300025294 Ga0209025_1003425 Ga0209025_10034253 314
117 3300025295 Ga0209564_1000018 Ga0209564_100001837 314
118 3300025295 Ga0209564_1016184 Ga0209564_10161841 314
119 3300025297 Ga0209758_1034652 Ga0209758_10346522 314
120 3300025298 Ga0209050_1001755 Ga0209050_10017553 314
121 3300025299 Ga0209256_1000031 Ga0209256_1000031381 314
122 3300025303 Ga0209051_1007495 Ga0209051_10074959 314
123 3300025304 Ga0209257_1000133 Ga0209257_10001333 314
124 3300025304 Ga0209257_1012447 Ga0209257_10124474 314
125 3300025304 Ga0209257_1015927 Ga0209257_10159273 314
126 3300025931 Ga0207644_10114778 Ga0207644_101147782 314
127 3300025949 Ga0207667_10062542 Ga0207667_100625421 314
128 3300026041 Ga0207639_10003961 Ga0207639_1000396112 314
129 3300026088 Ga0207641_10035486 Ga0207641_100354865 314
130 3300026118 Ga0207675_100084015 Ga0207675_1000840152 314
131 3300031852 Ga0307410_10241972 Ga0307410_102419721 314
132 3300041407 Ga0439447_001592 Ga0439447_001592_572_1552 314
133 3300046539 Ga0495621_0017978 Ga0495621_0017978_109_1089 314
134 3300046616 Ga0495668_0015855 Ga0495668_0015855_2391_3371 314
135 3300047318 Ga0495636_0005386 Ga0495636_0005386_2752_3732 314
136 3300047318 Ga0495636_0010202 Ga0495636_0010202_880_1860 314
137 3300048905 Ga0496102_0079813 Ga0496102_0079813_1674_2654 314
138 3300048909 Ga0496106_0041646 Ga0496106_0041646_1110_2090 314
139 3300048910 Ga0496107_0234227 Ga0496107_0234227_152_1132 314
140 3300048911 Ga0496108_0032361 Ga0496108_0032361_1348_2328 314
141 3300048912 Ga0496109_0147625 Ga0496109_0147625_218_1198 314
142 3300048913 Ga0496110_0079115 Ga0496110_0079115_736_1716 314
143 3300048914 Ga0496111_0027319 Ga0496111_0027319_1527_2507 314
144 3300048924 Ga0496121_0006877 Ga0496121_0006877_936_1916 314
145 3300049583 Ga0501067_0109441 Ga0501067_0109441_341_1336 314
146 iso_pu_bacteria 2643221559 2643818718 314
147 iso_pu_bacteria 2643221586 2643940969 314
148 iso_pu_bacteria 2643221612 2644079989 314
149 iso_pu_bacteria 2643221727 2644695584 314
150 3300041494 Ga0451837_0602140 Ga0451837_0602140_392_1390 316
151 3300005617 Ga0068859_100130355 Ga0068859_1001303554 319
152 3300014969 Ga0157376_10025657 Ga0157376_100256574 319
153 3300032004 Ga0307414_10002326 Ga0307414_1000232610 319
154 3300053096 Ga0500641_0024258 Ga0500641_0024258_1158_2288 319
155 3300005293 Ga0065715_10095718 Ga0065715_100957185 320
156 3300005328 Ga0070676_10001086 Ga0070676_100010869 320
157 3300005334 Ga0068869_100001581 Ga0068869_1000015819 320
158 3300005334 Ga0068869_100121006 Ga0068869_1001210062 320
159 3300005347 Ga0070668_100007403 Ga0070668_1000074034 320
160 3300005347 Ga0070668_100017122 Ga0070668_1000171224 320
161 3300005441 Ga0070700_100062722 Ga0070700_1000627222 320
162 3300005456 Ga0070678_100001954 Ga0070678_1000019544 320
163 3300005457 Ga0070662_100003178 Ga0070662_1000031788 320
164 3300005564 Ga0070664_100002579 Ga0070664_1000025792 320
165 3300005615 Ga0070702_100007441 Ga0070702_1000074415 320
166 3300005617 Ga0068859_100001385 Ga0068859_10000138518 320
167 3300005719 Ga0068861_100003967 Ga0068861_1000039678 320
