F444778

General Info

Members Datasets Scaffolds Average Seq Length
441 266 882 309

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_0241512|Ga0501035_0241512_544_1521
Length 325
Sequence MRSSSRRILPDTQHAMRTIVVGLGVQGYKRRRFAGSDFVASVDIKNPEADHRTLADVPFDAYDAALVCVPDDAKIELLRTLLGHGKHVLVEKPLVAGDEATLAELQRLARANDAVCQVAYNHRFEPHFVRMRDLIASGALGRIYRCRMFYGNGTARLVRNSDWRDRGAGVLDDLGSHLLDTARFWFGDIGDDIALVSARAFENAAPDHVVFGAARNLPQLEFEMTLLSWRNHFTCDVFAENGTAHIRSLCKWGPSEFTHRTRVLPSGRPPEATVTLVEDDPTWAAEYAHFKDLCARRQPADLSNDIWLNRVLKRLGTDALREVKR

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
264 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
265 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
266 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.8
Nodule 0.45
Rhizoplane 12.93
Rhizosphere 75.51
Stem 0
Stem Tuber 0
Unclassified 6.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_0241512 3300049822 Bacteria 1536
2 Ga0070676_10001667 3300005328 Bacteria 11299
3 Ga0070690_100068290 3300005330 Bacteria 2305
4 Ga0070670_100003545 3300005331 Bacteria 12980
5 Ga0070677_10041005 3300005333 Bacteria 1825
6 Ga0068869_100179310 3300005334 Bacteria 1660
7 Ga0070680_100097164 3300005336 Bacteria 2442
8 Ga0068868_100118630 3300005338 Bacteria 2156
9 Ga0070660_100187886 3300005339 Bacteria 1673
10 Ga0070689_100039391 3300005340 Bacteria 3618
11 Ga0070668_100018234 3300005347 Bacteria 5266
12 Ga0070669_100007512 3300005353 Bacteria 7807
13 Ga0070669_100478690 3300005353 Bacteria 1030
14 Ga0070675_100000991 3300005354 Bacteria 20340
15 Ga0070688_100331281 3300005365 Bacteria 1109
16 Ga0070667_100024497 3300005367 Bacteria 5012
17 Ga0070667_100288042 3300005367 Bacteria 1476
18 Ga0070714_100004383 3300005435 Bacteria 10631
19 Ga0070713_100033479 3300005436 Bacteria 4117
20 Ga0070713_100161818 3300005436 Bacteria 1999
21 Ga0070713_100194787 3300005436 Bacteria 1828
22 Ga0070710_10004287 3300005437 Bacteria 6764
23 Ga0070710_10010169 3300005437 Bacteria 4615
24 Ga0070710_10026833 3300005437 Bacteria 3065
25 Ga0070701_10113513 3300005438 Bacteria 1517
26 Ga0070701_10162167 3300005438 Bacteria 1296
27 Ga0070711_100049236 3300005439 Bacteria 2885
28 Ga0070711_100078912 3300005439 Bacteria 2340
29 Ga0070708_100214445 3300005445 Bacteria 1804
30 Ga0070663_100181401 3300005455 Bacteria 1633
31 Ga0070663_100244948 3300005455 Unclassified 1416
32 Ga0070678_100082206 3300005456 Bacteria 2445
33 Ga0070678_100127219 3300005456 Bacteria 2019
34 Ga0070662_100070967 3300005457 Bacteria 2567
35 Ga0070681_10095680 3300005458 Bacteria 2918
36 Ga0068867_100132726 3300005459 Bacteria 1937
37 Ga0070706_100002285 3300005467 Bacteria 19368
38 Ga0070706_100086247 3300005467 Bacteria 2909
39 Ga0070706_100172441 3300005467 Bacteria 2020
40 Ga0070706_100231481 3300005467 Bacteria 1725
41 Ga0070707_100000020 3300005468 Bacteria 130967
42 Ga0070707_100194663 3300005468 Bacteria 1977
43 Ga0070698_100045056 3300005471 Bacteria 4515
44 Ga0070698_100150593 3300005471 Unclassified 2274
45 Ga0070698_100479015 3300005471 Unclassified 1181
46 Ga0070699_100015186 3300005518 Bacteria 6617
47 Ga0070697_100010996 3300005536 Bacteria 7071
48 Ga0070697_100018311 3300005536 Bacteria 5521
49 Ga0070697_100042032 3300005536 Bacteria 3700
50 Ga0070672_100004022 3300005543 Bacteria 9588
51 Ga0070686_100195021 3300005544 Bacteria 1448
52 Ga0070696_100000105 3300005546 Bacteria 43214
53 Ga0070696_100008884 3300005546 Bacteria 6722
54 Ga0070704_100027257 3300005549 Bacteria 3787
55 Ga0070704_100157955 3300005549 Bacteria 1790
56 Ga0068855_100106676 3300005563 Unclassified 3219
57 Ga0068854_100136672 3300005578 Bacteria 1877
58 Ga0070702_100139091 3300005615 Bacteria 1544
59 Ga0070702_100160776 3300005615 Bacteria 1452
60 Ga0068852_100003230 3300005616 Bacteria 11382
61 Ga0068852_100082090 3300005616 Unclassified 2863
62 Ga0068861_100063977 3300005719 Bacteria 2829
63 Ga0068870_10003857 3300005840 Bacteria 6393
64 Ga0068863_100052526 3300005841 Bacteria 3862
65 Ga0068863_100406471 3300005841 Bacteria 1332
66 Ga0068860_100000135 3300005843 Bacteria 120265
67 Ga0068862_100205851 3300005844 Bacteria 1776
68 Ga0081455_10023877 3300005937 Bacteria 5679
69 Ga0081455_10222344 3300005937 Bacteria 1398
70 Ga0081540_1000891 3300005983 Bacteria 26991
71 Ga0081540_1037122 3300005983 Bacteria 2587
72 Ga0070717_10000145 3300006028 Bacteria 52677
73 Ga0070717_10000186 3300006028 Bacteria 45360
74 Ga0070717_10199673 3300006028 Bacteria 1751
75 Ga0070717_10215389 3300006028 Bacteria 1687
76 Ga0070717_10282461 3300006028 Bacteria 1472
77 Ga0075365_10046884 3300006038 Bacteria 2840
78 Ga0075368_10002793 3300006042 Bacteria 5763
