F444836

General Info

Members Datasets Scaffolds Average Seq Length
442 225 884 138

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100011874|Ga0070679_1000118742
Length 156
Sequence MWGVTRVILRRSNRPEVLMTHRYMKMGITVGVLAAAFIGLLYVTLAEGTEYYKHVDEVMASPEQWQGKQLQLHGFIVANSILVKPDTLEYRFKVQSNGKVVDASYQGIVPDTFKDRPGEEAEVVLKGQLTSAGFHVDPNGVMAKCPSKYEAAKKVG

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
147 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
148 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
149 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
153 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
198 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
199 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 5.66
Rhizosphere 92.99
Stem 0
Stem Tuber 0
Unclassified 31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100011874 3300005530 Bacteria 8311
2 Ga0058863_11495934 3300004799 Unclassified 605
3 Ga0058863_11915774 3300004799 Bacteria 1404
4 Ga0058861_10019214 3300004800 Bacteria 4251
5 Ga0058860_12036263 3300004801 Unclassified 500
6 Ga0065712_10085612 3300005290 Bacteria 2687
7 Ga0065712_10098318 3300005290 Bacteria 2119
8 Ga0065715_10090397 3300005293 Bacteria 7095
9 Ga0065715_10113281 3300005293 Bacteria 2495
10 Ga0065715_10124422 3300005293 Bacteria 2154
11 Ga0065715_10498930 3300005293 Bacteria 781
12 Ga0065707_10649141 3300005295 Unclassified 664
13 Ga0070683_100050105 3300005329 Bacteria 3864
14 Ga0070683_100244441 3300005329 Bacteria 1707
15 Ga0070690_100394569 3300005330 Bacteria 1015
16 Ga0070670_100055802 3300005331 Bacteria 3390
17 Ga0070670_100062607 3300005331 Bacteria 3194
18 Ga0070670_100316893 3300005331 Bacteria 1366
19 Ga0070677_10069553 3300005333 Bacteria 1477
20 Ga0070677_10404615 3300005333 Bacteria 720
21 Ga0070666_10247724 3300005335 Bacteria 1261
22 Ga0070680_100194431 3300005336 Unclassified 1710
23 Ga0070682_100113315 3300005337 Bacteria 1811
24 Ga0070682_100722416 3300005337 Bacteria 801
25 Ga0068868_101918750 3300005338 Unclassified 561
26 Ga0070660_100219280 3300005339 Bacteria 1546
27 Ga0070691_10456633 3300005341 Bacteria 730
28 Ga0070661_100004508 3300005344 Bacteria 9592
29 Ga0070661_101439276 3300005344 Unclassified 580
30 Ga0070675_100188019 3300005354 Bacteria 1788
31 Ga0070675_100374987 3300005354 Unclassified 1265
32 Ga0070671_100024579 3300005355 Bacteria 4934
33 Ga0070671_100046821 3300005355 Bacteria 3597
34 Ga0070671_100273395 3300005355 Bacteria 1436
35 Ga0070671_101195030 3300005355 Unclassified 669
36 Ga0070674_100020304 3300005356 Bacteria 4240
37 Ga0070674_101331856 3300005356 Unclassified 641
38 Ga0070673_100483437 3300005364 Unclassified 1118
39 Ga0070673_101275359 3300005364 Unclassified 690
40 Ga0070688_100919589 3300005365 Unclassified 691
41 Ga0070659_100116274 3300005366 Bacteria 2162
42 Ga0070659_100144513 3300005366 Bacteria 1938
43 Ga0070659_101188598 3300005366 Unclassified 674
44 Ga0070667_100804220 3300005367 Bacteria 873
45 Ga0070709_10051061 3300005434 Bacteria 2594
46 Ga0070710_10535306 3300005437 Bacteria 807
47 Ga0070711_100873212 3300005439 Unclassified 766
48 Ga0070663_100323651 3300005455 Bacteria 1240
49 Ga0070663_100955378 3300005455 Bacteria 743
50 Ga0070678_100634183 3300005456 Unclassified 957
51 Ga0070678_100824594 3300005456 Bacteria 844
52 Ga0070662_100445479 3300005457 Unclassified 1074
53 Ga0070662_101538634 3300005457 Archaea 574
54 Ga0070681_10402044 3300005458 Bacteria 1281
55 Ga0070685_10493525 3300005466 Unclassified 865
56 Ga0070706_100319190 3300005467 Bacteria 1449
57 Ga0070707_100041375 3300005468 Bacteria 4411
58 Ga0070707_100045963 3300005468 Bacteria 4178
59 Ga0070698_100053448 3300005471 Unclassified 4104
60 Ga0070698_100137666 3300005471 Unclassified 2395
61 Ga0070679_100293965 3300005530 Unclassified 1576
62 Ga0070672_100066615 3300005543 Bacteria 2852
63 Ga0070672_100241294 3300005543 Bacteria 1520
64 Ga0070686_100026280 3300005544 Bacteria 3513
65 Ga0070686_100551909 3300005544 Unclassified 901
66 Ga0070695_100002451 3300005545 Bacteria 10675
67 Ga0070665_100466666 3300005548 Bacteria 1273
68 Ga0070704_100166151 3300005549 Bacteria 1750
69 Ga0070704_101070080 3300005549 Bacteria 732
70 Ga0068855_100314513 3300005563 Bacteria 1732
71 Ga0070664_100494685 3300005564 Bacteria 1127