168 3300005840 Ga0068870_10016276 Ga0068870_100162762 320
169 3300005842 Ga0068858_100013341 Ga0068858_1000133418 320
170 3300005844 Ga0068862_100001203 Ga0068862_10000120312 320
171 3300005844 Ga0068862_100005947 Ga0068862_1000059475 320
172 3300006844 Ga0075428_100001185 Ga0075428_10000118518 320
173 3300006844 Ga0075428_100008978 Ga0075428_10000897812 320
174 3300006844 Ga0075428_100009895 Ga0075428_10000989510 320
175 3300006846 Ga0075430_100006120 Ga0075430_1000061203 320
176 3300006846 Ga0075430_100034376 Ga0075430_1000343764 320
177 3300006847 Ga0075431_100000750 Ga0075431_10000075024 320
178 3300006847 Ga0075431_100008704 Ga0075431_1000087043 320
179 3300006847 Ga0075431_100031906 Ga0075431_1000319065 320
180 3300006880 Ga0075429_100000349 Ga0075429_10000034914 320
181 3300006880 Ga0075429_100042990 Ga0075429_1000429903 320
182 3300006931 Ga0097620_100001385 Ga0097620_10000138510 320
183 3300009094 Ga0111539_10002071 Ga0111539_1000207119 320
184 3300009094 Ga0111539_10018524 Ga0111539_100185242 320
185 3300009147 Ga0114129_10638738 Ga0114129_106387381 320
186 3300009553 Ga0105249_10005307 Ga0105249_1000530711 320
187 3300013306 Ga0163162_10035500 Ga0163162_100355005 320
188 3300014326 Ga0157380_10060516 Ga0157380_100605164 320
189 3300025901 Ga0207688_10139206 Ga0207688_101392062 320
190 3300025907 Ga0207645_10016397 Ga0207645_100163974 320
191 3300025908 Ga0207643_10028245 Ga0207643_100282452 320
192 3300025921 Ga0207652_10246758 Ga0207652_102467582 320
193 3300025923 Ga0207681_10128315 Ga0207681_101283152 320
194 3300025933 Ga0207706_10001632 Ga0207706_1000163215 320
195 3300025942 Ga0207689_10046128 Ga0207689_100461282 320
196 3300025961 Ga0207712_10078644 Ga0207712_100786443 320
197 3300025972 Ga0207668_10003583 Ga0207668_100035839 320
198 3300026118 Ga0207675_100000471 Ga0207675_1000004716 320
199 3300026118 Ga0207675_100088130 Ga0207675_1000881304 320
200 3300026121 Ga0207683_10011311 Ga0207683_100113114 320
201 3300027907 Ga0207428_10157116 Ga0207428_101571162 320
202 3300028380 Ga0268265_10002199 Ga0268265_1000219911 320
203 3300031548 Ga0307408_100205147 Ga0307408_1002051472 320
204 3300032002 Ga0307416_100498554 Ga0307416_1004985541 320
205 3300036242 Ga0310104_01872 Ga0310104_01872_448_1443 320
206 3300036458 Ga0310112_003458 Ga0310112_003458_563_1558 320
207 3300036459 Ga0372808_006032 Ga0372808_006032_308_1303 320
208 3300036534 Ga0310109_002246 Ga0310109_002246_594_1589 320
209 3300036535 Ga0310110_004732 Ga0310110_004732_344_1339 320
210 3300036647 Ga0316582_0002556 Ga0316582_0002556_301_1392 320
211 3300037588 Ga0316581_0006233 Ga0316581_0006233_1793_2884 320
212 3300044658 Ga0466972_0007169 Ga0466972_0007169_2382_3473 320
213 3300045051 Ga0451576_0211282 Ga0451576_0211282_82_1191 320
214 3300049522 Ga0501299_002041 Ga0501299_002041_1414_2523 320
215 3300049568 Ga0501031_0001795 Ga0501031_0001795_4303_5316 320
216 3300049568 Ga0501031_0041255 Ga0501031_0041255_1130_2236 320
217 3300049569 Ga0501032_0010175 Ga0501032_0010175_2122_3135 320