79 Ga0075368_10003189 3300006042 Bacteria 5449
80 Ga0075364_10048956 3300006051 Bacteria 2755
81 Ga0075364_10091957 3300006051 Bacteria 2013
82 Ga0070715_10008071 3300006163 Bacteria 3654
83 Ga0070715_10058114 3300006163 Bacteria 1688
84 Ga0070715_10112485 3300006163 Bacteria 1286
85 Ga0070716_100011161 3300006173 Bacteria 4522
86 Ga0070712_100002399 3300006175 Bacteria 11534
87 Ga0070712_100021716 3300006175 Bacteria 4220
88 Ga0070712_100089899 3300006175 Bacteria 2247
89 Ga0070712_100125776 3300006175 Bacteria 1936
90 Ga0075367_10181541 3300006178 Bacteria 1312
91 Ga0075427_10001712 3300006194 Unclassified 2855
92 Ga0075366_10005040 3300006195 Bacteria 7136
93 Ga0097621_100154627 3300006237 Bacteria 1968
94 Ga0068871_100462679 3300006358 Bacteria 1138
95 Ga0075428_100031770 3300006844 Bacteria 5832
96 Ga0075428_100202882 3300006844 Bacteria 2143
97 Ga0075428_100345630 3300006844 Bacteria 1597
98 Ga0075428_100448510 3300006844 Bacteria 1382
99 Ga0075428_100463311 3300006844 Bacteria 1357
100 Ga0075431_100071321 3300006847 Bacteria 3584
101 Ga0075431_100151871 3300006847 Bacteria 2384
102 Ga0075433_10005969 3300006852 Bacteria 9590
103 Ga0075434_100054721 3300006871 Bacteria 3964
104 Ga0075434_100070233 3300006871 Bacteria 3492
105 Ga0075435_100194290 3300007076 Bacteria 1718
106 Ga0099794_10055473 3300007265 Unclassified 1915
107 Ga0105240_10002279 3300009093 Bacteria 31086
108 Ga0105240_10015842 3300009093 Bacteria 10228
109 Ga0111539_10303071 3300009094 Bacteria 1859
110 Ga0111539_10457901 3300009094 Bacteria 1486
111 Ga0105245_10022998 3300009098 Bacteria 5468
112 Ga0105245_10056906 3300009098 Bacteria 3516
113 Ga0105245_10182463 3300009098 Unclassified 2006
114 Ga0105247_10156152 3300009101 Bacteria 1507
115 Ga0114129_10012273 3300009147 Bacteria 12191
116 Ga0114129_10069867 3300009147 Bacteria 4896
117 Ga0114129_10074396 3300009147 Bacteria 4732
118 Ga0114129_10078352 3300009147 Bacteria 4597
119 Ga0114129_10340000 3300009147 Unclassified 1991
120 Ga0105243_10218152 3300009148 Bacteria 1684
121 Ga0105241_10023221 3300009174 Bacteria 4598
122 Ga0105242_10025378 3300009176 Bacteria 4690
123 Ga0105248_10076259 3300009177 Bacteria 3768
124 Ga0105237_10003249 3300009545 Bacteria 19433
125 Ga0105238_10124459 3300009551 Bacteria 2558
126 Ga0105239_10020073 3300010375 Bacteria 7373
127 Ga0105239_10110118 3300010375 Bacteria 3052
128 Ga0105246_10190735 3300011119 Unclassified 1586
129 Ga0105246_10379801 3300011119 Bacteria 1167
130 Ga0163162_10165523 3300013306 Bacteria 2335
131 Ga0157375_10293672 3300013308 Bacteria 1788
132 Ga0157380_10010052 3300014326 Bacteria 6792
133 Ga0157379_10513959 3300014968 Bacteria 1111
134 Ga0157376_10490658 3300014969 Bacteria 1205
135 Ga0213872_10002130 3300021361 Bacteria 11892
136 Ga0213872_10007094 3300021361 Bacteria 5541
137 Ga0213872_10025625 3300021361 Bacteria 2710
138 Ga0213876_10002024 3300021384 Bacteria 12078
139 Ga0207692_10005691 3300025898 Bacteria 5007
140 Ga0207692_10018220 3300025898 Bacteria 3148
141 Ga0207642_10124279 3300025899 Bacteria 1336
142 Ga0207688_10077122 3300025901 Bacteria 1899
143 Ga0207680_10013217 3300025903 Bacteria 4233
144 Ga0207685_10003519 3300025905 Bacteria 3823
145 Ga0207685_10015790 3300025905 Bacteria 2401
146 Ga0207699_10000864 3300025906 Bacteria 14437
147 Ga0207645_10002804 3300025907 Bacteria 13542
148 Ga0207684_10000220 3300025910 Bacteria 88359
149 Ga0207684_10046600 3300025910 Bacteria 3678
150 Ga0207684_10093527 3300025910 Bacteria 2564
151 Ga0207684_10272292 3300025910 Bacteria 1461
152 Ga0207654_10022167 3300025911 Bacteria 3385
153 Ga0207654_10139274 3300025911 Bacteria 1545
154 Ga0207695_10000006 3300025913 Bacteria 1135309
155 Ga0207695_10001941 3300025913 Bacteria 32125
156 Ga0207671_10010244 3300025914 Bacteria 7757
157 Ga0207693_10003065 3300025915 Bacteria 14416
158 Ga0207693_10003344 3300025915 Bacteria 13727
159 Ga0207693_10022975 3300025915 Bacteria 4952
160 Ga0207693_10053032 3300025915 Bacteria 3182
161 Ga0207693_10082254 3300025915 Unclassified 2521
162 Ga0207663_10009747 3300025916 Bacteria 5083
163 Ga0207652_10067337 3300025921 Bacteria 3105
164 Ga0207646_10000008 3300025922 Bacteria 457143
165 Ga0207646_10000009 3300025922 Bacteria 453146
166 Ga0207681_10006097 3300025923 Bacteria 7394
167 Ga0207681_10478547 3300025923 Bacteria 1017
168 Ga0207650_10054470 3300025925 Bacteria 2967
169 Ga0207650_10067569 3300025925 Bacteria 2682
170 Ga0207659_10009736 3300025926 Bacteria 6010
171 Ga0207659_10077270 3300025926 Bacteria 2450
172 Ga0207687_10023716 3300025927 Bacteria 4092
173 Ga0207687_10441512 3300025927 Bacteria 1078