72 Ga0070664_101140344 3300005564 Bacteria 735
73 Ga0068857_100067476 3300005577 Bacteria 3184
74 Ga0068857_100395068 3300005577 Bacteria 1286
75 Ga0068856_100445997 3300005614 Bacteria 1315
76 Ga0068852_100202224 3300005616 Unclassified 1880
77 Ga0068852_100731504 3300005616 Bacteria 1001
78 Ga0068859_100758483 3300005617 Bacteria 1059
79 Ga0068864_101964723 3300005618 Unclassified 591
80 Ga0068866_10581414 3300005718 Unclassified 753
81 Ga0068866_11207981 3300005718 Unclassified 546
82 Ga0068861_101978665 3300005719 Unclassified 581
83 Ga0068863_100517468 3300005841 Bacteria 1176
84 Ga0068863_101246458 3300005841 Unclassified 750
85 Ga0068863_101416998 3300005841 Bacteria 703
86 Ga0068860_101913592 3300005843 Unclassified 615
87 Ga0068862_100957035 3300005844 Bacteria 845
88 Ga0075368_10027672 3300006042 Bacteria 2188
89 Ga0075367_10089892 3300006178 Bacteria 1867
90 Ga0075366_10291192 3300006195 Bacteria 998
91 Ga0068871_100263113 3300006358 Bacteria 1505
92 Ga0068871_100689258 3300006358 Unclassified 935
93 Ga0068871_102229706 3300006358 Unclassified 522
94 Ga0075428_100046239 3300006844 Bacteria 4781
95 Ga0075428_100084996 3300006844 Bacteria 3451
96 Ga0075428_100353557 3300006844 Bacteria 1577
97 Ga0075428_100699490 3300006844 Bacteria 1080
98 Ga0075428_101875640 3300006844 Unclassified 623
99 Ga0075430_100185819 3300006846 Bacteria 1728
100 Ga0075431_100004138 3300006847 Bacteria 14159
101 Ga0075431_100099896 3300006847 Bacteria 2994
102 Ga0075431_100213790 3300006847 Bacteria 1969
103 Ga0075431_100570292 3300006847 Bacteria 1118
104 Ga0075431_101466049 3300006847 Unclassified 641
105 Ga0075431_101560880 3300006847 Unclassified 618
106 Ga0075431_101820150 3300006847 Bacteria 565
107 Ga0075433_10154706 3300006852 Bacteria 2040
108 Ga0075433_10330204 3300006852 Bacteria 1349
109 Ga0075433_10589937 3300006852 Bacteria 976
110 Ga0075433_10879574 3300006852 Unclassified 782
111 Ga0075433_11220202 3300006852 Unclassified 652
112 Ga0075434_100420748 3300006871 Unclassified 1357
113 Ga0075434_101634727 3300006871 Unclassified 652
114 Ga0075429_100050336 3300006880 Bacteria 3625
115 Ga0075429_100134455 3300006880 Bacteria 2164
116 Ga0075429_100333311 3300006880 Unclassified 1328
117 Ga0097620_100758629 3300006931 Bacteria 1059
118 Ga0075435_100000992 3300007076 Bacteria 17997
119 Ga0075435_100286715 3300007076 Bacteria 1406
120 Ga0105240_10499974 3300009093 Unclassified 1352
121 Ga0111539_10156620 3300009094 Bacteria 2666
122 Ga0111539_10226210 3300009094 Bacteria 2179
123 Ga0111539_10488014 3300009094 Bacteria 1435
124 Ga0111539_11515983 3300009094 Unclassified 778
125 Ga0105245_10551115 3300009098 Unclassified 1175
126 Ga0105247_11017229 3300009101 Archaea 648
127 Ga0114129_10012218 3300009147 Bacteria 12218
128 Ga0114129_10024895 3300009147 Bacteria 8486
129 Ga0114129_10046845 3300009147 Bacteria 6076
130 Ga0114129_10355375 3300009147 Bacteria 1940
131 Ga0114129_10724376 3300009147 Unclassified 1276
132 Ga0114129_10911982 3300009147 Bacteria 1113
133 Ga0114129_11380640 3300009147 Unclassified 870
134 Ga0114129_11454240 3300009147 Bacteria 844
135 Ga0105243_10358146 3300009148 Bacteria 1342
136 Ga0105243_11068684 3300009148 Bacteria 814
137 Ga0105242_10691631 3300009176 Bacteria 997
138 Ga0105248_10096249 3300009177 Bacteria 3334
139 Ga0105248_10141513 3300009177 Bacteria 2714
140 Ga0105248_10517296 3300009177 Bacteria 1346
141 Ga0105248_11054640 3300009177 Bacteria 918
142 Ga0105248_11116630 3300009177 Bacteria 891
143 Ga0105249_11330099 3300009553 Bacteria 790
144 Ga0105239_10882043 3300010375 Bacteria 1027
145 Ga0105239_11867400 3300010375 Unclassified 696
146 Ga0105239_13650135 3300010375 Bacteria 500
147 Ga0105246_10101900 3300011119 Bacteria 2092
148 Ga0157370_10045521 3300013104 Bacteria 4209
149 Ga0157369_10318525 3300013105 Unclassified 1617
150 Ga0157374_10114873 3300013296 Bacteria 2592
151 Ga0157374_10267061 3300013296 Unclassified 1687
152 Ga0157378_11317393 3300013297 Unclassified 764
153 Ga0163162_10515387 3300013306 Bacteria 1326
154 Ga0163162_11448361 3300013306 Archaea 782
155 Ga0163162_11729145 3300013306 Unclassified 714
156 Ga0163162_12365307 3300013306 Unclassified 611
157 Ga0157372_10553443 3300013307 Unclassified 1341