218 3300049569 Ga0501032_0162106 Ga0501032_0162106_81_1187 320
219 3300049570 Ga0501033_0005319 Ga0501033_0005319_2527_3540 320
220 3300049571 Ga0501034_0003437 Ga0501034_0003437_5617_6630 320
221 3300049572 Ga0501036_0014061 Ga0501036_0014061_2500_3513 320
222 3300049573 Ga0501037_0013333 Ga0501037_0013333_3655_4668 320
223 3300049574 Ga0501038_0001131 Ga0501038_0001131_14979_15992 320
224 3300049575 Ga0501039_0015074 Ga0501039_0015074_3606_4712 320
225 3300049575 Ga0501039_0026902 Ga0501039_0026902_1848_2861 320
226 3300049577 Ga0501041_0066037 Ga0501041_0066037_1079_2185 320
227 3300049579 Ga0501043_0069812 Ga0501043_0069812_853_1959 320
228 3300049580 Ga0501046_0008828 Ga0501046_0008828_2122_3135 320
229 3300049580 Ga0501046_0028174 Ga0501046_0028174_898_2004 320
230 3300049581 Ga0501047_0003649 Ga0501047_0003649_9407_10420 320
231 3300049582 Ga0501048_0023137 Ga0501048_0023137_2796_3809 320
232 3300049582 Ga0501048_0039668 Ga0501048_0039668_10_1116 320
233 3300049587 Ga0501071_0013447 Ga0501071_0013447_2161_3267 320
234 3300049588 Ga0501072_0005884 Ga0501072_0005884_7014_8120 320
235 3300049589 Ga0501073_0003923 Ga0501073_0003923_4761_5774 320
236 3300049590 Ga0501074_0033912 Ga0501074_0033912_1540_2646 320
237 3300049591 Ga0501075_0002964 Ga0501075_0002964_2118_3224 320
238 3300049592 Ga0501076_0046881 Ga0501076_0046881_1056_2162 320
239 3300049593 Ga0501077_0003882 Ga0501077_0003882_2161_3267 320
240 3300049741 Ga0501079_0016111 Ga0501079_0016111_2535_3641 320
241 3300049742 Ga0501080_0028217 Ga0501080_0028217_4002_5015 320
242 3300049743 Ga0501081_0158981 Ga0501081_0158981_429_1535 320
243 3300049744 Ga0501083_0118398 Ga0501083_0118398_386_1399 320
244 3300049822 Ga0501035_0002271 Ga0501035_0002271_2763_3776 320
245 3300049822 Ga0501035_0051513 Ga0501035_0051513_252_1358 320
246 3300049823 Ga0501044_0002762 Ga0501044_0002762_15159_16172 320
247 3300049824 Ga0501045_0000657 Ga0501045_0000657_18524_19630 320
248 3300050508 nmdc:mga09592_13853_c1 nmdc:mga09592_13853_c1_2004_3110 320
249 3300050509 nmdc:mga0qj67_119996_c1 nmdc:mga0qj67_119996_c1_184_1290 320
250 3300050509 nmdc:mga0qj67_4242_c1 nmdc:mga0qj67_4242_c1_2579_3688 320
251 3300050510 nmdc:mga06r32_598_c1 nmdc:mga06r32_598_c1_3942_5048 320
252 3300050511 nmdc:mga08y16_232070_c1 nmdc:mga08y16_232070_c1_360_1469 320
253 3300050511 nmdc:mga08y16_5133_c1 nmdc:mga08y16_5133_c1_12293_13399 320
254 3300053092 Ga0500583_0003712 Ga0500583_0003712_729_1820 320
255 3300053104 Ga0500556_0071016 Ga0500556_0071016_171_1262 320
256 3300053124 Ga0500617_064669 Ga0500617_064669_46_1137 320
257 3300053142 Ga0500577_0024112 Ga0500577_0024112_291_1382 320
258 3300053178 Ga0500637_0061225 Ga0500637_0061225_800_1909 320
259 3300061734 Ga0530510_0010435 Ga0530510_0010435_3304_4410 320
260 3300005355 Ga0070671_100027910 Ga0070671_1000279102 321
261 3300005367 Ga0070667_100150292 Ga0070667_1001502923 321
262 3300005535 Ga0070684_100124091 Ga0070684_1001240912 321
263 3300005539 Ga0068853_100038105 Ga0068853_1000381056 321
264 3300005564 Ga0070664_100230895 Ga0070664_1002308952 321