174 Ga0207700_10001378 3300025928 Bacteria 13792
175 Ga0207700_10101671 3300025928 Bacteria 2294
176 Ga0207700_10143496 3300025928 Bacteria 1965
177 Ga0207700_10179106 3300025928 Bacteria 1774
178 Ga0207664_10005942 3300025929 Bacteria 8355
179 Ga0207706_10038220 3300025933 Unclassified 4258
180 Ga0207706_10109450 3300025933 Bacteria 2431
181 Ga0207670_10025116 3300025936 Bacteria 3735
182 Ga0207691_10005055 3300025940 Bacteria 12727
183 Ga0207691_10011154 3300025940 Bacteria 8626
184 Ga0207711_10005571 3300025941 Bacteria 10648
185 Ga0207689_10055759 3300025942 Unclassified 3252
186 Ga0207667_10600483 3300025949 Bacteria 1110
187 Ga0207668_10074287 3300025972 Bacteria 2440
188 Ga0207658_10025656 3300025986 Bacteria 4127
189 Ga0207677_10020604 3300026023 Bacteria 4007
190 Ga0207677_10045914 3300026023 Bacteria 2921
191 Ga0207677_10157249 3300026023 Bacteria 1762
192 Ga0207678_10028912 3300026067 Bacteria 4838
193 Ga0207708_10364762 3300026075 Bacteria 1188
194 Ga0207641_10121618 3300026088 Bacteria 2330
195 Ga0207641_10132148 3300026088 Bacteria 2243
196 Ga0207648_10163168 3300026089 Bacteria 1968
197 Ga0207675_100048301 3300026118 Bacteria 3973
198 Ga0207675_100094983 3300026118 Unclassified 2805
199 Ga0207675_100120029 3300026118 Bacteria 2487
200 Ga0207683_10002736 3300026121 Bacteria 15400
201 Ga0207698_10019978 3300026142 Bacteria 4600
202 Ga0207698_10113326 3300026142 Bacteria 2278
203 Ga0209813_10003615 3300027866 Bacteria 3634
204 Ga0207428_10047447 3300027907 Unclassified 3449
205 Ga0268266_10014297 3300028379 Bacteria 6825
206 Ga0268264_10000038 3300028381 Bacteria 383623
207 Ga0265338_10032335 3300028800 Bacteria 5107
208 Ga0265324_10004422 3300029957 Bacteria 6365
209 Ga0265325_10043644 3300031241 Bacteria 2338
210 Ga0265339_10019145 3300031249 Bacteria 4021
211 Ga0265316_10002967 3300031344 Bacteria 17357
212 Ga0307509_10136018 3300031507 Bacteria 2403
213 Ga0265313_10009657 3300031595 Bacteria 6230
214 Ga0307508_10006027 3300031616 Bacteria 11436
215 Ga0307508_10031937 3300031616 Bacteria 4757
216 Ga0307516_10012510 3300031730 Bacteria 9137
217 Ga0307516_10028127 3300031730 Bacteria 5693
218 Ga0307516_10188056 3300031730 Bacteria 1793
219 Ga0307510_10004493 3300033180 Bacteria 16409
220 Ga0307510_10091842 3300033180 Bacteria 2876
221 Ga0373958_0000445 3300034819 Bacteria 5053
222 Ga0373926_0012346 3300035083 Bacteria 2886
223 Ga0373928_0002287 3300035084 Bacteria 3727
224 Ga0373949_0001414 3300035090 Bacteria 6867
225 Ga0373951_0011579 3300035091 Bacteria 1981
226 Ga0373932_0001642 3300035112 Bacteria 6136
227 Ga0373939_0008144 3300035114 Bacteria 2564
228 Ga0373941_0002817 3300035115 Bacteria 3870
229 Ga0373954_0000028 3300035118 Bacteria 56501
230 Ga0373943_0011203 3300035170 Bacteria 4033
231 Ga0373946_0006141 3300035171 Bacteria 4351
232 Ga0373931_0001386 3300035691 Bacteria 10367
233 Ga0373935_0010387 3300035692 Bacteria 5583
234 Ga0373935_0218550 3300035692 Bacteria 1323
235 Ga0373927_0011420 3300035695 Bacteria 5917
236 Ga0373927_0104717 3300035695 Unclassified 1842
237 Ga0373927_0105428 3300035695 Bacteria 1836
238 Ga0373933_0000059 3300035724 Bacteria 65716
239 Ga0373933_0158683 3300035724 Bacteria 1435
240 Ga0373947_0002891 3300035725 Bacteria 10256
241 Ga0373947_0391473 3300035725 Bacteria 936
242 Ga0373937_0006395 3300036401 Bacteria 10164
243 Ga0373937_0224275 3300036401 Bacteria 1769
244 Ga0373937_0577541 3300036401 Bacteria 1067
245 Ga0373925_0020367 3300037068 Bacteria 4828
246 Ga0395899_0001784 3300037312 Bacteria 17829
247 Ga0395900_0001426 3300037418 Bacteria 28527
248 Ga0395898_0001354 3300037466 Bacteria 35337
249 Ga0395905_0097934 3300037471 Bacteria 2754
250 Ga0395901_0004039 3300038443 Bacteria 14780
251 Ga0395901_0024658 3300038443 Bacteria 6176
252 Ga0436365_0115453 3300039437 Bacteria 5274
253 Ga0436365_0176365 3300039437 Bacteria 5950
254 Ga0436361_0154431 3300039447 Bacteria 6839
255 Ga0436361_0207983 3300039447 Bacteria 5842
256 Ga0436361_0303877 3300039447 Unclassified 1055
257 Ga0436361_0477005 3300039447 Bacteria 40055
258 Ga0451577_0000783 3300042876 Bacteria 47827
259 Ga0466966_0068340 3300044684 Bacteria 2231
260 Ga0453684_0015577 3300044712 Bacteria 12002
261 Ga0451576_0000295 3300045051 Bacteria 121139
262 Ga0451576_0106292 3300045051 Bacteria 2920
263 Ga0495603_0075223 3300046455 Bacteria 1983
264 Ga0495629_0022996 3300046459 Bacteria 4443
265 Ga0495629_0047962 3300046459 Bacteria 2995
266 Ga0495629_0056569 3300046459 Unclassified 2742
267 Ga0495641_0008634 3300046461 Bacteria 6171
268 Ga0495651_0032187 3300046462 Bacteria 4091