158 Ga0157375_10248034 3300013308 Bacteria 1941
159 Ga0157375_10449805 3300013308 Bacteria 1454
160 Ga0163163_10024460 3300014325 Bacteria 5749
161 Ga0182008_10670255 3300014497 Bacteria 589
162 Ga0157377_10579580 3300014745 Unclassified 797
163 Ga0157376_10213967 3300014969 Bacteria 1781
164 Ga0157376_10569991 3300014969 Bacteria 1123
165 Ga0157376_10571928 3300014969 Unclassified 1121
166 Ga0206350_11416462 3300020080 Bacteria 739
167 Ga0154015_1588769 3300020610 Bacteria 1258
168 Ga0207697_10004939 3300025315 Bacteria 6286
169 Ga0207697_10027739 3300025315 Unclassified 2315
170 Ga0207697_10197972 3300025315 Bacteria 883
171 Ga0207688_10010729 3300025901 Bacteria 4986
172 Ga0207680_10149120 3300025903 Bacteria 1558
173 Ga0207699_10043653 3300025906 Bacteria 2606
174 Ga0207645_10622864 3300025907 Unclassified 733
175 Ga0207705_10242179 3300025909 Bacteria 1374
176 Ga0207684_10480787 3300025910 Unclassified 1065
177 Ga0207684_11128049 3300025910 Unclassified 652
178 Ga0207707_10240832 3300025912 Bacteria 1573
179 Ga0207695_10670100 3300025913 Bacteria 918
180 Ga0207663_10766356 3300025916 Unclassified 767
181 Ga0207657_10037273 3300025919 Bacteria 4343
182 Ga0207657_10231546 3300025919 Bacteria 1477
183 Ga0207649_10088074 3300025920 Bacteria 2027
184 Ga0207652_10077597 3300025921 Bacteria 2899
185 Ga0207646_10049547 3300025922 Bacteria 3762
186 Ga0207646_10496305 3300025922 Bacteria 1100
187 Ga0207650_10117593 3300025925 Bacteria 2066
188 Ga0207650_10652559 3300025925 Unclassified 887
189 Ga0207650_10889322 3300025925 Bacteria 756
190 Ga0207644_10213106 3300025931 Bacteria 1528
191 Ga0207690_10739394 3300025932 Bacteria 810
192 Ga0207706_10154505 3300025933 Bacteria 2018
193 Ga0207686_10387810 3300025934 Bacteria 1061
194 Ga0207669_10416380 3300025937 Unclassified 1056
195 Ga0207691_10137098 3300025940 Bacteria 2158
196 Ga0207691_10139332 3300025940 Bacteria 2138
197 Ga0207711_10479550 3300025941 Unclassified 1159
198 Ga0207711_11911839 3300025941 Bacteria 536
199 Ga0207661_10502785 3300025944 Unclassified 1107
200 Ga0207661_10637284 3300025944 Bacteria 979
201 Ga0207679_10128695 3300025945 Bacteria 2028
202 Ga0207651_10494965 3300025960 Bacteria 1056
203 Ga0207658_10803327 3300025986 Bacteria 854
204 Ga0207678_10352294 3300026067 Bacteria 1270
205 Ga0207678_10551053 3300026067 Bacteria 1008
206 Ga0207702_10321783 3300026078 Bacteria 1473
207 Ga0207641_10893145 3300026088 Bacteria 882
208 Ga0207641_11147740 3300026088 Unclassified 776
209 Ga0207676_10247317 3300026095 Bacteria 1603
210 Ga0207676_11198077 3300026095 Bacteria 753
211 Ga0207674_10262595 3300026116 Bacteria 1674
212 Ga0207675_101325821 3300026118 Unclassified 740
213 Ga0207683_10124637 3300026121 Bacteria 2315
214 Ga0207683_10135362 3300026121 Bacteria 2218
215 Ga0207683_10421829 3300026121 Bacteria 1229
216 Ga0207683_10663046 3300026121 Unclassified 967
217 Ga0207698_10345820 3300026142 Bacteria 1403
218 Ga0207698_12650808 3300026142 Unclassified 510
219 Ga0207428_10118624 3300027907 Bacteria 2030
220 Ga0207428_10238780 3300027907 Bacteria 1358
221 Ga0268266_10600947 3300028379 Bacteria 1057
222 Ga0268266_10604888 3300028379 Unclassified 1053
223 Ga0268265_10866817 3300028380 Unclassified 885
224 Ga0268264_11302522 3300028381 Bacteria 737
225 Ga0268264_11800959 3300028381 Unclassified 622
226 Ga0307408_100036529 3300031548 Bacteria 3454
227 Ga0307408_100134789 3300031548 Bacteria 1931
228 Ga0307408_100265625 3300031548 Unclassified 1422
229 Ga0307408_100647926 3300031548 Bacteria 944
230 Ga0307406_10336845 3300031901 Bacteria 1173
231 Ga0307407_10084866 3300031903 Bacteria 1925
232 Ga0307407_10730792 3300031903 Unclassified 748
233 Ga0307409_100026484 3300031995 Bacteria 4090
234 Ga0307416_100035555 3300032002 Bacteria 3806
235 Ga0307416_100123596 3300032002 Bacteria 2313
236 Ga0373945_0045880 3300035116 Bacteria 1593
237 Ga0373960_0187712 3300035121 Archaea 725
238 Ga0373946_0174448 3300035171 Bacteria 1017
239 Ga0373955_0133314 3300035172 Bacteria 1452
240 Ga0373931_0167899 3300035691 Bacteria 1291
241 Ga0373935_0450631 3300035692 Bacteria 930
242 Ga0373925_0109301 3300037068 Bacteria 2134
243 Ga0395905_0246603 3300037471 Bacteria 1669
244 Ga0395905_0424664 3300037471 Unclassified 1226
245 Ga0395901_1475112 3300038443 Unclassified 637