265 3300005614 Ga0068856_100405079 Ga0068856_1004050791 321
266 3300005616 Ga0068852_100193989 Ga0068852_1001939892 321
267 3300005834 Ga0068851_10028635 Ga0068851_100286353 321
268 3300010375 Ga0105239_10031067 Ga0105239_100310678 321
269 3300014325 Ga0163163_10211881 Ga0163163_102118812 321
270 3300025321 Ga0207656_10130607 Ga0207656_101306071 321
271 3300025938 Ga0207704_10032140 Ga0207704_100321402 321
272 3300025945 Ga0207679_10150314 Ga0207679_101503142 321
273 3300026023 Ga0207677_10116668 Ga0207677_101166682 321
274 3300026095 Ga0207676_10087515 Ga0207676_100875151 321
275 3300026116 Ga0207674_10125524 Ga0207674_101255242 321
276 3300041486 Ga0451807_1244457 Ga0451807_1244457_465_1532 321
277 3300045051 Ga0451576_0087831 Ga0451576_0087831_1191_2168 321
278 3300047472 Ga0495686_0082419 Ga0495686_0082419_626_1642 321
279 3300050513 nmdc:mga0rr50_11633_c1 nmdc:mga0rr50_11633_c1_2052_3029 321
280 iso_pu_bacteria 2617270889 2617918271 321
281 iso_pu_bacteria 2811994880 2812365158 321
282 iso_pu_bacteria 2831426010 2831431756 321
283 iso_pu_bacteria 2848694841 2848696670 321
284 iso_pu_bacteria 2849660919 2849666276 321
285 iso_pu_bacteria 2873151551 2873156019 321
286 iso_pu_bacteria 2886627955 2886633917 321
287 iso_pu_bacteria 2913844669 2913848303 321
288 iso_pu_bacteria 2913939268 2913941330 321
289 iso_pu_bacteria 642555144 642599434 321
290 3300046516 Ga0495628_0006373 Ga0495628_0006373_3206_4201 322
291 3300013308 Ga0157375_10154518 Ga0157375_101545182 323
292 3300031665 Ga0316575_10040413 Ga0316575_100404132 323
293 iso_pu_bacteria 2912723979 2912729565 323
294 3300005367 Ga0070667_100079715 Ga0070667_1000797153 324
295 3300025986 Ga0207658_10221067 Ga0207658_102210671 324
296 3300028379 Ga0268266_10251401 Ga0268266_102514012 324
297 3300045051 Ga0451576_0016474 Ga0451576_0016474_384_1385 324
298 3300005539 Ga0068853_100012186 Ga0068853_1000121865 325
299 3300005548 Ga0070665_100006223 Ga0070665_10000622313 325
300 3300005563 Ga0068855_100007250 Ga0068855_1000072504 325
301 3300005578 Ga0068854_100001843 Ga0068854_1000018436 325
302 3300006028 Ga0070717_10324949 Ga0070717_103249491 325
303 3300021377 Ga0213874_10033112 Ga0213874_100331122 325
304 3300022467 Ga0224712_10095147 Ga0224712_100951472 325
305 3300025904 Ga0207647_10004927 Ga0207647_100049278 325
306 3300025911 Ga0207654_10017024 Ga0207654_100170244 325
307 3300025913 Ga0207695_10002812 Ga0207695_1000281211 325
308 3300025914 Ga0207671_10000306 Ga0207671_1000030624 325
309 3300025924 Ga0207694_10001441 Ga0207694_1000144114 325
310 3300025949 Ga0207667_10066638 Ga0207667_100666384 325
311 3300025981 Ga0207640_10001163 Ga0207640_100011637 325
312 3300026078 Ga0207702_10041180 Ga0207702_100411804 325
313 3300028800 Ga0265338_10084080 Ga0265338_100840803 325
314 3300033524 Ga0316592_1003361 Ga0316592_10033612 325
315 3300035119 Ga0373956_0000138 Ga0373956_0000138_14870_15871 325
316 3300036401 Ga0373937_0117468 Ga0373937_0117468_846_1838 325
317 3300042876 Ga0451577_0262316 Ga0451577_0262316_36_1040 325