269 Ga0495651_0241343 3300046462 Unclassified 1239
270 Ga0495653_0009997 3300046463 Bacteria 7762
271 Ga0495653_0134488 3300046463 Bacteria 1746
272 Ga0495582_0003751 3300046473 Bacteria 8564
273 Ga0495662_0037355 3300046476 Bacteria 2346
274 Ga0495664_0024924 3300046477 Bacteria 3479
275 Ga0495584_0002289 3300046491 Bacteria 10926
276 Ga0495594_0002387 3300046499 Bacteria 9784
277 Ga0495606_0066662 3300046507 Bacteria 2282
278 Ga0495618_0009900 3300046514 Bacteria 5769
279 Ga0495628_0107758 3300046516 Bacteria 2145
280 Ga0495630_0028641 3300046517 Bacteria 4138
281 Ga0495630_0115436 3300046517 Bacteria 2035
282 Ga0495648_0032800 3300046524 Bacteria 3402
283 Ga0495652_0065297 3300046529 Bacteria 3058
284 Ga0495640_0004555 3300046533 Bacteria 11049
285 Ga0495586_0008356 3300046535 Bacteria 5509
286 Ga0495587_0088595 3300046536 Bacteria 1790
287 Ga0495587_0212175 3300046536 Unclassified 1093
288 Ga0495656_0168961 3300046615 Bacteria 1068
289 Ga0495634_0083927 3300046642 Unclassified 2078
290 Ga0495634_0127721 3300046642 Bacteria 1623
291 Ga0495634_0137321 3300046642 Bacteria 1555
292 Ga0495634_0226401 3300046642 Bacteria 1152
293 Ga0495635_0021860 3300046663 Bacteria 4459
294 Ga0495635_0171991 3300046663 Bacteria 1473
295 Ga0495646_0053040 3300046680 Bacteria 2447
296 Ga0495647_0086214 3300046681 Bacteria 1281
297 Ga0495658_0000957 3300046683 Bacteria 15363
298 Ga0495658_0094716 3300046683 Bacteria 1774
299 Ga0495613_0000705 3300046689 Bacteria 26320
300 Ga0495624_0079429 3300046690 Bacteria 2034
301 Ga0495581_0011478 3300047315 Bacteria 5127
302 Ga0495581_0022608 3300047315 Bacteria 3643
303 Ga0495604_0104289 3300047317 Bacteria 2078
304 Ga0495604_0168587 3300047317 Unclassified 1542
305 Ga0495636_0022089 3300047318 Bacteria 2571
306 Ga0495674_0001653 3300047319 Bacteria 21923
307 Ga0495676_0030107 3300047321 Bacteria 4613
308 Ga0495676_0042687 3300047321 Bacteria 3720
309 Ga0495676_0075838 3300047321 Bacteria 2570
310 Ga0495680_0040514 3300047322 Bacteria 3711
311 Ga0495675_0157299 3300047444 Bacteria 1401
312 Ga0495684_0066770 3300047471 Bacteria 2735
313 Ga0495684_0120675 3300047471 Bacteria 1974
314 Ga0495686_0011350 3300047472 Bacteria 6280
315 Ga0495614_0045638 3300048089 Bacteria 1879
316 Ga0496100_0054575 3300048903 Bacteria 2606
317 Ga0496100_0063825 3300048903 Bacteria 2435
318 Ga0496100_0273674 3300048903 Bacteria 1256
319 Ga0496101_0016353 3300048904 Bacteria 5009
320 Ga0496101_0149199 3300048904 Bacteria 1787
321 Ga0496101_0268907 3300048904 Bacteria 1330
322 Ga0496102_0047830 3300048905 Bacteria 3888
323 Ga0496102_0078721 3300048905 Bacteria 3035
324 Ga0496103_0164734 3300048906 Bacteria 1422
325 Ga0496104_0002466 3300048907 Bacteria 15943
326 Ga0496104_0005786 3300048907 Bacteria 10821
327 Ga0496104_0041509 3300048907 Bacteria 4314
328 Ga0496104_0062892 3300048907 Bacteria 3519
329 Ga0496104_0302515 3300048907 Bacteria 1511
330 Ga0496105_0018866 3300048908 Bacteria 5555
331 Ga0496105_0027058 3300048908 Bacteria 4681
332 Ga0496105_0028520 3300048908 Bacteria 4564
333 Ga0496105_0069126 3300048908 Bacteria 2918
334 Ga0496105_0129452 3300048908 Bacteria 2081
335 Ga0496106_0120242 3300048909 Bacteria 2052
336 Ga0496106_0165710 3300048909 Bacteria 1749
337 Ga0496107_0086914 3300048910 Bacteria 2283
338 Ga0496108_0000674 3300048911 Bacteria 26407
339 Ga0496108_0021422 3300048911 Bacteria 5314
340 Ga0496108_0029316 3300048911 Bacteria 4555
341 Ga0496108_0031144 3300048911 Bacteria 4424
342 Ga0496108_0068656 3300048911 Bacteria 2990
343 Ga0496108_0118004 3300048911 Bacteria 2274
344 Ga0496109_0008396 3300048912 Bacteria 8779
345 Ga0496109_0031683 3300048912 Bacteria 4747
346 Ga0496109_0069422 3300048912 Bacteria 3231
347 Ga0496109_0098440 3300048912 Bacteria 2711
348 Ga0496110_0002966 3300048913 Bacteria 12866
349 Ga0496110_0005636 3300048913 Bacteria 9826
350 Ga0496110_0030627 3300048913 Bacteria 4639
351 Ga0496110_0040546 3300048913 Bacteria 4058
352 Ga0496111_0019035 3300048914 Bacteria 4762
353 Ga0496111_0053658 3300048914 Bacteria 2913
354 Ga0496111_0078206 3300048914 Unclassified 2412
355 Ga0496111_0197511 3300048914 Bacteria 1496
356 Ga0496111_0256086 3300048914 Bacteria 1298
357 Ga0496112_0011806 3300048915 Bacteria 7996
358 Ga0496112_0027171 3300048915 Bacteria 5517
359 Ga0496112_0032611 3300048915 Bacteria 5058
360 Ga0496112_0042987 3300048915 Bacteria 4423
361 Ga0496112_0094827 3300048915 Bacteria 2955
362 Ga0496112_0109091 3300048915 Unclassified 2738
363 Ga0496112_0199031 3300048915 Unclassified 1963
364 Ga0496112_0215598 3300048915 Bacteria 1876
365 Ga0496112_0302547 3300048915 Bacteria 1545