246 Ga0439436_0256677 3300041404 Unclassified 508
247 Ga0439461_0074955 3300041410 Bacteria 790
248 Ga0451797_0446079 3300041453 Unclassified 509
249 Ga0451807_1446289 3300041486 Unclassified 739
250 Ga0451839_0284447 3300041496 Bacteria 558
251 Ga0439431_0227244 3300041997 Bacteria 549
252 Ga0439433_0009358 3300041999 Bacteria 2132
253 Ga0439433_0077851 3300041999 Unclassified 804
254 Ga0439449_0067813 3300042007 Bacteria 1315
255 Ga0439457_175912 3300042014 Unclassified 521
256 Ga0439446_0054846 3300042156 Bacteria 1196
257 Ga0439446_0182614 3300042156 Bacteria 702
258 Ga0439446_0349617 3300042156 Unclassified 527
259 Ga0439464_0127725 3300042439 Bacteria 786
260 Ga0439460_0042290 3300042461 Unclassified 1342
261 Ga0439440_0089596 3300042993 Unclassified 824
262 Ga0451576_0729959 3300045051 Bacteria 1041
263 Ga0495580_0098613 3300046472 Bacteria 2033
264 Ga0495594_0264280 3300046499 Bacteria 980
265 Ga0495628_0256282 3300046516 Bacteria 1305
266 Ga0495628_0285365 3300046516 Bacteria 1225
267 Ga0495635_0248440 3300046663 Unclassified 1200
268 Ga0495602_0897961 3300048088 Bacteria 590
269 Ga0496101_0780217 3300048904 Unclassified 754
270 Ga0496102_0006997 3300048905 Bacteria 9629
271 Ga0496104_0018760 3300048907 Bacteria 6317
272 Ga0496104_0309602 3300048907 Bacteria 1492
273 Ga0496105_0024432 3300048908 Bacteria 4909
274 Ga0496106_0047958 3300048909 Bacteria 3216
275 Ga0496106_0266531 3300048909 Bacteria 1371
276 Ga0496106_1545077 3300048909 Unclassified 510
277 Ga0496108_0016245 3300048911 Bacteria 6068
278 Ga0496108_0193318 3300048911 Bacteria 1764
279 Ga0496108_0208047 3300048911 Bacteria 1698
280 Ga0496109_0333882 3300048912 Unclassified 1431
281 Ga0496109_0408388 3300048912 Bacteria 1283
282 Ga0496110_0008372 3300048913 Bacteria 8320
283 Ga0496110_0056246 3300048913 Bacteria 3462
284 Ga0496110_0297831 3300048913 Bacteria 1469
285 Ga0496111_0050372 3300048914 Bacteria 3004
286 Ga0496112_0017386 3300048915 Bacteria 6754
287 Ga0496112_0017482 3300048915 Bacteria 6737
288 Ga0496113_0213132 3300048916 Bacteria 1538
289 Ga0496113_1434680 3300048916 Unclassified 534
290 Ga0496114_0235543 3300048917 Unclassified 1609
291 Ga0496114_0496728 3300048917 Bacteria 1079
292 Ga0501298_168727 3300049521 Bacteria 544
293 Ga0501031_0099311 3300049568 Bacteria 1900
294 Ga0501031_0247824 3300049568 Bacteria 1158
295 Ga0501033_0208879 3300049570 Bacteria 1393
296 Ga0501033_0429007 3300049570 Bacteria 920
297 Ga0501033_0680931 3300049570 Unclassified 701
298 Ga0501034_0128548 3300049571 Bacteria 2518
299 Ga0501036_0071223 3300049572 Bacteria 2940
300 Ga0501036_0071966 3300049572 Bacteria 2923
301 Ga0501036_0873489 3300049572 Archaea 739
302 Ga0501037_0089903 3300049573 Bacteria 2222
303 Ga0501038_0134711 3300049574 Bacteria 2025
304 Ga0501039_0064347 3300049575 Bacteria 2843
305 Ga0501039_0135026 3300049575 Bacteria 1937
306 Ga0501039_0335542 3300049575 Bacteria 1188
307 Ga0501039_1031938 3300049575 Unclassified 638
308 Ga0501040_0037465 3300049576 Bacteria 3295
309 Ga0501040_0100696 3300049576 Bacteria 2015
310 Ga0501040_0365339 3300049576 Unclassified 1034
311 Ga0501040_0461341 3300049576 Bacteria 915
312 Ga0501041_0076359 3300049577 Unclassified 2061
313 Ga0501041_0087555 3300049577 Unclassified 1922
314 Ga0501041_0139187 3300049577 Unclassified 1513
315 Ga0501041_0502143 3300049577 Unclassified 772
316 Ga0501041_0813297 3300049577 Bacteria 599
317 Ga0501042_0047974 3300049578 Bacteria 3045
318 Ga0501042_0067091 3300049578 Bacteria 2565
319 Ga0501046_0130928 3300049580 Bacteria 1903
320 Ga0501046_0304165 3300049580 Bacteria 1164
321 Ga0501046_0449150 3300049580 Bacteria 927
322 Ga0501048_0056800 3300049582 Bacteria 2777
323 Ga0501048_0073694 3300049582 Bacteria 2410
324 Ga0501048_0081280 3300049582 Unclassified 2286
325 Ga0501048_0309182 3300049582 Unclassified 1125
326 Ga0501068_0830085 3300049584 Unclassified 607
327 Ga0501069_0188845 3300049585 Bacteria 1192
328 Ga0501070_0441143 3300049586 Bacteria 1050
329 Ga0501070_0909835 3300049586 Unclassified 686
330 Ga0501071_0022714 3300049587 Bacteria 4375
331 Ga0501071_0054868 3300049587 Bacteria 2875
332 Ga0501071_0081425 3300049587 Bacteria 2369
333 Ga0501071_0269137 3300049587 Bacteria 1288
334 Ga0501071_0391416 3300049587 Unclassified 1061