318 3300044673 Ga0453683_0000007 Ga0453683_0000007_418609_419613 325
319 3300044712 Ga0453684_0007705 Ga0453684_0007705_8112_9116 325
320 3300044712 Ga0453684_0016330 Ga0453684_0016330_2650_3654 325
321 3300053079 Ga0500610_0000500 Ga0500610_0000500_5513_6577 325
322 3300006847 Ga0075431_100467538 Ga0075431_1004675382 326
323 3300031733 Ga0316577_10006299 Ga0316577_100062992 326
324 3300036712 Ga0316584_0016493 Ga0316584_0016493_109_1104 326
325 3300042876 Ga0451577_0000229 Ga0451577_0000229_66727_67752 326
326 3300042876 Ga0451577_0015360 Ga0451577_0015360_1428_2432 326
327 3300044673 Ga0453683_0000165 Ga0453683_0000165_11457_12437 326
328 3300044712 Ga0453684_0000740 Ga0453684_0000740_66727_67752 326
329 3300044712 Ga0453684_0000883 Ga0453684_0000883_84719_85723 326
330 3300044712 Ga0453684_0004226 Ga0453684_0004226_1845_2825 326
331 3300044712 Ga0453684_0015820 Ga0453684_0015820_10408_11388 326
332 3300044712 Ga0453684_0051326 Ga0453684_0051326_1339_2346 326
333 3300049744 Ga0501083_0002867 Ga0501083_0002867_10404_11432 326
334 3300053101 Ga0500553_066267 Ga0500553_066267_477_1484 327
335 3300005458 Ga0070681_10004545 Ga0070681_100045454 328
336 3300005518 Ga0070699_100003796 Ga0070699_10000379611 328
337 3300005545 Ga0070695_100105698 Ga0070695_1001056982 328
338 3300006844 Ga0075428_100072914 Ga0075428_1000729142 328
339 3300009545 Ga0105237_10055478 Ga0105237_100554784 328
340 3300013307 Ga0157372_10006976 Ga0157372_1000697610 328
341 3300025912 Ga0207707_10005634 Ga0207707_100056346 328
342 3300037418 Ga0395900_0104483 Ga0395900_0104483_1360_2349 328
343 3300044673 Ga0453683_0020992 Ga0453683_0020992_3096_4103 328
344 3300045051 Ga0451576_0018371 Ga0451576_0018371_1846_2853 328
345 3300031240 Ga0265320_10028170 Ga0265320_100281704 329
346 3300048914 Ga0496111_0100751 Ga0496111_0100751_162_1169 329
347 iso_pu_bacteria 2802429296 2804849462 329
348 iso_pu_bacteria 8025413630 8025414516 329
349 3300031665 Ga0316575_10066482 Ga0316575_100664822 330
350 3300059492 Ga0587073_0007282 Ga0587073_0007282_371_1399 330
351 3300059503 Ga0587080_004854 Ga0587080_004854_337_1365 330
352 3300059624 Ga0587109_010097 Ga0587109_010097_295_1323 330
353 3300005290 Ga0065712_10002445 Ga0065712_100024457 331
354 3300005331 Ga0070670_100003606 Ga0070670_1000036067 331
355 3300005354 Ga0070675_100050966 Ga0070675_1000509662 331
356 3300005365 Ga0070688_100020612 Ga0070688_1000206125 331
357 3300006914 Ga0075436_100085478 Ga0075436_1000854782 331
358 3300007076 Ga0075435_100015751 Ga0075435_1000157515 331
359 3300013308 Ga0157375_10302179 Ga0157375_103021791 331
360 3300025908 Ga0207643_10054908 Ga0207643_100549082 331
361 3300025925 Ga0207650_10020979 Ga0207650_100209797 331
362 3300025926 Ga0207659_10062209 Ga0207659_100622092 331
363 3300026116 Ga0207674_10012741 Ga0207674_100127418 331
364 3300050514 nmdc:mga08x19_58808_c1 nmdc:mga08x19_58808_c1_365_1372 331
365 3300036535 Ga0310110_005276 Ga0310110_005276_482_1531 333
366 3300031344 Ga0265316_10051614 Ga0265316_100516142 334
367 3300044712 Ga0453684_0088437 Ga0453684_0088437_1911_2921 334