366 Ga0496113_0021641 3300048916 Bacteria 4538
367 Ga0496113_0062254 3300048916 Bacteria 2817
368 Ga0496113_0103579 3300048916 Bacteria 2207
369 Ga0496113_0133077 3300048916 Bacteria 1952
370 Ga0496114_0013975 3300048917 Bacteria 6435
371 Ga0496114_0056226 3300048917 Bacteria 3283
372 Ga0496115_0079331 3300048918 Bacteria 2672
373 Ga0496117_0168490 3300048920 Bacteria 1274
374 Ga0496121_0033592 3300048924 Bacteria 4638
375 Ga0496125_0001114 3300048928 Bacteria 41120
376 Ga0496125_0007905 3300048928 Bacteria 11232
377 Ga0496126_0059683 3300048929 Bacteria 3434
378 Ga0496126_0098034 3300048929 Bacteria 2568
379 Ga0496126_0188904 3300048929 Bacteria 1746
380 Ga0501036_0205948 3300049572 Bacteria 1654
381 Ga0501038_0218779 3300049574 Bacteria 1520
382 Ga0501039_0112596 3300049575 Bacteria 2128
383 Ga0501043_0195356 3300049579 Bacteria 1572
384 Ga0501046_0123011 3300049580 Bacteria 1973
385 Ga0501047_0032551 3300049581 Bacteria 5033
386 Ga0501070_0072818 3300049586 Bacteria 2844
387 Ga0501073_0328298 3300049589 Bacteria 1056
388 Ga0501075_0159427 3300049591 Bacteria 1721
389 Ga0501080_0024806 3300049742 Bacteria 5561
390 Ga0501083_0063153 3300049744 Bacteria 2470
391 Ga0501035_0144942 3300049822 Bacteria 2063
392 Ga0501044_0171690 3300049823 Bacteria 2139
393 nmdc:mga03683_26187_c1 3300050489 Bacteria 2298
394 nmdc:mga0yw44_219229_c1 3300050492 Bacteria 1260
395 nmdc:mga0yw44_301979_c1 3300050492 Bacteria 1073
396 nmdc:mga0k408_25170_c1 3300050493 Bacteria 3369
397 nmdc:mga06z11_2735_c1 3300050494 Bacteria 6764
398 nmdc:mga06z11_81523_c1 3300050494 Bacteria 1737
399 nmdc:mga04h51_885_c1 3300050495 Bacteria 6895
400 nmdc:mga05p37_64488_c1 3300050507 Bacteria 4507
401 nmdc:mga05p37_7321_c1 3300050507 Bacteria 13025
402 nmdc:mga05p37_84512_c1 3300050507 Bacteria 3910
403 nmdc:mga09592_39667_c1 3300050508 Bacteria 3955
404 nmdc:mga0qj67_19578_c1 3300050509 Bacteria 5172
405 nmdc:mga06r32_56056_c1 3300050510 Unclassified 3782
406 nmdc:mga0n895_124967_c1 3300050512 Bacteria 2596
407 nmdc:mga0n895_181482_c1 3300050512 Bacteria 2136
408 nmdc:mga0n895_35018_c1 3300050512 Bacteria 4837
409 nmdc:mga0n895_427446_c1 3300050512 Bacteria 1339
410 nmdc:mga0n895_4465_c1 3300050512 Bacteria 11499
411 nmdc:mga0n895_571877_c1 3300050512 Bacteria 1134
412 nmdc:mga0rr50_102643_c1 3300050513 Bacteria 2250
413 nmdc:mga0rr50_115944_c1 3300050513 Bacteria 2126
414 nmdc:mga0a205_306523_c1 3300050515 Unclassified 1460
415 Ga0495601_0000106 3300053077 Bacteria 45985
416 Ga0495601_0066974 3300053077 Unclassified 2287
417 Ga0495612_0002101 3300053078 Bacteria 8189
418 Ga0495595_0028393 3300053084 Bacteria 2499
419 Ga0495619_0000186 3300053085 Bacteria 45844
420 Ga0495619_0023399 3300053085 Bacteria 3960
421 Ga0495619_0092756 3300053085 Bacteria 2046
422 Ga0500643_003090 3300053087 Bacteria 8180
423 Ga0500566_0055534 3300053094 Bacteria 2255
424 Ga0500641_0006986 3300053096 Bacteria 4018
425 Ga0500641_0037459 3300053096 Bacteria 1944
426 Ga0500650_0015482 3300053098 Unclassified 3251
427 Ga0500556_0000211 3300053104 Bacteria 47457
428 Ga0500595_000001 3300053119 Bacteria 1088438
429 Ga0500595_008768 3300053119 Bacteria 4113
430 Ga0500595_011005 3300053119 Bacteria 3566
431 Ga0500652_000006 3300053131 Bacteria 167437
432 Ga0500568_0004730 3300053139 Bacteria 7213
433 Ga0500616_0003554 3300053153 Bacteria 11814
434 Ga0500638_102950 3300053162 Bacteria 1329
435 Ga0500636_0011576 3300053177 Bacteria 5165
436 Ga0500661_009765 3300055283 Bacteria 1752
437 Ga0501082_0030036 3300060353 Bacteria 4683
438 2883355225 2883354860 Bacteria 5865246
439 2941534897 2941531003 Bacteria 7653939
440 3005718918 3005718088 Bacteria 8283608
441 8006929504 8006926726 Bacteria 6749210
442 Ga0501035_0241512
443 Ga0070676_10001667
444 Ga0070690_100068290
445 Ga0070670_100003545
446 Ga0070677_10041005
447 Ga0068869_100179310
448 Ga0070680_100097164
449 Ga0068868_100118630
450 Ga0070660_100187886
451 Ga0070689_100039391
452 Ga0070668_100018234
453 Ga0070669_100007512
454 Ga0070669_100478690
455 Ga0070675_100000991
456 Ga0070688_100331281
457 Ga0070667_100024497
458 Ga0070667_100288042
459 Ga0070714_100004383
460 Ga0070713_100033479
461 Ga0070713_100161818
462 Ga0070713_100194787
463 Ga0070710_10004287
464 Ga0070710_10010169
465 Ga0070710_10026833
466 Ga0070701_10113513
467 Ga0070701_10162167
468 Ga0070711_100049236
469 Ga0070711_100078912
470 Ga0070708_100214445
471 Ga0070663_100181401
472 Ga0070663_100244948
473 Ga0070678_100082206
474 Ga0070678_100127219
475 Ga0070662_100070967
476 Ga0070681_10095680
477 Ga0068867_100132726
478 Ga0070706_100002285
479 Ga0070706_100086247
480 Ga0070706_100172441