335 Ga0501071_0800438 3300049587 Unclassified 727
336 Ga0501072_0024689 3300049588 Bacteria 4679
337 Ga0501072_0042051 3300049588 Bacteria 3590
338 Ga0501072_0050368 3300049588 Bacteria 3279
339 Ga0501072_0316023 3300049588 Bacteria 1241
340 Ga0501072_0940788 3300049588 Bacteria 674
341 Ga0501073_0461223 3300049589 Unclassified 878
342 Ga0501074_0075138 3300049590 Bacteria 2426
343 Ga0501074_0235605 3300049590 Unclassified 1303
344 Ga0501074_0341493 3300049590 Unclassified 1063
345 Ga0501074_1203319 3300049590 Unclassified 531
346 Ga0501075_0002950 3300049591 Bacteria 11380
347 Ga0501075_0073030 3300049591 Bacteria 2594
348 Ga0501075_0076030 3300049591 Bacteria 2539
349 Ga0501075_0186874 3300049591 Bacteria 1580
350 Ga0501075_0236712 3300049591 Bacteria 1392
351 Ga0501075_0686743 3300049591 Bacteria 780
352 Ga0501076_0005671 3300049592 Bacteria 9002
353 Ga0501076_0023536 3300049592 Bacteria 4750
354 Ga0501076_0036915 3300049592 Bacteria 3831
355 Ga0501076_0065281 3300049592 Bacteria 2902
356 Ga0501076_0251588 3300049592 Unclassified 1446
357 Ga0501076_0267770 3300049592 Bacteria 1399
358 Ga0501076_0306215 3300049592 Bacteria 1303
359 Ga0501077_0079614 3300049593 Unclassified 2076
360 Ga0501077_0280611 3300049593 Bacteria 1060
361 Ga0501077_0362567 3300049593 Bacteria 925
362 Ga0501077_0767276 3300049593 Unclassified 620
363 Ga0501249_178878 3300049679 Unclassified 547
364 Ga0501250_057616 3300049680 Unclassified 612
365 Ga0501221_110968 3300049704 Unclassified 691
366 Ga0501245_153650 3300049708 Unclassified 510
367 Ga0501079_0119972 3300049741 Bacteria 2045
368 Ga0501079_0220071 3300049741 Bacteria 1483
369 Ga0501079_0286174 3300049741 Unclassified 1289
370 Ga0501079_0309358 3300049741 Unclassified 1236
371 Ga0501079_0533901 3300049741 Bacteria 922
372 Ga0501080_0030667 3300049742 Bacteria 5010
373 Ga0501080_0185846 3300049742 Unclassified 1911
374 Ga0501080_0338286 3300049742 Bacteria 1360
375 Ga0501080_0575094 3300049742 Unclassified 1002
376 Ga0501080_1065201 3300049742 Unclassified 699
377 Ga0501081_0151582 3300049743 Bacteria 1666
378 Ga0501081_0481933 3300049743 Unclassified 923
379 Ga0501081_0506631 3300049743 Unclassified 900
380 Ga0501083_1098408 3300049744 Unclassified 518
381 Ga0501083_1135176 3300049744 Unclassified 509
382 Ga0501270_166455 3300049767 Unclassified 512
383 Ga0501035_0422908 3300049822 Bacteria 1106
384 Ga0501044_0838368 3300049823 Unclassified 797
385 Ga0501045_0025718 3300049824 Bacteria 4233
386 Ga0501045_0083458 3300049824 Bacteria 2357
387 Ga0501045_0138285 3300049824 Unclassified 1811
388 Ga0501045_0350933 3300049824 Bacteria 1098
389 nmdc:mga0k408_107463_c1 3300050493 Bacteria 1648
390 nmdc:mga05p37_1889487_c1 3300050507 Unclassified 571
391 nmdc:mga05p37_23316_c1 3300050507 Bacteria 7510
392 nmdc:mga05p37_23929_c1 3300050507 Bacteria 7416
393 nmdc:mga05p37_25677_c1 3300050507 Bacteria 7166
394 nmdc:mga05p37_38606_c1 3300050507 Bacteria 5858
395 nmdc:mga05p37_73619_c1 3300050507 Bacteria 4204
396 nmdc:mga09592_82526_c1 3300050508 Bacteria 2739
397 nmdc:mga0qj67_117067_c1 3300050509 Bacteria 2154
398 nmdc:mga06r32_1109254_c1 3300050510 Bacteria 740
399 nmdc:mga06r32_1401319_c1 3300050510 Unclassified 641
400 nmdc:mga06r32_1488442_c1 3300050510 Unclassified 617
401 nmdc:mga06r32_15573_c1 3300050510 Bacteria 6908
402 nmdc:mga06r32_96648_c1 3300050510 Bacteria 2893
403 nmdc:mga08y16_175404_c1 3300050511 Bacteria 2226
404 nmdc:mga08y16_390867_c1 3300050511 Bacteria 1425
405 nmdc:mga08y16_777493_c1 3300050511 Bacteria 952
406 nmdc:mga0n895_1249946_c1 3300050512 Unclassified 715
407 nmdc:mga0n895_482640_c1 3300050512 Bacteria 1250
408 nmdc:mga0rr50_14454_c1 3300050513 Bacteria 5180
409 nmdc:mga0rr50_30821_c1 3300050513 Bacteria 3802
410 nmdc:mga0a205_127217_c1 3300050515 Bacteria 2448
411 nmdc:mga0a205_18321_c2 3300050515 Bacteria 3864
412 nmdc:mga0a205_34009_c1 3300050515 Bacteria 4890
413 nmdc:mga0a205_349615_c1 3300050515 Bacteria 1346
414 nmdc:mga0a205_494123_c1 3300050515 Bacteria 1081
415 nmdc:mga0a205_609734_c1 3300050515 Bacteria 944
416 Ga0495601_0701602 3300053077 Unclassified 646
417 Ga0495619_0010502 3300053085 Bacteria 5827
418 Ga0501084_0226662 3300054114 Unclassified 1577
419 Ga0501084_0328352 3300054114 Bacteria 1292
420 Ga0501084_0699088 3300054114 Unclassified 855