368 3300005545 Ga0070695_100000847 Ga0070695_1000008473 335
369 3300006852 Ga0075433_10044596 Ga0075433_100445963 335
370 3300050515 nmdc:mga0a205_14656_c1 nmdc:mga0a205_14656_c1_4438_5448 335
371 3300044712 Ga0453684_0307908 Ga0453684_0307908_213_1223 336
372 3300005347 Ga0070668_100106596 Ga0070668_1001065962 338
373 3300005937 Ga0081455_10061976 Ga0081455_100619762 338
374 3300048909 Ga0496106_0006799 Ga0496106_0006799_5703_6788 338
375 3300048928 Ga0496125_0000148 Ga0496125_0000148_153498_154514 338
376 3300003479 Ga0006556J51387_1008026 Ga0006556J51387_10080261 339
377 3300003556 Ga0006557J51388_1009583 Ga0006557J51388_10095831 339
378 3300003558 Ga0006558J51389_1009412 Ga0006558J51389_10094121 339
379 3300003560 Ga0006559J51393_1008410 Ga0006559J51393_10084101 339
380 3300003561 Ga0006553J51392_1008836 Ga0006553J51392_10088361 339
381 3300003564 Ga0006555J51386_1007989 Ga0006555J51386_10079891 339
382 3300003565 Ga0006560J51390_1007647 Ga0006560J51390_10076472 339
383 3300003567 Ga0006554J51385_1009443 Ga0006554J51385_10094431 339
384 3300005536 Ga0070697_100136996 Ga0070697_1001369961 339
385 3300023557 Ga0247521_102428 Ga0247521_1024282 339
386 3300023558 Ga0247526_102359 Ga0247526_1023592 339
387 3300023559 Ga0247529_102472 Ga0247529_1024721 339
388 3300023560 Ga0247514_102247 Ga0247514_1022472 339
389 3300023564 Ga0247515_102286 Ga0247515_1022862 339
390 3300023664 Ga0247527_101528 Ga0247527_1015281 339
391 3300023666 Ga0247531_102474 Ga0247531_1024741 339
392 3300023686 Ga0247520_102498 Ga0247520_1024982 339
393 3300023688 Ga0247522_102013 Ga0247522_1020132 339
394 3300023690 Ga0247512_102344 Ga0247512_1023441 339
395 3300031614 Ga0310103_103038 Ga0310103_1030382 339
396 3300031636 Ga0310113_103444 Ga0310113_1034441 339
397 3300031666 Ga0310105_103332 Ga0310105_1033321 339
398 3300031686 Ga0310119_103916 Ga0310119_1039161 339
399 3300031690 Ga0310101_102362 Ga0310101_1023621 339
400 3300031810 Ga0316044_103248 Ga0316044_1032481 339
401 3300031815 Ga0316045_103334 Ga0316045_1033341 339
402 3300031816 Ga0316042_104212 Ga0316042_1042122 339
403 3300031828 Ga0316043_103757 Ga0316043_1037572 339
404 3300041502 Ga0451846_52639 Ga0451846_52639_160_1344 339
405 3300041504 Ga0451848_09797 Ga0451848_09797_474_1658 339
406 3300041506 Ga0451850_58294 Ga0451850_58294_119_1303 339
407 3300000545 CNXas_1000044 CNXas_100004425 340
408 3300005289 Ga0065704_10093059 Ga0065704_100930592 340
409 3300005290 Ga0065712_10008386 Ga0065712_100083862 340
410 3300005290 Ga0065712_10073891 Ga0065712_100738916 340
411 3300005293 Ga0065715_10093300 Ga0065715_100933005 340
412 3300005329 Ga0070683_100051689 Ga0070683_1000516893 340
413 3300005365 Ga0070688_100045655 Ga0070688_1000456553 340
414 3300005440 Ga0070705_100035863 Ga0070705_1000358632 340
415 3300005445 Ga0070708_100360859 Ga0070708_1003608592 340
416 3300005455 Ga0070663_100042850 Ga0070663_1000428503 340
417 3300005466 Ga0070685_10174288 Ga0070685_101742881 340
418 3300005468 Ga0070707_100000171 Ga0070707_1000001717 340