481 Ga0070706_100231481
482 Ga0070707_100000020
483 Ga0070707_100194663
484 Ga0070698_100045056
485 Ga0070698_100150593
486 Ga0070698_100479015
487 Ga0070699_100015186
488 Ga0070697_100010996
489 Ga0070697_100018311
490 Ga0070697_100042032
491 Ga0070672_100004022
492 Ga0070686_100195021
493 Ga0070696_100000105
494 Ga0070696_100008884
495 Ga0070704_100027257
496 Ga0070704_100157955
497 Ga0068855_100106676
498 Ga0068854_100136672
499 Ga0070702_100139091
500 Ga0070702_100160776
501 Ga0068852_100003230
502 Ga0068852_100082090
503 Ga0068861_100063977
504 Ga0068870_10003857
505 Ga0068863_100052526
506 Ga0068863_100406471
507 Ga0068860_100000135
508 Ga0068862_100205851
509 Ga0081455_10023877
510 Ga0081455_10222344
511 Ga0081540_1000891
512 Ga0081540_1037122
513 Ga0070717_10000145
514 Ga0070717_10000186
515 Ga0070717_10199673
516 Ga0070717_10215389
517 Ga0070717_10282461
518 Ga0075365_10046884
519 Ga0075368_10002793
520 Ga0075368_10003189
521 Ga0075364_10048956
522 Ga0075364_10091957
523 Ga0070715_10008071
524 Ga0070715_10058114
525 Ga0070715_10112485
526 Ga0070716_100011161
527 Ga0070712_100002399
528 Ga0070712_100021716
529 Ga0070712_100089899
530 Ga0070712_100125776
531 Ga0075367_10181541
532 Ga0075427_10001712
533 Ga0075366_10005040
534 Ga0097621_100154627
535 Ga0068871_100462679
536 Ga0075428_100031770
537 Ga0075428_100202882
538 Ga0075428_100345630
539 Ga0075428_100448510
540 Ga0075428_100463311
541 Ga0075431_100071321
542 Ga0075431_100151871
543 Ga0075433_10005969
544 Ga0075434_100054721
545 Ga0075434_100070233
546 Ga0075435_100194290
547 Ga0099794_10055473
548 Ga0105240_10002279
549 Ga0105240_10015842
550 Ga0111539_10303071
551 Ga0111539_10457901
552 Ga0105245_10022998
553 Ga0105245_10056906
554 Ga0105245_10182463
555 Ga0105247_10156152
556 Ga0114129_10012273
557 Ga0114129_10069867
558 Ga0114129_10074396
559 Ga0114129_10078352
560 Ga0114129_10340000
561 Ga0105243_10218152
562 Ga0105241_10023221
563 Ga0105242_10025378
564 Ga0105248_10076259
565 Ga0105237_10003249
566 Ga0105238_10124459
567 Ga0105239_10020073
568 Ga0105239_10110118
569 Ga0105246_10190735
570 Ga0105246_10379801
571 Ga0163162_10165523
572 Ga0157375_10293672
573 Ga0157380_10010052
574 Ga0157379_10513959
575 Ga0157376_10490658
576 Ga0213872_10002130
577 Ga0213872_10007094
578 Ga0213872_10025625
579 Ga0213876_10002024
580 Ga0207692_10005691
581 Ga0207692_10018220
582 Ga0207642_10124279
583 Ga0207688_10077122
584 Ga0207680_10013217
585 Ga0207685_10003519
586 Ga0207685_10015790
587 Ga0207699_10000864
588 Ga0207645_10002804
589 Ga0207684_10000220
590 Ga0207684_10046600
591 Ga0207684_10093527
592 Ga0207684_10272292
593 Ga0207654_10022167
594 Ga0207654_10139274
595 Ga0207695_10000006
596 Ga0207695_10001941
597 Ga0207671_10010244
598 Ga0207693_10003065
599 Ga0207693_10003344
600 Ga0207693_10022975
601 Ga0207693_10053032
602 Ga0207693_10082254
603 Ga0207663_10009747
604 Ga0207652_10067337
605 Ga0207646_10000008
606 Ga0207646_10000009
607 Ga0207681_10006097
608 Ga0207681_10478547
609 Ga0207650_10054470
610 Ga0207650_10067569
611 Ga0207659_10009736
612 Ga0207659_10077270
613 Ga0207687_10023716
614 Ga0207687_10441512
615 Ga0207700_10001378
616 Ga0207700_10101671
617 Ga0207700_10143496
618 Ga0207700_10179106
619 Ga0207664_10005942
620 Ga0207706_10038220
621 Ga0207706_10109450
622 Ga0207670_10025116
623 Ga0207691_10005055
624 Ga0207691_10011154
625 Ga0207711_10005571
626 Ga0207689_10055759
627 Ga0207667_10600483
628 Ga0207668_10074287
629 Ga0207658_10025656
630 Ga0207677_10020604
631 Ga0207677_10045914
632 Ga0207677_10157249
633 Ga0207678_10028912
634 Ga0207708_10364762
635 Ga0207641_10121618
636 Ga0207641_10132148
637 Ga0207648_10163168
638 Ga0207675_100048301
639 Ga0207675_100094983
640 Ga0207675_100120029
641 Ga0207683_10002736
642 Ga0207698_10019978
643 Ga0207698_10113326
644 Ga0209813_10003615
645 Ga0207428_10047447
646 Ga0268266_10014297
647 Ga0268264_10000038
648 Ga0265338_10032335
649 Ga0265324_10004422
650 Ga0265325_10043644
651 Ga0265339_10019145
652 Ga0265316_10002967
653 Ga0307509_10136018
654 Ga0265313_10009657
655 Ga0307508_10006027
656 Ga0307508_10031937
657 Ga0307516_10012510
658 Ga0307516_10028127
659 Ga0307516_10188056
660 Ga0307510_10004493
661 Ga0307510_10091842
662 Ga0373958_0000445
663 Ga0373926_0012346
664 Ga0373928_0002287
665 Ga0373949_0001414
666 Ga0373951_0011579
667 Ga0373932_0001642
668 Ga0373939_0008144
669 Ga0373941_0002817
670 Ga0373954_0000028
671 Ga0373943_0011203
672 Ga0373946_0006141
673 Ga0373931_0001386
674 Ga0373935_0010387
675 Ga0373935_0218550
676 Ga0373927_0011420
677 Ga0373927_0104717
678 Ga0373927_0105428
679 Ga0373933_0000059