421 Ga0501084_1158202 3300054114 Unclassified 649
422 Ga0501084_1587556 3300054114 Unclassified 547
423 Ga0590071_000290 3300059421 Bacteria 14640
424 Ga0590071_007022 3300059421 Bacteria 2665
425 Ga0590071_029160 3300059421 Bacteria 1311
426 Ga0590071_034740 3300059421 Unclassified 1206
427 Ga0590074_000236 3300059423 Bacteria 7338
428 Ga0590074_004973 3300059423 Bacteria 2196
429 Ga0590074_030142 3300059423 Bacteria 956
430 Ga0590075_001329 3300059424 Bacteria 6206
431 Ga0590077_000640 3300059426 Bacteria 9374
432 Ga0590077_008256 3300059426 Bacteria 2133
433 Ga0590077_010556 3300059426 Bacteria 1899
434 Ga0590077_123236 3300059426 Unclassified 613
435 Ga0501082_0288086 3300060353 Unclassified 1430
436 Ga0501082_0486629 3300060353 Unclassified 1078
437 Ga0501082_0820020 3300060353 Bacteria 814
438 Ga0501082_1304227 3300060353 Bacteria 634
439 Ga0530510_0005423 3300061734 Bacteria 8826
440 Ga0530510_0326888 3300061734 Unclassified 1150
441 Ga0530510_0334600 3300061734 Bacteria 1136
442 Ga0530510_1305707 3300061734 Unclassified 556
443 Ga0070679_100011874
444 Ga0058863_11495934
445 Ga0058863_11915774
446 Ga0058861_10019214
447 Ga0058860_12036263
448 Ga0065712_10085612
449 Ga0065712_10098318
450 Ga0065715_10090397
451 Ga0065715_10113281
452 Ga0065715_10124422
453 Ga0065715_10498930
454 Ga0065707_10649141
455 Ga0070683_100050105
456 Ga0070683_100244441
457 Ga0070690_100394569
458 Ga0070670_100055802
459 Ga0070670_100062607
460 Ga0070670_100316893
461 Ga0070677_10069553
462 Ga0070677_10404615
463 Ga0070666_10247724
464 Ga0070680_100194431
465 Ga0070682_100113315
466 Ga0070682_100722416
467 Ga0068868_101918750
468 Ga0070660_100219280
469 Ga0070691_10456633
470 Ga0070661_100004508
471 Ga0070661_101439276
472 Ga0070675_100188019
473 Ga0070675_100374987
474 Ga0070671_100024579
475 Ga0070671_100046821
476 Ga0070671_100273395
477 Ga0070671_101195030
478 Ga0070674_100020304
479 Ga0070674_101331856
480 Ga0070673_100483437
481 Ga0070673_101275359
482 Ga0070688_100919589
483 Ga0070659_100116274
484 Ga0070659_100144513
485 Ga0070659_101188598
486 Ga0070667_100804220
487 Ga0070709_10051061
488 Ga0070710_10535306
489 Ga0070711_100873212
490 Ga0070663_100323651
491 Ga0070663_100955378
492 Ga0070678_100634183
493 Ga0070678_100824594
494 Ga0070662_100445479
495 Ga0070662_101538634
496 Ga0070681_10402044
497 Ga0070685_10493525
498 Ga0070706_100319190
499 Ga0070707_100041375
500 Ga0070707_100045963
501 Ga0070698_100053448
502 Ga0070698_100137666
503 Ga0070679_100293965
504 Ga0070672_100066615
505 Ga0070672_100241294
506 Ga0070686_100026280
507 Ga0070686_100551909
508 Ga0070695_100002451
509 Ga0070665_100466666
510 Ga0070704_100166151
511 Ga0070704_101070080
512 Ga0068855_100314513
513 Ga0070664_100494685
514 Ga0070664_101140344
515 Ga0068857_100067476
516 Ga0068857_100395068
517 Ga0068856_100445997
518 Ga0068852_100202224
519 Ga0068852_100731504
520 Ga0068859_100758483
521 Ga0068864_101964723
522 Ga0068866_10581414
523 Ga0068866_11207981
524 Ga0068861_101978665
525 Ga0068863_100517468
526 Ga0068863_101246458
527 Ga0068863_101416998
528 Ga0068860_101913592
529 Ga0068862_100957035
530 Ga0075368_10027672
531 Ga0075367_10089892
532 Ga0075366_10291192
533 Ga0068871_100263113
534 Ga0068871_100689258
535 Ga0068871_102229706
536 Ga0075428_100046239
537 Ga0075428_100084996
538 Ga0075428_100353557
539 Ga0075428_100699490
540 Ga0075428_101875640
541 Ga0075430_100185819
542 Ga0075431_100004138
543 Ga0075431_100099896
544 Ga0075431_100213790
545 Ga0075431_100570292
546 Ga0075431_101466049
547 Ga0075431_101560880
548 Ga0075431_101820150
549 Ga0075433_10154706
550 Ga0075433_10330204
551 Ga0075433_10589937
552 Ga0075433_10879574
553 Ga0075433_11220202
554 Ga0075434_100420748
555 Ga0075434_101634727
556 Ga0075429_100050336
557 Ga0075429_100134455
558 Ga0075429_100333311
559 Ga0097620_100758629
560 Ga0075435_100000992
561 Ga0075435_100286715
562 Ga0105240_10499974
563 Ga0111539_10156620
564 Ga0111539_10226210
565 Ga0111539_10488014
566 Ga0111539_11515983
567 Ga0105245_10551115
568 Ga0105247_11017229
569 Ga0114129_10012218
570 Ga0114129_10024895
571 Ga0114129_10046845
572 Ga0114129_10355375
573 Ga0114129_10724376
574 Ga0114129_10911982
575 Ga0114129_11380640
576 Ga0114129_11454240
577 Ga0105243_10358146
578 Ga0105243_11068684