419 3300005471 Ga0070698_100042279 Ga0070698_1000422793 340
420 3300005518 Ga0070699_100000001 Ga0070699_100000001612 340
421 3300005535 Ga0070684_100041405 Ga0070684_1000414053 340
422 3300005536 Ga0070697_100003525 Ga0070697_10000352514 340
423 3300005548 Ga0070665_100013925 Ga0070665_1000139259 340
424 3300006175 Ga0070712_100097433 Ga0070712_1000974332 340
425 3300006852 Ga0075433_10095199 Ga0075433_100951992 340
426 3300007076 Ga0075435_100079764 Ga0075435_1000797642 340
427 3300009093 Ga0105240_10001096 Ga0105240_100010969 340
428 3300009553 Ga0105249_10372794 Ga0105249_103727942 340
429 3300025913 Ga0207695_10006159 Ga0207695_100061595 340
430 3300025915 Ga0207693_10046943 Ga0207693_100469432 340
431 3300026067 Ga0207678_10021399 Ga0207678_100213997 340
432 3300031456 Ga0307513_10089975 Ga0307513_100899752 340
433 3300035692 Ga0373935_0106405 Ga0373935_0106405_190_1227 340
434 3300035692 Ga0373935_0265248 Ga0373935_0265248_55_1077 340
435 3300035695 Ga0373927_0014528 Ga0373927_0014528_662_1699 340
436 3300037068 Ga0373925_0016275 Ga0373925_0016275_4157_5194 340
437 3300037068 Ga0373925_0155200 Ga0373925_0155200_337_1359 340
438 3300045051 Ga0451576_0385839 Ga0451576_0385839_215_1249 340
439 3300046517 Ga0495630_0007958 Ga0495630_0007958_3815_4852 340
440 3300050512 nmdc:mga0n895_20553_c1 nmdc:mga0n895_20553_c1_3420_4445 340
441 3300050513 nmdc:mga0rr50_74803_c1 nmdc:mga0rr50_74803_c1_11_1036 340
442 3300050515 nmdc:mga0a205_111482_c1 nmdc:mga0a205_111482_c1_590_1615 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

322

411

0.99

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

182

261

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9868 18 340
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9856 17 340
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9838 17 340
4x9o-assembly1.cif.gz_B beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate 0.9834 17 340
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9816 17 340
ID Description Score Start End Superfamily
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9892 17 184 3.40.47.10
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.984 17 184 3.40.47.10
4x9oB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9834 17 340 3.40.47.10
3il4B01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9821 17 184 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9803 17 340 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A661PT68-F1-model_v4 3-oxoacyl-ACP synthase 0.9996 20 130 GO:0016746
GO:0044550
AF-A0A800M9R9-F1-model_v4 3-oxoacyl-ACP synthase 0.9989 19 169 GO:0004315
GO:0006633
GO:0044550
AF-A0A535AJN1-F1-model_v4 3-oxoacyl-ACP synthase 0.9953 15 174 GO:0004315
GO:0006633
GO:0044550
AF-A0A7X3RR09-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9951 16 340 GO:0004315
GO:0005737
GO:0006633
GO:0033818
AF-A0A3D1TF25-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9948 26 340 GO:0004315
GO:0005737
GO:0006633
GO:0033818
GO:0044550

Feature Viewer

pLDDT pTM Quality
94.51 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map