680 Ga0373933_0158683
681 Ga0373947_0002891
682 Ga0373947_0391473
683 Ga0373937_0006395
684 Ga0373937_0224275
685 Ga0373937_0577541
686 Ga0373925_0020367
687 Ga0395899_0001784
688 Ga0395900_0001426
689 Ga0395898_0001354
690 Ga0395905_0097934
691 Ga0395901_0004039
692 Ga0395901_0024658
693 Ga0436365_0115453
694 Ga0436365_0176365
695 Ga0436361_0154431
696 Ga0436361_0207983
697 Ga0436361_0303877
698 Ga0436361_0477005
699 Ga0451577_0000783
700 Ga0466966_0068340
701 Ga0453684_0015577
702 Ga0451576_0000295
703 Ga0451576_0106292
704 Ga0495603_0075223
705 Ga0495629_0022996
706 Ga0495629_0047962
707 Ga0495629_0056569
708 Ga0495641_0008634
709 Ga0495651_0032187
710 Ga0495651_0241343
711 Ga0495653_0009997
712 Ga0495653_0134488
713 Ga0495582_0003751
714 Ga0495662_0037355
715 Ga0495664_0024924
716 Ga0495584_0002289
717 Ga0495594_0002387
718 Ga0495606_0066662
719 Ga0495618_0009900
720 Ga0495628_0107758
721 Ga0495630_0028641
722 Ga0495630_0115436
723 Ga0495648_0032800
724 Ga0495652_0065297
725 Ga0495640_0004555
726 Ga0495586_0008356
727 Ga0495587_0088595
728 Ga0495587_0212175
729 Ga0495656_0168961
730 Ga0495634_0083927
731 Ga0495634_0127721
732 Ga0495634_0137321
733 Ga0495634_0226401
734 Ga0495635_0021860
735 Ga0495635_0171991
736 Ga0495646_0053040
737 Ga0495647_0086214
738 Ga0495658_0000957
739 Ga0495658_0094716
740 Ga0495613_0000705
741 Ga0495624_0079429
742 Ga0495581_0011478
743 Ga0495581_0022608
744 Ga0495604_0104289
745 Ga0495604_0168587
746 Ga0495636_0022089
747 Ga0495674_0001653
748 Ga0495676_0030107
749 Ga0495676_0042687
750 Ga0495676_0075838
751 Ga0495680_0040514
752 Ga0495675_0157299
753 Ga0495684_0066770
754 Ga0495684_0120675
755 Ga0495686_0011350
756 Ga0495614_0045638
757 Ga0496100_0054575
758 Ga0496100_0063825
759 Ga0496100_0273674
760 Ga0496101_0016353
761 Ga0496101_0149199
762 Ga0496101_0268907
763 Ga0496102_0047830
764 Ga0496102_0078721
765 Ga0496103_0164734
766 Ga0496104_0002466
767 Ga0496104_0005786
768 Ga0496104_0041509
769 Ga0496104_0062892
770 Ga0496104_0302515
771 Ga0496105_0018866
772 Ga0496105_0027058
773 Ga0496105_0028520
774 Ga0496105_0069126
775 Ga0496105_0129452
776 Ga0496106_0120242
777 Ga0496106_0165710
778 Ga0496107_0086914
779 Ga0496108_0000674
780 Ga0496108_0021422
781 Ga0496108_0029316
782 Ga0496108_0031144
783 Ga0496108_0068656
784 Ga0496108_0118004
785 Ga0496109_0008396
786 Ga0496109_0031683
787 Ga0496109_0069422
788 Ga0496109_0098440
789 Ga0496110_0002966
790 Ga0496110_0005636
791 Ga0496110_0030627
792 Ga0496110_0040546
793 Ga0496111_0019035
794 Ga0496111_0053658
795 Ga0496111_0078206
796 Ga0496111_0197511
797 Ga0496111_0256086
798 Ga0496112_0011806
799 Ga0496112_0027171
800 Ga0496112_0032611
801 Ga0496112_0042987
802 Ga0496112_0094827
803 Ga0496112_0109091
804 Ga0496112_0199031
805 Ga0496112_0215598
806 Ga0496112_0302547
807 Ga0496113_0021641
808 Ga0496113_0062254
809 Ga0496113_0103579
810 Ga0496113_0133077
811 Ga0496114_0013975
812 Ga0496114_0056226
813 Ga0496115_0079331
814 Ga0496117_0168490
815 Ga0496121_0033592
816 Ga0496125_0001114
817 Ga0496125_0007905
818 Ga0496126_0059683
819 Ga0496126_0098034
820 Ga0496126_0188904
821 Ga0501036_0205948
822 Ga0501038_0218779
823 Ga0501039_0112596
824 Ga0501043_0195356
825 Ga0501046_0123011
826 Ga0501047_0032551
827 Ga0501070_0072818
828 Ga0501073_0328298
829 Ga0501075_0159427
830 Ga0501080_0024806
831 Ga0501083_0063153
832 Ga0501035_0144942
833 Ga0501044_0171690
834 nmdc:mga03683_26187_c1
835 nmdc:mga0yw44_219229_c1
836 nmdc:mga0yw44_301979_c1
837 nmdc:mga0k408_25170_c1
838 nmdc:mga06z11_2735_c1
839 nmdc:mga06z11_81523_c1
840 nmdc:mga04h51_885_c1
841 nmdc:mga05p37_64488_c1
842 nmdc:mga05p37_7321_c1
843 nmdc:mga05p37_84512_c1
844 nmdc:mga09592_39667_c1
845 nmdc:mga0qj67_19578_c1
846 nmdc:mga06r32_56056_c1
847 nmdc:mga0n895_124967_c1
848 nmdc:mga0n895_181482_c1
849 nmdc:mga0n895_35018_c1
850 nmdc:mga0n895_427446_c1
851 nmdc:mga0n895_4465_c1
852 nmdc:mga0n895_571877_c1
853 nmdc:mga0rr50_102643_c1
854 nmdc:mga0rr50_115944_c1
855 nmdc:mga0a205_306523_c1
856 Ga0495601_0000106
857 Ga0495601_0066974
858 Ga0495612_0002101
859 Ga0495595_0028393
860 Ga0495619_0000186
861 Ga0495619_0023399
862 Ga0495619_0092756
863 Ga0500643_003090
864 Ga0500566_0055534
865 Ga0500641_0006986
866 Ga0500641_0037459
867 Ga0500650_0015482
868 Ga0500556_0000211
869 Ga0500595_000001
870 Ga0500595_008768
871 Ga0500595_011005
872 Ga0500652_000006
873 Ga0500568_0004730
874 Ga0500616_0003554
875 Ga0500638_102950
876 Ga0500636_0011576
877 Ga0500661_009765
878 Ga0501082_0030036
879 2883355225
880 2941534897
881 3005718918
882 8006929504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