579 Ga0105242_10691631
580 Ga0105248_10096249
581 Ga0105248_10141513
582 Ga0105248_10517296
583 Ga0105248_11054640
584 Ga0105248_11116630
585 Ga0105249_11330099
586 Ga0105239_10882043
587 Ga0105239_11867400
588 Ga0105239_13650135
589 Ga0105246_10101900
590 Ga0157370_10045521
591 Ga0157369_10318525
592 Ga0157374_10114873
593 Ga0157374_10267061
594 Ga0157378_11317393
595 Ga0163162_10515387
596 Ga0163162_11448361
597 Ga0163162_11729145
598 Ga0163162_12365307
599 Ga0157372_10553443
600 Ga0157375_10248034
601 Ga0157375_10449805
602 Ga0163163_10024460
603 Ga0182008_10670255
604 Ga0157377_10579580
605 Ga0157376_10213967
606 Ga0157376_10569991
607 Ga0157376_10571928
608 Ga0206350_11416462
609 Ga0154015_1588769
610 Ga0207697_10004939
611 Ga0207697_10027739
612 Ga0207697_10197972
613 Ga0207688_10010729
614 Ga0207680_10149120
615 Ga0207699_10043653
616 Ga0207645_10622864
617 Ga0207705_10242179
618 Ga0207684_10480787
619 Ga0207684_11128049
620 Ga0207707_10240832
621 Ga0207695_10670100
622 Ga0207663_10766356
623 Ga0207657_10037273
624 Ga0207657_10231546
625 Ga0207649_10088074
626 Ga0207652_10077597
627 Ga0207646_10049547
628 Ga0207646_10496305
629 Ga0207650_10117593
630 Ga0207650_10652559
631 Ga0207650_10889322
632 Ga0207644_10213106
633 Ga0207690_10739394
634 Ga0207706_10154505
635 Ga0207686_10387810
636 Ga0207669_10416380
637 Ga0207691_10137098
638 Ga0207691_10139332
639 Ga0207711_10479550
640 Ga0207711_11911839
641 Ga0207661_10502785
642 Ga0207661_10637284
643 Ga0207679_10128695
644 Ga0207651_10494965
645 Ga0207658_10803327
646 Ga0207678_10352294
647 Ga0207678_10551053
648 Ga0207702_10321783
649 Ga0207641_10893145
650 Ga0207641_11147740
651 Ga0207676_10247317
652 Ga0207676_11198077
653 Ga0207674_10262595
654 Ga0207675_101325821
655 Ga0207683_10124637
656 Ga0207683_10135362
657 Ga0207683_10421829
658 Ga0207683_10663046
659 Ga0207698_10345820
660 Ga0207698_12650808
661 Ga0207428_10118624
662 Ga0207428_10238780
663 Ga0268266_10600947
664 Ga0268266_10604888
665 Ga0268265_10866817
666 Ga0268264_11302522
667 Ga0268264_11800959
668 Ga0307408_100036529
669 Ga0307408_100134789
670 Ga0307408_100265625
671 Ga0307408_100647926
672 Ga0307406_10336845
673 Ga0307407_10084866
674 Ga0307407_10730792
675 Ga0307409_100026484
676 Ga0307416_100035555
677 Ga0307416_100123596
678 Ga0373945_0045880
679 Ga0373960_0187712
680 Ga0373946_0174448
681 Ga0373955_0133314
682 Ga0373931_0167899
683 Ga0373935_0450631
684 Ga0373925_0109301
685 Ga0395905_0246603
686 Ga0395905_0424664
687 Ga0395901_1475112
688 Ga0439436_0256677
689 Ga0439461_0074955
690 Ga0451797_0446079
691 Ga0451807_1446289
692 Ga0451839_0284447
693 Ga0439431_0227244
694 Ga0439433_0009358
695 Ga0439433_0077851
696 Ga0439449_0067813
697 Ga0439457_175912
698 Ga0439446_0054846
699 Ga0439446_0182614
700 Ga0439446_0349617
701 Ga0439464_0127725
702 Ga0439460_0042290
703 Ga0439440_0089596
704 Ga0451576_0729959
705 Ga0495580_0098613
706 Ga0495594_0264280
707 Ga0495628_0256282
708 Ga0495628_0285365
709 Ga0495635_0248440
710 Ga0495602_0897961
711 Ga0496101_0780217
712 Ga0496102_0006997
713 Ga0496104_0018760
714 Ga0496104_0309602
715 Ga0496105_0024432
716 Ga0496106_0047958
717 Ga0496106_0266531
718 Ga0496106_1545077
719 Ga0496108_0016245
720 Ga0496108_0193318
721 Ga0496108_0208047
722 Ga0496109_0333882
723 Ga0496109_0408388
724 Ga0496110_0008372
725 Ga0496110_0056246
726 Ga0496110_0297831
727 Ga0496111_0050372
728 Ga0496112_0017386
729 Ga0496112_0017482
730 Ga0496113_0213132
731 Ga0496113_1434680
732 Ga0496114_0235543
733 Ga0496114_0496728
734 Ga0501298_168727
735 Ga0501031_0099311
736 Ga0501031_0247824
737 Ga0501033_0208879
738 Ga0501033_0429007
739 Ga0501033_0680931
740 Ga0501034_0128548
741 Ga0501036_0071223
742 Ga0501036_0071966
743 Ga0501036_0873489
744 Ga0501037_0089903
745 Ga0501038_0134711
746 Ga0501039_0064347
747 Ga0501039_0135026
748 Ga0501039_0335542
749 Ga0501039_1031938
750 Ga0501040_0037465
751 Ga0501040_0100696
752 Ga0501040_0365339
753 Ga0501040_0461341
754 Ga0501041_0076359
755 Ga0501041_0087555
756 Ga0501041_0139187
757 Ga0501041_0502143
758 Ga0501041_0813297
759 Ga0501042_0047974
760 Ga0501042_0067091
761 Ga0501046_0130928
762 Ga0501046_0304165
763 Ga0501046_0449150
764 Ga0501048_0056800
765 Ga0501048_0073694
766 Ga0501048_0081280
767 Ga0501048_0309182
768 Ga0501068_0830085
769 Ga0501069_0188845
770 Ga0501070_0441143
771 Ga0501070_0909835
772 Ga0501071_0022714
773 Ga0501071_0054868
774 Ga0501071_0081425
775 Ga0501071_0269137
776 Ga0501071_0391416
777 Ga0501071_0800438
778 Ga0501072_0024689
779 Ga0501072_0042051
780 Ga0501072_0050368
781 Ga0501072_0316023
782 Ga0501072_0940788
783 Ga0501073_0461223
784 Ga0501074_0075138
785 Ga0501074_0235605
786 Ga0501074_0341493
787 Ga0501074_1203319
788 Ga0501075_0002950
789 Ga0501075_0073030
790 Ga0501075_0076030
791 Ga0501075_0186874
792 Ga0501075_0236712
793 Ga0501075_0686743
794 Ga0501076_0005671
795 Ga0501076_0023536
796 Ga0501076_0036915
797 Ga0501076_0065281
798 Ga0501076_0251588
799 Ga0501076_0267770
800 Ga0501076_0306215
801 Ga0501077_0079614
802 Ga0501077_0280611
803 Ga0501077_0362567
804 Ga0501077_0767276
805 Ga0501249_178878
806 Ga0501250_057616
807 Ga0501221_110968
808 Ga0501245_153650
809 Ga0501079_0119972
810 Ga0501079_0220071
811 Ga0501079_0286174
812 Ga0501079_0309358
813 Ga0501079_0533901
814 Ga0501080_0030667
815 Ga0501080_0185846
816 Ga0501080_0338286
817 Ga0501080_0575094
818 Ga0501080_1065201
819 Ga0501081_0151582
820 Ga0501081_0481933
821 Ga0501081_0506631
822 Ga0501083_1098408
823 Ga0501083_1135176
824 Ga0501270_166455
825 Ga0501035_0422908
826 Ga0501044_0838368
827 Ga0501045_0025718
828 Ga0501045_0083458
829 Ga0501045_0138285
830 Ga0501045_0350933
831 nmdc:mga0k408_107463_c1
832 nmdc:mga05p37_1889487_c1
833 nmdc:mga05p37_23316_c1
834 nmdc:mga05p37_23929_c1
835 nmdc:mga05p37_25677_c1
836 nmdc:mga05p37_38606_c1
837 nmdc:mga05p37_73619_c1
838 nmdc:mga09592_82526_c1
839 nmdc:mga0qj67_117067_c1
840 nmdc:mga06r32_1109254_c1
841 nmdc:mga06r32_1401319_c1
842 nmdc:mga06r32_1488442_c1
843 nmdc:mga06r32_15573_c1
844 nmdc:mga06r32_96648_c1
845 nmdc:mga08y16_175404_c1
846 nmdc:mga08y16_390867_c1
847 nmdc:mga08y16_777493_c1
848 nmdc:mga0n895_1249946_c1
849 nmdc:mga0n895_482640_c1
850 nmdc:mga0rr50_14454_c1
851 nmdc:mga0rr50_30821_c1
852 nmdc:mga0a205_127217_c1
853 nmdc:mga0a205_18321_c2
854 nmdc:mga0a205_34009_c1
855 nmdc:mga0a205_349615_c1
856 nmdc:mga0a205_494123_c1
857 nmdc:mga0a205_609734_c1
858 Ga0495601_0701602
859 Ga0495619_0010502
860 Ga0501084_0226662
861 Ga0501084_0328352
862 Ga0501084_0699088
863 Ga0501084_1158202
864 Ga0501084_1587556
865 Ga0590071_000290
866 Ga0590071_007022
867 Ga0590071_029160
868 Ga0590071_034740
869 Ga0590074_000236
870 Ga0590074_004973
871 Ga0590074_030142
872 Ga0590075_001329
873 Ga0590077_000640
874 Ga0590077_008256
875 Ga0590077_010556
876 Ga0590077_123236
877 Ga0501082_0288086
878 Ga0501082_0486629
879 Ga0501082_0820020
880 Ga0501082_1304227
881 Ga0530510_0005423
882 Ga0530510_0326888
883 Ga0530510_0334600
884 Ga0530510_1305707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

19

152

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8033 51 126
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.7927 31 122
1w3s-assembly1.cif.gz_A the crystal structure of reco from deinococcus radiodurans. 0.7848 48 122
1kaw-assembly1.cif.gz_A structure of single stranded dna binding protein (ssb) 0.7757 51 108
1u5k-assembly1.cif.gz_B recombinational repair protein reco 0.7737 51 122
ID Description Score Start End Superfamily
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8033 51 126 2.40.50.140
af_K7VHZ3_96_226_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7948 31 122 2.40.50.140
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7927 31 122 2.40.50.140
1g29102 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7792 55 101 2.40.50.140
af_Q5SV06_230_347_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7708 31 122 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1Q7GS37-F1-model_v4 Cytochrome c maturation protein CcmE 0.9247 26 127 GO:0005886
GO:0017004
GO:0020037
AF-A0A7V3U6N4-F1-model_v4 Cytochrome c maturation protein CcmE 0.8919 29 122 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A1Q7GS37-F1-model_v4 Cytochrome c maturation protein CcmE 0.891 26 127 GO:0005886
GO:0017004
GO:0020037
AF-A0A7V2ICH5-F1-model_v4 Cytochrome c maturation protein CcmE 0.8792 4 128 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A7W1TXU8-F1-model_v4 Cytochrome c maturation protein CcmE 0.8755 1 122 GO:0005886
GO:0017004
GO:0020037
GO:0046872

Map