132

226

0.88

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

5

120

0.82

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

128

245

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6a3j-assembly1.cif.gz_D levoglucosan dehydrogenase, complex with nadh and l-sorbose 0.8445 1 308
1rye-assembly1.cif.gz_D crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis 0.842 1 308
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8412 1 302
6a3g-assembly1.cif.gz_B levoglucosan dehydrogenase, complex with nadh 0.8395 1 308
3db2-assembly1.cif.gz_C-2 crystal structure of a putative nadph-dependent oxidoreductase (dhaf_2064) from desulfitobacterium hafniense dcb-2 at 1.70 a resolution 0.8394 3 308
ID Description Score Start End Superfamily
af_B0S5N7_2_137_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8609 1 121 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8569 1 101 3.40.50.720
af_B0S5N7_5_117_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8521 5 102 3.40.50.720
af_D4A903_1_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8503 1 101 3.40.50.720
af_F1R9L8_3_129_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.85 2 103 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7Z9GM10-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.99 1 110 GO:0000166
AF-A0A7Z9GM10-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9812 1 110 GO:0000166
AF-A0A1G1IH94-F1-model_v4 Oxidoreductase 0.98 1 310 GO:0000166
GO:0016491
AF-A0A2V6QZ98-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.958 1 301 GO:0000166
GO:0016491
AF-A0A6H1Q402-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9558 1 303 GO:0000166
GO:0016491

Map